Search Results

Search found 74473 results on 2979 pages for 'data table'.

Page 218/2979 | < Previous Page | 214 215 216 217 218 219 220 221 222 223 224 225  | Next Page >

  • Recover partition table after DD command

    - by Shreedhar
    I executed the following command from a Ubuntu live cd terminal (dont ask why). dd if=/dev/zero of=/dev/sdb2 bs=512 count=1 Where sdb2 is a NTFS partition (third partition) on a disk. Suffice to say it is now messed up. When I boot into windows 7, it does show me E drive but when I click on it it asks me to format it. I am not ever sure what I did, did I mess up partition table or only the MFT? Is there any way to get the data back PLEASE HELP! this is very important :(

    Read the article

  • MS Word showing unwanted table borders on screen (but not on print preview)

    - by Jivlain
    I have a MS Word document with a number of tables. The other day when I created it, the tables all had no borders. Today, I opened it up to find that the tables did have borders. However, when I check the border properties on each table, it says that there are no borders. The tables are displayed with cell borders in all view modes except for the reading layout, and they do not show up on print preview. As this document is going to generally be for on-screen viewing, I need to get rid of the borders. How can I accomplish this? (this is a MS Word 2003 *.doc document, in MS Word 2003, which has been the only editor involved.)

    Read the article

  • Some strange things in the db table of mysql database

    - by 0al0
    I noticed some weird things in the db table of mysql database in a client's server, after having the Mysql service stopping for no reason what are the test, and test_% entries? Why are there two entries for the database AQUA? Why is there a entry with a blank name? Should I worry about any of those? What should I do for each specific case? Is it safe to just delete the ones that should not be there, after backing up?

    Read the article

  • Network Table assistance

    - by mitchnufc
    I am designing a small network and have came up with the following table I am just wondering if this seems right, would appreciate some feedback, thanks. Network/Router First IP Last IP Subnet Host Broadcast Router 1 162.10.0.1 162.10.0.7 255.255.255.248 162.10.0.0 162.10.0.8 Network 1 162.10.1.1 162.10.2.253 255.255.254.0 162.10.1.0 162.10.2.254 Network 2 162.10.0.9 162.10.0.14 255.255.255.248 162.10.0.8 162.10.0.15 Router 2 162.10.0.17 162.10.0.18 255.255.255.252 162.10.0.16 162.10.0.19 Network 3 162.10.0.21 162.10.0.146 255.255.255.128 162.10.0.20 162.10.0.147 Router one is the IP assigned by the ISP

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • SQL SERVER – Weekly Series – Memory Lane – #032

