Search Results

Search found 33557 results on 1343 pages for 'inline method'.

Page 218/1343 | < Previous Page | 214 215 216 217 218 219 220 221 222 223 224 225  | Next Page >

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Ruby and duck typing: design by contract impossible?

    - by davetron5000
    Method signature in Java: public List<String> getFilesIn(List<File> directories) similar one in ruby def get_files_in(directories) In the case of Java, the type system gives me information about what the method expects and delivers. In Ruby's case, I have no clue what I'm supposed to pass in, or what I'll expect to receive. In Java, the object must formally implement the interface. In Ruby, the object being passed in must respond to whatever methods are called in the method defined here. This seems highly problematic: Even with 100% accurate, up-to-date documentation, the Ruby code has to essentially expose its implementation, breaking encapsulation. "OO purity" aside, this would seem to be a maintenance nightmare. The Ruby code gives me no clue what's being returned; I would have to essentially experiment, or read the code to find out what methods the returned object would respond to. Not looking to debate static typing vs duck typing, but looking to understand how you maintain a production system where you have almost no ability to design by contract. Update No one has really addressed the exposure of a method's internal implementation via documentation that this approach requires. Since there are no interfaces, if I'm not expecting a particular type, don't I have to itemize every method I might call so that the caller knows what can be passed in? Or is this just an edge case that doesn't really come up?

    Read the article

  • ASP MVC - Getting Controller Level error handling

    - by RP
    How to get Controller-Level error handling: This is my map-route: routes.MapRoute( "Default", // Route name "{controller}/{action}/{id}", // URL with parameters new { controller = "Home", action = "Index", id = "" } // Parameter defaults ); And I have 2 controllers - HomeController and AwayController I want both both controllers to handle their own errors For example, a call to /Home/InvalidAction would be handled by one method and /Away/InvalidAction would be handled by another method Where InvalidAction currently results in a 404 as there's no Action method with that name

    Read the article

  • Template class giving linker error ...

    - by Atul
    Hi, I am having a template class which is exposed, in which I added a method. This class is in namespace A. Now, I am calling this method in another namespace (say B). Initially, compiler gave me linker error saying "unresolved external symbol" for this particular method. However, if I call this method inside the same namespace (that is A), it links well. After that, it links well in namespace B as well. Why could this be happening ? Does this has something to do with the creating Template object of my class ? Atul

    Read the article

  • Wondering about a way to conserve memory in C# using List<> with structs

    - by Michael Ryan
    I'm not even sure how I should phrase this question. I'm passing some CustomStruct objects as parameters to a class method, and storing them in a List. What I'm wondering is if it's possible and more efficient to add multiple references to a particular instance of a CustomStruct if a equivalent instance it found. This is a dummy/example struct: public struct CustomStruct { readonly int _x; readonly int _y; readonly int _w; readonly int _h; readonly Enum _e; } Using the below method, you can pass one, two, or three CustomStruct objects as parameters. In the final method (that takes three parameters), it may be the case that the 3rd and possibly the 2nd will have the same value as the first. List<CustomStruct> _list; public void AddBackground(CustomStruct normal) { AddBackground(normal, normal, normal); } public void AddBackground(CustomStruct normal, CustomStruct hover) { AddBackground(normal, hover, hover); } public void AddBackground(CustomStruct normal, CustomStruct hover, CustomStruct active) { _list = new List<CustomStruct>(3); _list.Add(normal); _list.Add(hover); _list.Add(active); } As the method stands now, I believe it will create new instances of CustomStruct objects, and then adds a reference of each to the List. It is my understanding that if I instead check for equality between normal and hover and (if equal) insert normal again in place of hover, when the method completes, hover will lose all references and eventually be garbage collected, whereas normal will have two references in the List. The same could be done for active. That would be better, right? The CustomStruct is a ValueType, and therefore one instance would remain on the Stack, and the three List references would just point to it. The overall List size is determined not by the object Type is contains, but by its Capacity. By eliminating the "duplicate" CustomStuct objects, you allow them to be cleaned up. When the CustomStruct objects are passed to these methods, new instances are created each time. When the structs are added to the List, is another copy made? For example, if i pass just one CustomStruct, AddBackground(normal) creates a copy of the original variable, and then passes it three times to Addbackground(normal, hover, active). In this method, three copies are made of the original copy. When the three local variables are added to the List using Add(), are additional copies created inside Add(), and does that defeat the purpose of any equality checks as previously mentioned? Am I missing anything here?