    - by Pinal Dave
    Here is the list of selected articles of SQLAuthority.com across all these years. Instead of just listing all the articles I have selected a few of my most favorite articles and have listed them here with additional notes below it. Let me know which one of the following is your favorite article from memory lane. 2007 Complete Series of Database Coding Standards and Guidelines SQL SERVER Database Coding Standards and Guidelines – Introduction SQL SERVER – Database Coding Standards and Guidelines – Part 1 SQL SERVER – Database Coding Standards and Guidelines – Part 2 SQL SERVER Database Coding Standards and Guidelines Complete List Download Explanation and Example – SELF JOIN When all of the data you require is contained within a single table, but data needed to extract is related to each other in the table itself. Examples of this type of data relate to Employee information, where the table may have both an Employee’s ID number for each record and also a field that displays the ID number of an Employee’s supervisor or manager. To retrieve the data tables are required to relate/join to itself. Insert Multiple Records Using One Insert Statement – Use of UNION ALL This is very interesting question I have received from new developer. How can I insert multiple values in table using only one insert? Now this is interesting question. When there are multiple records are to be inserted in the table following is the common way using T-SQL. Function to Display Current Week Date and Day – Weekly Calendar Straight blog post with script to find current week date and day based on the parameters passed in the function.  2008 In my beginning years, I have almost same confusion as many of the developer had in their earlier years. Here are two of the interesting question which I have attempted to answer in my early year. Even if you are experienced developer may be you will still like to read following two questions: Order Of Column In Index Order of Conditions in WHERE Clauses Example of DISTINCT in Aggregate Functions Have you ever used DISTINCT with the Aggregation Function? Here is a simple example about how users can do it. Create a Comma Delimited List Using SELECT Clause From Table Column Straight to script example where I explained how to do something easy and quickly. Compound Assignment Operators SQL SERVER 2008 has introduced new concept of Compound Assignment Operators. Compound Assignment Operators are available in many other programming languages for quite some time. Compound Assignment Operators is operator where variables are operated upon and assigned on the same line. PIVOT and UNPIVOT Table Examples Here is a very interesting question – the answer to the question can be YES or NO both. “If we PIVOT any table and UNPIVOT that table do we get our original table?” Read the blog post to get the explanation of the question above. 2009 What is Interim Table – Simple Definition of Interim Table The interim table is a table that is generated by joining two tables and not the final result table. In other words, when two tables are joined they create an interim table as resultset but the resultset is not final yet. It may be possible that more tables are about to join on the interim table, and more operations are still to be applied on that table (e.g. Order By, Having etc). Besides, it may be possible that there is no interim table; sometimes final table is what is generated when the query is run. 2010 Stored Procedure and Transactions If Stored Procedure is transactional then, it should roll back complete transactions when it encounters any errors. Well, that does not happen in this case, which proves that Stored Procedure does not only provide just the transactional feature to a batch of T-SQL. Generate Database Script for SQL Azure When talking about SQL Azure the most common complaint I hear is that the script generated from stand-along SQL Server database is not compatible with SQL Azure. This was true for some time for sure but not any more. If you have SQL Server 2008 R2 installed you can follow the guideline below to generate a script which is compatible with SQL Azure. Convert IN to EXISTS – Performance Talk It is NOT necessary that every time when IN is replaced by EXISTS it gives better performance. However, in our case listed above it does for sure give better performance. You can read about this subject in the associated blog post. Subquery or Join – Various Options – SQL Server Engine Knows the Best Every single time whenever there is a performance tuning exercise, I hear the conversation from developer where some prefer subquery and some prefer join. In this two part blog post, I explain the same in the detail with examples. Part 1 | Part 2 Merge Operations – Insert, Update, Delete in Single Execution MERGE is a new feature that provides an efficient way to do multiple DML operations. In earlier versions of SQL Server, we had to write separate statements to INSERT, UPDATE, or DELETE data based on certain conditions; however, at present, by using the MERGE statement, we can include the logic of such data changes in one statement that even checks when the data is matched and then just update it, and similarly, when the data is unmatched, it is inserted. 2011 Puzzle – Statistics are not updated but are Created Once Here is the quick scenario about my setup. Create Table Insert 1000 Records Check the Statistics Now insert 10 times more 10,000 indexes Check the Statistics – it will be NOT updated – WHY? Question to You – When to use Function and When to use Stored Procedure Personally, I believe that they are both different things - they cannot be compared. I can say, it will be like comparing apples and oranges. Each has its own unique use. However, they can be used interchangeably at many times and in real life (i.e., production environment). I have personally seen both of these being used interchangeably many times. This is the precise reason for asking this question. 2012 In year 2012 I had two interesting series ran on the blog. If there is no fun in learning, the learning becomes a burden. For the same reason, I had decided to build a three part quiz around SEQUENCE. The quiz was to identify the next value of the sequence. I encourage all of you to take part in this fun quiz. Guess the Next Value – Puzzle 1 Guess the Next Value – Puzzle 2 Guess the Next Value – Puzzle 3 Guess the Next Value – Puzzle 4 Simple Example to Configure Resource Governor – Introduction to Resource Governor Resource Governor is a feature which can manage SQL Server Workload and System Resource Consumption. We can limit the amount of CPU and memory consumption by limiting /governing /throttling on the SQL Server. If there are different workloads running on SQL Server and each of the workload needs different resources or when workloads are competing for resources with each other and affecting the performance of the whole server resource governor is a very important task. Tricks to Replace SELECT * with Column Names – SQL in Sixty Seconds #017 – Video  Retrieves unnecessary columns and increases network traffic When a new columns are added views needs to be refreshed manually Leads to usage of sub-optimal execution plan Uses clustered index in most of the cases instead of using optimal index It is difficult to debug SQL SERVER – Load Generator – Free Tool From CodePlex The best part of this SQL Server Load Generator is that users can run multiple simultaneous queries again SQL Server using different login account and different application name. The interface of the tool is extremely easy to use and very intuitive as well. A Puzzle – Swap Value of Column Without Case Statement Let us assume there is a single column in the table called Gender. The challenge is to write a single update statement which will flip or swap the value in the column. For example if the value in the gender column is ‘male’ swap it with ‘female’ and if the value is ‘female’ swap it with ‘male’. Reference: Pinal Dave (http://blog.sqlauthority.com) Filed under: Memory Lane, PostADay, SQL, SQL Authority, SQL Query, SQL Server, SQL Tips and Tricks, T SQL, Technology

    Read the article

  • JSF 2.0: java based custom component + html table + facelets = data model not updated

    - by mikic
    Hi, I'm having problems getting the data model of a HtmlDataTable to be correctly updated by JSF 2.0 and Facelets. I have created a custom Java-based component that extends HtmlDataTable and dynamically adds columns in the encodeBegin method. @Override public void encodeBegin(FacesContext context) throws IOException { if (this.findComponent("c0") == null) { for (int i = 0; i < 3; i++) { HtmlColumn myNewCol = new HtmlColumn(); myNewCol.setId("c" + i); HtmlInputText myNewText = new HtmlInputText(); myNewText.setId("t" + i); myNewText.setValue("#{row[" + i + "]}"); myNewCol.getChildren().add(myNewText); this.getChildren().add(myNewCol); } } super.encodeBegin(context); } My test page contains the following <h:form id="fromtb"> <test:MatrixTest id="tb" var="row" value="#{MyManagedBean.model}"> </test:MatrixTest> <h:commandButton id="btn" value="Set" action="#{MyManagedBean.mergeInput}"/> </h:form> <h:outputText id="mergedInput" value="#{MyManagedBean.mergedInput}"/> My managed bean class contains the following @ManagedBean(name="MyManagedBean") @SessionScoped public class MyManagedBean { private List model = null; private String mergedInput = null; public MyManagedBean() { model = new ArrayList(); List myFirst = new ArrayList(); myFirst.add(""); myFirst.add(""); myFirst.add(""); model.add(myFirst); List mySecond = new ArrayList(); mySecond.add(""); mySecond.add(""); mySecond.add(""); model.add(mySecond); } public String mergeInput() { StringBuffer myMergedInput = new StringBuffer(); for (Object object : model) { myMergedInput.append(object); } setMergedInput(myMergedInput.toString()); return null; } public List getModel() { return model; } public void setModel(List model) { this.model = model; } public String getMergedInput() { return mergedInput; } public void setMergedInput(String mergedInput) { this.mergedInput = mergedInput; } When invoked, the page is correctly rendered with a table made of 3 columns (added at runtime) and 2 rows (as my data model has 2 rows). However when the user enter some data in the input fields and then click the submit button, the model is not correctly updated and therefore the mergeInput() method creates a sequence of empty strings which is rendered on the same page. I have added some logging to the decode() method of my custom component and I can see that the parameters entered by the user are being posted back with the request, however these parameters are not used to update the data model. If I update the encodeBegin() method of my custom component as follow @Override public void encodeBegin(FacesContext context) throws IOException { super.encodeBegin(context); } and I update the test page as follow <test:MatrixTest id="tb" var="row" value="#{MyManagedBean.model}"> <h:column id="c0"><h:inputText id="t0" value="#{row[0]}"/></h:column> <h:column id="c1"><h:inputText id="t1" value="#{row[1]}"/></h:column> <h:column id="c2"><h:inputText id="t2" value="#{row[2]}"/></h:column> </test:MatrixTest> the page is correctly rendered and this time when the user enters data and submits the form, the underlying data model is correctly updated and the mergeInput() method creates a sequence of strings with the user data. Why does the test case with columns declared in the facelet page works correctly (ie the data model is correctly updated by JSF) where the same does not happen when the columns are created at runtime using the encodeBegin() method? Is there any method I need to invoke or interface I need to extend in order to ensure the data model is correctly updated? I am using this test case to address the issue that is appearing in a much more complex component, therefore I can't achieve the same functionality using a facelet composite component. Please note that this has been done using NetBeans 6.8, JRE 1.6.0u18, GlassFish 3.0. Thanks for your help.

    Read the article

  • d:DesignData issue, Visual Studio 2010 cant build after adding sample design data with Expression Bl

    - by Valko
    Hi, VS 2010 solution and Silverlight project builds fine, then: I open MyView.xaml view in Expression Blend 4 Add sample data from class (I use my class defined in the same project) after I add new sample design data with Expression blend 4, everything looks fine, you see the added sample data in the EB 4 fine, you also see the data in VS 2010 designer too. Close the EB 4, and next VS 2010 build is giving me this errors: Error 7 XAML Namespace http://schemas.microsoft.com/expression/blend/2008 is not resolved. C:\Code\source\...myview.xaml and: Error 12 Object reference not set to an instance of an object. ... TestSampleData.xaml when I open the TestSampleData.xaml I see that namespace for my class used to define sample data is not recognized. However this namespace and the class itself exist in the same project! If I remove the design data from the MyView.xaml: d:DataContext="{d:DesignData /SampleData/TestSampleData.xaml}" it builds fine and the namespace in TestSampleData.xaml is recognized this time?? and then if add: d:DataContext="{d:DesignData /SampleData/TestSampleData.xaml}" I again see in the VS 2010 designer sample data, but the next build fails and again I see studio cant find the namespace in my TestSampleData.xaml containing sample data. That cycle is driving me crazy. Am I missing something here, is it not possible to have your class defining sample design data in the same project you have the MyView.xaml view?? cheers Valko