    Read the article

  • How to show percentage of 'memory used' in a win32 process?

    - by pj4533
    I know that memory usage is a very complex issue on Windows. I am trying to write a UI control for a large application that shows a 'percentage of memory used' number, in order to give the user an indication that it may be time to clear up some memory, or more likely restart the application. One implementation used ullAvailVirtual from MEMORYSTATUSEX as a base, then used HeapWalk() to walk the process heap looking for additional free memory. The HeapWalk() step was needed because we noticed that after a while of running the memory allocated and freed by the heap was never returned and reported by the ullAvailVirtual number. After hours of intensive working, the ullAvailVirtual number no longer would accurately report the amount of memory available. However, this method proved not ideal, due to occasional odd errors that HeapWalk() would return, even when the process heap was not corrupted. Further, since this is a UI control, the heap walking code was executing every 5-10 seconds. I tried contacting Microsoft about why HeapWalk() was failing, escalated a case via MSDN, but never got an answer other than "you probably shouldn't do that". So, as a second implementation, I used PagefileUsage from PROCESS_MEMORY_COUNTERS as a base. Then I used VirtualQueryEx to walk the virtual address space adding up all regions that weren't MEM_FREE and returned a value for GetMappedFileNameA(). My thinking was that the PageFileUsage was essentially 'private bytes' so if I added to that value the total size of the DLLs my process was using, it would be a good approximation of the amount of memory my process was using. This second method seems to (sorta) work, at least it doesn't cause crashes like the heap walker method. However, when both methods are enabled, the values are not the same. So one of the methods is wrong. So, StackOverflow world...how would you implement this? which method is more promising, or do you have a third, better method? should I go back to the original method, and further debug the odd errors? should I stay away from walking the heap every 5-10 seconds? Keep in mind the whole point is to indicate to the user that it is getting 'dangerous', and they should either free up memory or restart the application. Perhaps a 'percentage used' isn't the best solution to this problem? What is? Another idea I had was a color based system (red, yellow, green, which I could base on more factors than just a single number)

    Read the article

  • About local Final varibles in java

    - by Sathish
    In java Program, parameters which is defined as String in method declaration.But in method definition it is accessed as final String variable. Whether it'll lead to some issues (like security, memory problem)? For Example: Method Declaration join(String a,String b); Method definition public void join(final String a,final String b) { Authenticator au = new Authenticator(){ public PasswordAuthentication getPasswordAuthentication(){ return new PasswordAuthentication(a,b)} }; } Please help for me and clarify my doubts. Thanks in advance P.S. I;m accessing a and b as final variable because i've to use it in the inner class.

    Read the article

  • VS 2008 Profiler - Caller/Callee view showing bottom of stack

    - by Ncc
    Hello, I am currently trying to profile a class contained in a different assembly. To do this I created a small console application which calls into the public entry point of the class I want to profile. This enrty point is called Run(). This is working fine when I run my Console application in Debug mode and I can step into the Run() method. The Run() method calls a variety of other methods in its own assembly and other assemblies. However, when I create a new profiler of type "Instrumentation" in VS 2008, and run the profiler, the report shows my Main() function calling Run(), but in turn, when viewing the Caller/Callee report for my Run() method the report shows that the Run() method is the bottom of the stack. This is clearly not the case - could anyone please suggest why this is happening? Thanks.

    Read the article

  • Best way to check for null values in Java?

    - by Arty-fishL
    I need to check whether the function of an object returns true or false in Java, but that object may be null, so obviously then the function would throw a NullPointerException. This means I need to check if the object is null before checking the value of the function. What is the best way to go about this? I've listed some methods I considered, I just want to know the most sensible one, the one that is best programming practice for Java (opinion?). // method 1 if (foo != null) { if (foo.bar()) { etc... } } // method 2 if (foo != null ? foo.bar() : false) { etc... } // method 3 try { if (foo.bar()) { etc... } } catch (NullPointerException e) { } // method 4 // would this work all the time, would it still call foo.bar()? if (foo != null && foo.bar()) { etc... }

    Read the article

  • Implementing an interface using an asynchronous WCF service?