    Read the article

  • SQL Server Clustered Index: (Physical) Data Page Order

    - by scherand
    I am struggling understanding what a clustered index in SQL Server 2005 is. I read the MSDN article Clustered Index Structures (among other things) but I am still unsure if I understand it correctly. The (main) question is: what happens if I insert a row (with a "low" key) into a table with a clustered index? The above mentioned MSDN article states: The pages in the data chain and the rows in them are ordered on the value of the clustered index key. And Using Clustered Indexes for example states: For example, if a record is added to the table that is close to the beginning of the sequentially ordered list, any records in the table after that record will need to shift to allow the record to be inserted. Does this mean that if I insert a row with a very "low" key into a table that already contains a gazillion rows literally all rows are physically shifted on disk? I cannot believe that. This would take ages, no? Or is it rather (as I suspect) that there are two scenarios depending on how "full" the first data page is. A) If the page has enough free space to accommodate the record it is placed into the existing data page and data might be (physically) reordered within that page. B) If the page does not have enough free space for the record a new data page would be created (anywhere on the disk!) and "linked" to the front of the leaf level of the B-Tree? This would then mean the "physical order" of the data is restricted to the "page level" (i.e. within a data page) but not to the pages residing on consecutive blocks on the physical hard drive. The data pages are then just linked together in the correct order. Or formulated in an alternative way: if SQL Server needs to read the first N rows of a table that has a clustered index it can read data pages sequentially (following the links) but these pages are not (necessarily) block wise in sequence on disk (so the disk head has to move "randomly"). How close am I? :)

    Read the article

  • storing/retrieving data for graph with long continuous stretches

    - by james
    i have a large 2-dimensional data set which i would like to graph. the graph is displayed in a browser and the data is retrieved via ajax. long stretches of this graph will be continuous - e.g., for x=0 through x=1000, y=9, then for x=1001 through x=1100, y=80, etc. the approach i'm considering is to send (from the server) and store (in the browser) only the points where the data changes. so for the example above, i would say data[0] = 9, then data[1001] = 80. then given x=999 for example, retrieving data[999] would actually look up data[0]. the problem that arises is finding a dictionary-like data structure which behaves like this. the approach i'm considering is to store the data in a traditional dictionary object, then also maintain a sorted array of key for that object. when given x=999, it would look at the mid-point of this array, determine whether the nearest lower key is left or right of that midpoint, then repeat with the correct subsection, etc.. does anyone have thoughts on this problem/approach?

    Read the article

  • Dojox Datagrid contains data, but shows up as empty

    - by Vivek
    I'd really appreciate any help on this. There is this Dojox Datagrid that I'm creating programatically and supplying JSON data. As of now, I'm creating this data within JavaScript itself. Please refer to the below code sample. var upgradeStageStructure =[{ cells:[ { field: "stage", name: "Stage", width: "50%", styles: 'text-align: left;' }, { field:"status", name: "Status", width: "50%", styles: 'text-align: left;' } ] }]; var upgradeStageData = [ {id:1, stage: "Preparation", status: "Complete"}, {id:2, stage: "Formatting", status: "Complete"}, {id:3, stage: "OS Installation", status: "Complete"}, {id:4, stage: "OS Post-Installation", status: "In Progress"}, {id:5, stage: "Application Installation", status: "Not Started"}, {id:6, stage: "Application Post-Installation", status: "Not Started"} ]; var stagestore = new dojo.data.ItemFileReadStore({data:{identifier:"id", items: upgradeStageData}}); var upgradeStatusGrid = new dojox.grid.DataGrid({ autoHeight: true, style: "width:400px;padding:0em;margin:0em;", store: stagestore, clientSort: false, rowSelector: '20px', structure: upgradeStageStructure, columnReordering: false, selectable: false, singleClickEdit: false, selectionMode: 'none', loadingMessage: 'Loading Upgrade Stages', noDataMessage:'There is no data', errorMessage: 'Failed to load Upgrade Status' }); dojo.byId('progressIndicator').innerHTML=''; dojo.byId('progressIndicator').appendChild(upgradeStatusGrid.domNode); upgradeStatusGrid.startup(); The problem is that I am not seeing anything within the grid upon display (no headers, no data). But I know for sure that the data in the grid does exist and the grid is properly initialized, because I called alert (grid.domNode.innerHTML);. The resultant HTML that is thrown up does show a table containing header rows and the above data. This link contains an image which illustrates what I'm seeing when I display the page. (Can't post images since my account is new here) As you may notice, there are 6 rows for 6 pieces of data I have created but the grid is a mess. Please help out if you think you know what could be going wrong. Thanks in advance, Viv