    - by John K.
    Hello, I am trying to figure out if it is possible to implement a .NET interface, where the interface method has to return something and you are implementing that particular interface method with an asynchronous WCF service? Hopefully you should already see the issue I am encountering. Here is the interface: public interface IDataService { IDataServiceResponse SendDataRequest(); } IDataServiceResponse is supposed to represent a simple container that holds the result of my asynchronous WCF callback. Here is the code snippet where I am implementing the interface method, SendDataRequest() public IDataServiceResponse SendDataRequest() { InitializeDataServiceParameters(); // Call the web service asynchronously, here.... _client.BeginQueryJobs(_parameters, DataServiceQueryCallBack, _client); // How do I return _dataServiceResponse, if I am calling the WCF service // asynchronously?? return _dataServiceResponse; } And the callback method signature: void DataServiceQueryCallBack(IAsyncResult result) { // ... implementation code } Thanks in advance, John

    Read the article

  • java partial classes

    - by Dewfy
    Hello colleagues, Small preamble. I was good java developer on 1.4 jdk. After it I have switched to another platforms, but here I come with problem so question is strongly about jdk 1.6 (or higher :) ). I have 3 coupled class, the nature of coupling concerned with native methods. Bellow is example of this 3 class public interface A { public void method(); } final class AOperations { static native method(. . .); } public class AImpl implements A { @Override public void method(){ AOperations.method( . . . ); } } So there is interface A, that is implemented in native way by AOperations, and AImpl just delegates method call to native methods. These relations are auto-generated. Everything ok, but I have stand before problem. Sometime interface like A need expose iterator capability. I can affect interface, but cannot change implementation (AImpl). Saying in C# I could be able resolve problem by simple partial: (C# sample) partial class AImpl{ ... //here comes auto generated code } partial class AImpl{ ... //here comes MY implementation of ... //Iterator } So, has java analogue of partial or something like.

    Read the article

  • Creating UI problem

    - by Xaver
    I create program which have the installer-like interface. How better realize that with ShowDialog method of Form-class or doing MDI interface? when i using ShowDialog method i doing this ways and i have next problems: 1) First form have ShowInTaskbar property=true other form false, formm appeared by .ShowDialog() method in event of press button "Next", event of pressing "" (also this function do .visible=false to undisplay form), event of pressing "

    Read the article

  • android numberformat exception

    - by asifkt
    my application shows this number format exception errror while running. 1 0-22 11:09:06.095: WARN/System.err(290): at java.lang.Long.parseLong(Long.java:330) 10-22 11:09:06.095: WARN/System.err(290): at java.lang.Long.parseLong(Long.java:307) 10-22 11:09:06.105: WARN/System.err(290): at com.htc.socialnetwork.facebook.FacebookUtils.getSyncInterval(FacebookUtils.java:54) 10-22 11:09:06.105: WARN/System.err(290): at com.htc.socialnetwork.facebook.remote.FacebookReceiver.getSyncInterval(FacebookReceiver.java:269) 10-22 11:09:06.105: WARN/System.err(290): at com.htc.socialnetwork.facebook.remote.FacebookReceiver.onReceive(FacebookReceiver.java:196) 10-22 11:09:06.105: WARN/System.err(290): at android.app.ActivityThread.handleReceiver(ActivityThread.java:2751) 10-22 11:09:06.105: WARN/System.err(290): at android.app.ActivityThread.access$3100(ActivityThread.java:126) 10-22 11:09:06.105: WARN/System.err(290): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:1982) 10-22 11:09:06.105: WARN/System.err(290): at android.os.Handler.dispatchMessage(Handler.java:99) 10-22 11:09:06.105: WARN/System.err(290): at android.os.Looper.loop(Looper.java:123) 10-22 11:09:06.105: WARN/System.err(290): at android.app.ActivityThread.main(ActivityThread.java:4603) 10-22 11:09:06.105: WARN/System.err(290): at java.lang.reflect.Method.invokeNative(Native Method) 10-22 11:09:06.105: WARN/System.err(290): at java.lang.reflect.Method.invoke(Method.java:521) 10-22 11:09:06.105: WARN/System.err(290): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:860) 10-22 11:09:06.105: WARN/System.err(290): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:618) 10-22 11:09:06.115: WARN/System.err(290): at dalvik.system.NativeStart.main(Native Method) anybody please help me to get the reason for this error