    Read the article

  • rpy2: Converting a data.frame to a numpy array

    - by Mike Dewar
    I have a data.frame in R. It contains a lot of data : gene expression levels from many (125) arrays. I'd like the data in Python, due mostly to my incompetence in R and the fact that this was supposed to be a 30 minute job. I would like the following code to work. To understand this code, know that the variable path contains the full path to my data set which, when loaded, gives me a variable called immgen. Know that immgen is an object (a Bioconductor ExpressionSet object) and that exprs(immgen) returns a data frame with 125 columns (experiments) and tens of thousands of rows (named genes). robjects.r("load('%s')"%path) # loads immgen e = robjects.r['data.frame']("exprs(immgen)") expression_data = np.array(e) This code runs, but expression_data is simply array([[1]]). I'm pretty sure that e doesn't represent the data frame generated by exprs() due to things like: In [40]: e._get_ncol() Out[40]: 1 In [41]: e._get_nrow() Out[41]: 1 But then again who knows? Even if e did represent my data.frame, that it doesn't convert straight to an array would be fair enough - a data frame has more in it than an array (rownames and colnames) and so maybe life shouldn't be this easy. However I still can't work out how to perform the conversion. The documentation is a bit too terse for me, though my limited understanding of the headings in the docs implies that this should be possible. Anyone any thoughts?

    Read the article

  • How to find the latest row for each group of data

    - by Jason
    Hi All, I have a tricky problem that I'm trying to find the most effective method to solve. Here's a simplified version of my View structure. Table: Audits AuditID | PublicationID | AuditEndDate | AuditStartDate 1 | 3 | 13/05/2010 | 01/01/2010 2 | 1 | 31/12/2009 | 01/10/2009 3 | 3 | 31/03/2010 | 01/01/2010 4 | 3 | 31/12/2009 | 01/10/2009 5 | 2 | 31/03/2010 | 01/01/2010 6 | 2 | 31/12/2009 | 01/10/2009 7 | 1 | 30/09/2009 | 01/01/2009 There's 3 query's that I need from this. I need to one to get all the data. The next to get only the history data (that is, everything but exclude the latest data item by AuditEndDate) and then the last query is to obtain the latest data item (by AuditEndDate). There's an added layer of complexity that I have a date restriction (This is on a per user/group basis) where certain user groups can only see between certain dates. You'll notice this in the where clause as AuditEndDate<=blah and AuditStartDate=blah Foreach publication, select all the data available. select * from Audits Where auditEndDate<='31/03/10' and AuditStartDate='06/06/2009'; foreach publication, select all the data but Exclude the latest data available (by AuditEndDate) select * from Audits left join (select AuditId as aid, publicationID as pid and max(auditEndDate) as pend from Audit where auditenddate <= '31/03/2009' /* user restrict / group by pid) Ax on Ax.pid=Audit.pubid where pend!=Audits.auditenddate AND auditEndDate<='31/03/10' and AuditStartDate='06/06/2009' / user restrict */ Foreach publication, select only the latest data available (by AuditEndDate) select * from Audits left join (select AuditId as aid, publicationID as pid and max(auditEndDate) as pend from Audit where auditenddate <= '31/03/2009'/* user restrict / group by pid) Ax on Ax.pid=Audit.pubid where pend=Audits.auditenddate AND auditEndDate<='31/03/10' and AuditStartDate='06/06/2009' / user restrict */ So at the moment, query 1 and 3 work fine, but query 2 just returns all the data instead of the restriction. Can anyone help me? Thanks jason

    Read the article

  • Multiple calls to data service from SL3?

    - by Chris
    I have an SL3 that makes asynchronous calls to a data service. Basically, there is a treeview that is bound to a collection of objects. The idea is that as a user selects a specific treeviewitem, a call is made to the data service, with a parameter specific to the selected treeviewitem being passed to the corresponding web method in the data service. The data service returns data back to the SL3 client, and the client presents the data to the user. This works well. The problem is that when users start to navigate through the treeview using the arrow keys on their keyboard, they could press the down arrow key, for example, 10 times, and 10 calls will be made to the data service, and then each of the 10 items will be displayed to the user momentarily, until finishing with the data for the most recently selected treeview item. So - onto the question. How can I put in some form of delay, to allow someone to navigate quickly through a treeview, then, once then stop at a certain treeviewitem, a call is made to the data service? Thanks for any suggestions. Chris

    Read the article

  • Getting zeros between data while reading a binary file in C

    - by indiajoe
    I have a binary data which I am reading into an array of long integers using a C programme. hexdump of the binary data shows, that after first few data points , it starts again at a location 20000 hexa adresses away. hexdump output is as shown below. 0000000 0000 0000 0000 0000 0000 0000 0000 0000 * 0020000 0000 0000 0053 0000 0064 0000 006b 0000 0020010 0066 0000 0068 0000 0066 0000 005d 0000 0020020 0087 0000 0059 0000 0062 0000 0066 0000 ........ and so on... But when I read it into an array 'data' of long integers. by the typical fread command fread(data,sizeof(*data),filelength/sizeof(*data),fd); It is filling up with all zeros in my data array till it reaches the 20000 location. After that it reads in data correctly. Why is it reading regions where my file is not there? Or how will I make it read only my file, not anything inbetween which are not in file? I know it looks like a trivial problem, but I cannot figure it out even after googling one night.. Can anyone suggest me where I am doing it wrong? Other Info : I am working on a gnu/linux machine. (slax-atma distro to be specific) My C compiler is gcc.

    Read the article

  • memcache is not storing data accross requests

    - by morpheous
    I am new to using memcache, so I may be doing something wrong. I have written a wrapper class around memcache. The wrapper class has only static methods, so is a quasi singleton. The class looks something like this: class myCache { private static $memcache = null; private static $initialized = false; public static function init() { if (self::$initialized) return; self::$memcache = new Memcache(); if (self::configure()) //connects to daemon { self::store('foo', 'bar'); } else throw ConnectionError('I barfed'); } public static function store($key, $data, $flag=MEMCACHE_COMPRESSED, $timeout=86400) { if (self::$memcache->get($key)!== false) return self::$memcache->replace($key, $data, $flag, $timeout); return self::$memcache->set($key, $data, $flag, $timeout); } public static function fetch($key) { return self::$memcache->get($key); } } //in my index.php file, I use the class like this require_once('myCache.php'); myCache::init(); echo 'Stored value is: '. myCache::fetch('foo'); The problem is that the myCache::init() method is being executed in full everytime a page is requested. I then remembered that static variables do not maintain state accross page requests. So I decided instead, to store the flag that indicates whether the server contains the start up data (for our purposes, the variable 'foo', with value 'bar') in memcache itself. Once the status flag is stored in memcache itself, It solves the problem of the initialisation data being loaded for every page request (which quite frankly, defeats the purpose of memcache). However, having solved that problem, when I come to fetch the data in memcache, it is empty. I dont understand whats going on. Can anyone clarify how I can store my data once and retrieve it accross page requests? BTW, (just to clarify), the get/set is working correctly, and if I allow memcache to load the initialisation data for each page request, (which is silly), then the data is available in memcache.

    Read the article

  • Cross-domain data access in JavaScript

    - by vit
    We have an ASP.Net application hosted on our network and exposed to a specific client. This client wants to be able to import data from their own server into our application. The data is retrieved with an HTTP request and is CSV formatted. The problem is that they do not want to expose their server to our network and are requesting the import to be done on the client side (all clients are from the same network as their server). So, what needs to be done is: They request an import page from our server The client script on the page issues a request to their server to get CSV formatted data The data is sent back to our application This is not a challenge when both servers are on the same domain: a simple hidden iframe or something similar will do the trick, but here what I'm getting is a cross-domain "access denied" error. They also refuse to change the data format to return JSON or XML formatted data. What I tried and learned so far is: Hidden iframe -- "access denied" XMLHttpRequest -- behaviour depends on the browser security settings: may work, may work while nagging a user with security warnings, or may not work at all Dynamic script tags -- would have worked if they could have returned data in JSON format IE client data binding -- the same "access denied" error Is there anything else I can try before giving up and saying that it will not be possible without exposing their server to our application, changing their data format or changing their browser security settings? (DNS trick is not an option, by the way).

    Read the article

  • AJAX Post Not Sending Data?