    Read the article

  • Exception handling in biztalk 2006 R2

    - by IB
    Hello I have a Biztalk 2006 R2 project (used with ESB Guidance 1) I am calling from orchstration to a static method in c# code, this method uses a class to load a file data into xlang message body at part 0 When i pass filepath which doesnt exists the inside class catch the exception but dont throw it up (in the static method there is a catch block and in the orchstration there is the real handling of the exception) The static method is : public static XLANGMessage LoadFileIntoMessage(XLANGMessage message, string filePath,Encoding encoding) { try { IStreamFactory sf = new FileStreamFactory(filePath,encoding); message[0].LoadFrom(sf); return message; } catch (Exception ex) { throw ex; } } The Class which load the file stream is : private class FileStreamFactory : IStreamFactory { string _fname; Encoding _encoding; public FileStreamFactory(string fname,Encoding encoding) { _fname = fname; _encoding = encoding; } public Stream CreateStream() { try { StreamReader sr; sr = new StreamReader ( _fname, _encoding ); return sr.BaseStream; } catch (Exception ex) { throw ex; } } } I call the static method from the orchstration and expect to catch the exception in my orchstration after the class and the emthod gets it

    Read the article

  • Rails3. How do I display two different objects in a search?

    - by JZ
    I am using a simple search that displays search results: @adds = Add.search(params[:search]) In addition to the search results I'm trying to utilize a method, nearbys(), which displays objects that are close in proximity to the search result. The following method displays objects which are close to 2, but it does not display object 2. How do I display object 2 in conjunction with the nearby objects? @adds = Add.find(2).nearbys(10) While the above code functions, when I use search, @adds = Add.search(params[:search]).nearbys(10) a no method error is returned, undefined methodnearbys' for Array:0x30c3278` How can I search the model for an object AND use the nearbys() method AND display all results returned?

    Read the article

  • Difference between KeywordQuery, FullTextQuerySearch type for Object Model and Web service Query

    - by Raghu
    Initially I believed these 3 to be doing more or less the same thing with just the notation being different. Until recently, when i noticed that their does exists a big difference between the results of the KeyWordQuery/FullTextQuerySearch and Web service Query. I used both KeywordQuery and FullText method to search of the the value of a customColumn XYZ with value (ASDSADA-21312ASD-ASDASD):- When I run this query as:- FullTextSqlQuery:- FullTextSqlQuery myQuery = new FullTextSqlQuery(site); { // Construct query text String queryText = "Select title, path, author, isdocument from scope() where freetext('ASDSADA-21312ASD-ASDASD') "; myQuery.QueryText = queryText; myQuery.ResultTypes = ResultType.RelevantResults; }; // execute the query and load the results into a datatable ResultTableCollection queryResults = myQuery.Execute(); ResultTable resultTable = queryResults[ResultType.RelevantResults]; // Load table with results DataTable queryDataTable = new DataTable(); queryDataTable.Load(resultTable, LoadOption.OverwriteChanges); I get the following result representing the document. * Title: TestPDF * path: http://SharepointServer/Shared Documents/Forms/DispForm.aspx?ID=94 * author: null * isDocument: false Do note the Path and isDocument fields of the above result. Web Service Method Then I tried a Web Service Query method. I used Sharepoint Search Service Tool available at http://sharepointsearchserv.codeplex.com/ and ran the same query i.e. Select title, path, author, isdocument from scope() where freetext('ASDSADA-21312ASD-ASDASD'). This time I got the following results:- * Title: TestPDF * path: http://SharepointServer/Shared Documents/TestPDF.pdf * author: null * isDocument: true Again note the path. While the search results from 2nd method are useful as they provide me the file path exactly, I can't seem to understand why is the method 1 not giving me the same results? Why is there a discrepancy between the two results?

    Read the article

  • ASP.NET MVC Ajax OnBegin/Complete Javascript Problem

    - by mrkcsc
    Hello, I am trying to fire off a javascript method using the OnBegin AjaxOption in an Ajax method. However, when debugging with firebug the callback in unable to find the Javascript method and I do not know why. My code is simple, first I use a basic Ajax method like this: <%= Ajax.ActionLink("Testing", "Testing", new AjaxOptions { OnBegin = "RunThisThing" }) % Then under it I decalre this script. <script type="text/javascript"> function RunThisThing { alert("WORK") } </script> Yet when I try running the page and clicking on the link, Firebug tells me "RunThisThing is not defined". Any idea what I might be doing wrong?