    - by Jascha
    I can't for the life of me figure out why this is happening. This is kind of a repost, so forgive me, but I have new data. I am running a javascript log out function called logOut() that has make a jQuery ajax call to a php script... function logOut(){ var data = new Object; data.log_out = true; $.ajax({ type: 'POST', url: 'http://www.mydomain.com/functions.php', data: data, success: function() { alert('done'); } }); } the php function it calls is here: if(isset($_POST['log_out'])){ $query = "INSERT INTO `token_manager` (`ip_address`) VALUES('logOutSuccess')"; $connection->runQuery($query); // <-- my own database class... // omitted code that clears session etc... die(); } Now, 18 hours out of the day this works, but for some reason, every once in a while, the POST data will not trigger my query. (this will last about an hour or so). I figured out the post data is not being set by adding this at the end of my script... $query = "INSERT INTO `token_manager` (`ip_address`) VALUES('POST FAIL')"; $connection->runQuery($query); So, now I know for certain my log out function is being skipped because in my database is the following data: if it were NOT being skipped, my data would show up like this: I know it is being skipped for two reasons, one the die() at the end of my first function, and two, if it were a success a "logOutSuccess" would be registered in the table. Any thoughts? One friend says it's a janky hosting company (hostgator.com). I personally like them because they are cheap and I'm a fan of cpanel. But, if that's the case??? Thanks in advance. -J

    Read the article

  • Exporting de-aggregated data

    - by Ben
    I'm currently working on a data export feature for a survey application. We are using SQL2k8. We store data in a normalized format: QuestionId, RespondentId, Answer. We have a couple other tables that define what the question text is for the QuestionId and demographics for the RespondentId... Currently I'm using some dynamic SQL to generate a pivot that joins the question table to the answer table and creates an export, its working... The problem is that it seems slow and we don't have that much data (less than 50k respondents). Right now I'm thinking "why am I 'paying' to de-aggregate the data for each query? Why don't I cache that?" The data being exported is based on dynamic criteria. It could be "give me respondents that completed on x date (or range)" or "people that like blue", etc. Because of that, I think I have to cache at the respondent level, find out what respondents are being exported and then select their combined cached de-aggregated data. To me the quick and dirty fix is a totally flat table, RespondentId, Question1, Question2, etc. The problem is, we have multiple clients and that doesn't scale AND I don't want to have to maintain the flattened table as the survey changes. So I'm thinking about putting an XML column on the respondent table and caching the results of a SELECT * FROM Data FOR XML AUTO WHERE RespondentId = x. With that in place, I would then be able to get my export with filtering and XML calls into the XML column. What are you doing to export aggregated data in a flattened format (CSV, Excel, etc)? Does this approach seem ok? I worry about the cost of XML functions on larger result sets (think SELECT RespondentId, XmlCol.value('//data/question_1', 'nvarchar(50)') AS [Why is there air?], XmlCol.RinseAndRepeat)... Is there a better technology/approach for this? Thanks!

    Read the article

  • IPad SQLite Push and Pull Data from external MS SQL Server DB

    - by MattyD
    This carries on from my previous post (http://stackoverflow.com/questions/4182664/ipad-app-pull-and-push-relational-data). My plan is that when the ipad application starts I am going to pull data (config data i.e. Departments, Types etc etc relational data that is used across the system) from a webhosted MS SQL Server DB via a webservice and populate it into an SQL Lite DB on the IPad. Then when I load a listing I will pull the data over the line again via a webservice and populate it into the SQL Lite db on the ipad (than just run select commands to populate the listing). My questions are: 1. What is the most efficient way to transfer data across the line via the web? Everyone seems to do it a different way. My idea is that I will have a webService for each type of data pull (e.g. RetrieveContactListing) that will query the db and than convert that data into "something" to send across the line. My question really is what is the "something" that it should be converting into? 2. Everyone talks about odata services. Is this suited for applications where complex read and writes are needed? Ive created a simple iphone app before that talked to an sql server db (i just sent my own structured xml across the line) but now with this app the data calls are going to be a lot larger so efficiency is key.

    Read the article

  • Best Practice: Protecting Personally Identifiable Data in a ASP.NET / SQL Server 2008 Environment

    - by William
    Thanks to a SQL injection vulnerability found last week, some of my recommendations are being investigated at work. We recently re-did an application which stores personally identifiable information whose disclosure could lead to identity theft. While we read some of the data on a regular basis, the restricted data we only need a couple of times a year and then only two employees need it. I've read up on SQL Server 2008's encryption function, but I'm not convinced that's the route I want to go. My problem ultimately boils down to the fact that we're either using symmetric keys or assymetric keys encrypted by a symmetric key. Thus it seems like a SQL injection attack could lead to a data leak. I realize permissions should prevent that, permissions should also prevent the leaking in the first place. It seems to me the better method would be to asymmetrically encrypt the data in the web application. Then store the private key offline and have a fat client that they can run the few times a year they need to access the restricted data so the data could be decrypted on the client. This way, if the server get compromised, we don't leak old data although depending on what they do we may leak future data. I think the big disadvantage is this would require re-writing the web application and creating a new fat application (to pull the restricted data). Due to the recent problem, I can probably get the time allocated, so now would be the proper time to make the recommendation. Do you have a better suggestion? Which method would you recommend? More importantly why?

    Read the article

  • Load some data from database and hide it somewhere in a web page

    - by kwokwai
    Hi all, I am trying to load some data (which may be up to a few thousands words) from the database, and store the data somewhere in a html web page for comparing the data input by users. I am thinking to load the data to a Textarea under Div tag and hide the the data: <Div id="reference" style="Display:none;"> <textarea rows="2" cols="20" id="database"> html, htm, php, asp, jsp, aspx, ctp, thtml, xml, xsl... </textarea> </Div> <table border=0 width="100%"> <tr> <td>Username</td> <td> <div id="username"> <input type="text" name="data" id="data"> </div> </td> </tr> </table> <script> $(document).ready(function(){ //comparing the data loaded from database with the user's input if($("#data").val()==$("#database").val()) {alert("error");} }); </script> I am not sure if this is the best way to do it, so could you give me some advice and suggest your methods please.

    Read the article

  • How to deal with a flaw in System.Data.DataTableExtensions.CopyToDataTable()

    - by andy
    Hey guys, so I've come across something which is perhaps a flaw in the Extension method .CopyToDataTable. This method is used by Importing (in VB.NET) System.Data.DataTableExtensions and then calling the method against an IEnumerable. You would do this if you want to filter a Datatable using LINQ, and then restore the DataTable at the end. i.e: Imports System.Data.DataRowExtensions Imports System.Data.DataTableExtensions Public Class SomeClass Private Shared Function GetData() As DataTable Dim Data As DataTable Data = LegacyADO.NETDBCall Data = Data.AsEnumerable.Where(Function(dr) dr.Field(Of Integer)("SomeField") = 5).CopyToDataTable() Return Data End Function End Class In the example above, the "WHERE" filtering might return no results. If this happens CopyToDataTable throws an exception because there are no DataRows. Why? The correct behavior should be to return a DataTable with Rows.Count = 0. Can anyone think of a clean workaround to this, in such a way that whoever calls CopyToDataTable doesn't have to be aware of this issue? System.Data.DataTableExtensions is a Static Class so I can't override the behavior....any ideas? Have I missed something? cheers UPDATE: I have submitted this as an issue to Connect. I would still like some suggestions, but if you agree with me, you could vote up the issue at Connect via the link above cheers

    Read the article

  • Passing $_GET or $_POST data to PHP script that is run with wget

    - by Matt
    Hello, I have the following line of PHP code which works great: exec( 'wget http://www.mydomain.com/u1.php /dev/null &' ); u1.php acts to do various types of maintenance on my server and the above command makes it happen in the background. No problems there. But I need to pass variable data to u1.php before it's executed. I'd like to pass POST data preferably, but could accommodate GET or SESSION data if POST isn't an option. Basically the type of data being passed is user-specific and will vary depending on who is logged in to the site and triggering the above code. I've tried adding the GET data to the end of the URL and that didn't work. So how else might I be able to send the data to u1.php? POST data preferred, SESSION data would work as well (but I tried this and it didn't pick up the logged in user's session data). GET would be a last resort. Thanks!

    Read the article

  • Bind DropDownList with Hierarchy from MSSQL Table with ASP.NET C#

    - by Gal V
    Hello all, I have the following sql table which contains menu (website menu) data. Table Name: MenuItems Columns: Id, MenuId, ParentMenuItemId, Text. My goal is to bind a DDL according to the following hierarchy (example): Id: 1, MenuId: 1, ParentMenuItemId: -1, Text: 'One' Id: 2, MenuId: 1, ParentMenuItemId: 1, Text: 'Two' Id: 3, MenuId: 1, ParentMenuItemId: 1, Text: 'Three' Id: 4, MenuId: 1, ParentMenuItemId: 2, Text: 'Four' Id: 5, MenuId: 1, ParentMenuItemId: 4, Text: 'Five' Requested result in DDL: One -- Two ---- Four ------ Five -- Three I think it should contain 'WITH' SQL command. Thanks all!

    Read the article

< Previous Page | 214 215 216 217 218 219 220 221 222 223 224 225  | Next Page >