    Read the article

  • actionscript-3: refactor interface inheritance to get rid of ambiguous reference error

    - by maxmc
    hi! imagine there are two interfaces arranged via composite pattern, one of them has a dispose method among other methods: interface IComponent extends ILeaf { ... function dispose() : void; } interface ILeaf { ... } some implementations have some more things in common (say an id) so there are two more interfaces: interface ICommonLeaf extends ILeaf { function get id() : String; } interface ICommonComponent extends ICommonLeaf, IComponent { } so far so good. but there is another interface which also has a dispose method: interface ISomething { ... function dispose() : void; } and ISomething is inherited by ICommonLeaf: interface ICommonLeaf extends ILeaf, ISomething { function get id() : String; } As soon as the dispose method is invoked on an instance which implements the ICommonComponent interface, the compiler fails with an ambiguous reference error because ISomething has a method called dispose and ILeaf also has a dispose method, both living in different interfaces (IComponent, ISomething) within the inheritace tree of ICommonComponent. I wonder how to deal with the situation if the IComponent, the ILeaf and the ISomething can't change. the composite structure must also work for for the ICommonLeaf & ICommonComponent implementations and the ICommonLeaf & ICommonComponent must conform to the ISomething type. this might be an actionscript-3 specific issue. i haven't tested how other languages (for instance java) handle stuff like this.

    Read the article

  • Bullets WILL NOT dissapear in firefox

    - by DunlopBurns
    Hoping you can help me with a problem. I cannot get rid of Bullets in Firefox, i don't want any anywhere, hence my list-style-type: none!important being everywhere. It only appears in Firefox as far as i can tell. the HTML.... <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" lang="en" xml:lang="en"> <head> <title>littleprints.nl</title> <meta name="description" content="----" /> <meta name="keywords" content="----" /> <meta http-equiv="Content-Type" content="text/html; charset=iso-8859-1" /> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1.4/jquery.min.js"></script> <script type="text/javascript" src="js/slimbox2.js"></script> <link rel="stylesheet" href="css/slimbox2.css" type="text/css" media="screen" /> <link rel="stylesheet" href="layout.css"/> <link rel="stylesheet" href="style.css"/> </head> <body> <div id="container"> <div id="inline1"> <div id="mainpic"> <img src="myimages/circle.jpg" width="100%" alt="Circle bracelet"/> </div> <div id="intro"> <p>Hi and welcome to little prints NL. we make this and that all by hand with 100% silver. my name is Donna Burns and i work by commision, ive been studying for 4 years and am currently learning to become a goldsmith.</p> </div> </div> <div id="inline2"> <p>Click for more...</p> <div id="images"> <a href="myimages/photos/dogtag.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/chunky.gif" alt="chunky"/></a> <a href="myimages/photos/hearts.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/hearts.gif" alt="hearts"/></a> <a href="myimages/photos/close.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/close.gif" alt="close"/></a> <a href="myimages/photos/pearl.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/flower.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/frontcircle.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/dogtag.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> </div> </div> </div><!--end container--> <div id="footer"> <div id="footalign"> <div id="social"> <ul> <li> <a href="http://www.facebook.com/littleprints" title="Little Prints"> <img src="myimages/facebook.png" width="50px" height="50px" alt="FB"/> </a> </li> <li> <a href="contact.html" title="contact"> <img src="myimages/at.gif" alt="@"/> </a> </li> </ul> </div> <div id="contact"> <p><br/>To enquire about a charm either phone:<br/> 0787463289<br/> or use one of the methods to the side.</p> </div> </div> </div> </body> </html> the CSS... * {margin: 0; padding: 0; border: 0;} html, body { background-color: #000000;image; text-align: center; font: 16px/1.8 Verdana, Arial, Helvetica, sans-serif; list-style-type: none!important; text-decoration: none;} #container { position: relative; width: 900px; top: 0; min-height: 100%; margin-left: auto; margin-right: auto; padding-top: 20px; background-image: URL(myimages/back2.gif); margin-bottom: 180px; } #footer { background-color: #555555; position: relative; clear: both; bottom: 0; width: 900px; height: auto; margin-left: auto; margin-right: auto; margin-bottom: 20px; padding-bottom: 22px; margin-top: -180px; } #inline1{ display: inline-block; margin-top: 250px; margin-bottom: 20px; } #inline2 { display: inline-block; margin-top: 30px; margin-bottom: 50px; } #mainpic { float: left; width: 68%; margin-left: 20px; } #intro { float: right; width: 20%; margin-left: auto; margin-right: 50px; margin-top: 20px; } #images { margin-bottom: 20px; margin-left: auto; margin-right: auto; } #footalign { display: inline; width:900px; list-style-type: none; } #contact { text-align: center; background-color:#555555; float: middle; list-style-type: none; } #social{ background-color:#555555; float: right; list-style: none; padding:0; padding-right: 5px; text-align:center; list-style-type: none!important; } #social img{ border: none; list-style-type: none!important; margin: 3px; } #social ul{ border: none; list-style-type: none!important; } #social a{ display:inline-block; -webkit-transition:all .5s ease-out; -moz-transition:all .5s ease-out; -ms-transition:all .5s ease-out; -o-transition:all .5s ease-out; transition:all .5s ease-out; list-style-type: none!important; } #social a:hover{ display:inline-block; -webkit-transform:translate(-10px,0px); -moz-transform:translate(0px,-10px); -ms-transform:translate(-10px,0px); -o-transform:translate(-10px,0px); transform:translate(-10px,0px); list-style-type: none!important; } #form { margin-top: 250px; margin-bottom: 50px; } .nav1 {font-family: sans-serif;font-size: 22px;text-shadow: 2px 2px 5px #000000;} a:link {text-decoration:none; color:#000000; padding:3px;} a:visited {text-decoration:none; color:#000000;} a:active {text-decoration:none; color:#555555;} a:hover {text-decoration:none; color:#555555;} .nav2 {font-family: sans-serif;font-size: 22px;text-shadow: 2px 2px 5px #ffffff;} a:link {text-decoration:none; color:#ffffff; padding:3px;} a:visited {text-decoration:none; color:#ffffff;} a:active {text-decoration:none; color:#555555;} a:hover {text-decoration:none; color:#555555;} .p1 { color: #ffffff; } div#images img { max-width: 500px; height: auto; }

    Read the article

  • How to get `gcc` to generate `bts` instruction for x86-64 from standard C?

    - by Norman Ramsey
    Inspired by a recent question, I'd like to know if anyone knows how to get gcc to generate the x86-64 bts instruction (bit test and set) on the Linux x86-64 platforms, without resorting to inline assembly or to nonstandard compiler intrinsics. Related questions: Why doesn't gcc do this for a simple |= operation were the right-hand side has exactly 1 bit set? How to get bts using compiler intrinsics or the asm directive Portability is more important to me than bts, so I won't use and asm directive, and if there's another solution, I prefer not to use compiler instrinsics. EDIT: The C source language does not support atomic operations, so I'm not particularly interested in getting atomic test-and-set (even though that's the original reason for test-and-set to exist in the first place). If I want something atomic I know I have no chance of doing it with standard C source: it has to be an intrinsic, a library function, or inline assembly. (I have implemented atomic operations in compilers that support multiple threads.)

    Read the article

  • Return ActionResult to a Dialog. ASP.NET MVC

    - by Stacey
    Given a method.. public ActionResult Method() { // program logic if(condition) { // external library // external library returns an ActionResult } return View(viewname); } I cannot control the return type or method of the external library. I want to catch its results and handle that in a dialog on the page - but I cannot figure out how to get back to the page to execute the jQuery that would be responsible for it. Any ideas?

    Read the article

  • What is the best practice of using return keyword?

    - by Artic
    What is the best practice of using return keyword? If i need to return something from method which pattern is better to use? public boolean method(){ if (case1){ return true; } if (case 2){ return false; } return false; } or public boolean method(){ boolean result = false; if (case1){ result = true; } if (case 2){ result = false; } return result; }

    Read the article

  • How to call Cocoa Methods from Applescript under Mac OS X 10.6

    - by Nico
    In former Mac OS x versions it was possible to call Cocoa methods via the "call method" command in applescript ("Applescript Studio"). E.g. this way: set theURL to "http://www.apple.com" set URLWithString to (call method "stringByAddingPercentEscapesUsingEncoding:" of theURL with parameter 30) The script interpreter in the "Applescript Editor" (10.6) does not understand the command "call method". - Is there an equivalent for "Applescript Editor" (10.6)?

    Read the article

< Previous Page | 214 215 216 217 218 219 220 221 222 223 224 225  | Next Page >