Search Results

Search found 33557 results on 1343 pages for 'inline method'.

Page 218/1343 | < Previous Page | 214 215 216 217 218 219 220 221 222 223 224 225  | Next Page >

  • How to show percentage of 'memory used' in a win32 process?

    - by pj4533
    I know that memory usage is a very complex issue on Windows. I am trying to write a UI control for a large application that shows a 'percentage of memory used' number, in order to give the user an indication that it may be time to clear up some memory, or more likely restart the application. One implementation used ullAvailVirtual from MEMORYSTATUSEX as a base, then used HeapWalk() to walk the process heap looking for additional free memory. The HeapWalk() step was needed because we noticed that after a while of running the memory allocated and freed by the heap was never returned and reported by the ullAvailVirtual number. After hours of intensive working, the ullAvailVirtual number no longer would accurately report the amount of memory available. However, this method proved not ideal, due to occasional odd errors that HeapWalk() would return, even when the process heap was not corrupted. Further, since this is a UI control, the heap walking code was executing every 5-10 seconds. I tried contacting Microsoft about why HeapWalk() was failing, escalated a case via MSDN, but never got an answer other than "you probably shouldn't do that". So, as a second implementation, I used PagefileUsage from PROCESS_MEMORY_COUNTERS as a base. Then I used VirtualQueryEx to walk the virtual address space adding up all regions that weren't MEM_FREE and returned a value for GetMappedFileNameA(). My thinking was that the PageFileUsage was essentially 'private bytes' so if I added to that value the total size of the DLLs my process was using, it would be a good approximation of the amount of memory my process was using. This second method seems to (sorta) work, at least it doesn't cause crashes like the heap walker method. However, when both methods are enabled, the values are not the same. So one of the methods is wrong. So, StackOverflow world...how would you implement this? which method is more promising, or do you have a third, better method? should I go back to the original method, and further debug the odd errors? should I stay away from walking the heap every 5-10 seconds? Keep in mind the whole point is to indicate to the user that it is getting 'dangerous', and they should either free up memory or restart the application. Perhaps a 'percentage used' isn't the best solution to this problem? What is? Another idea I had was a color based system (red, yellow, green, which I could base on more factors than just a single number)

    Read the article

  • Double buffering C#

    - by LmSNe
    Hey, I'm trying to implement the following method: void Ball::DrawOn(Graphics g); The method should draw all previous locations(stored in a queue) of the ball and finally the current location. I don't know if that matters, but I print the previous locations using g.DrawEllipse(...) and the current location using g.FillEllipse(...). The question is, that as you could imagine there is a lot of drawing to be done and thus the display starts to flicker much. I had searched for a way to double buffer, but all I could find is these 2 ways: 1) System.Windows.Forms.Control.DoubleBuffered = true; 2) SetStyle(ControlStyles.DoubleBuffer | ControlStyles.UserPaint | ControlStyles.AllPaintingInWmPaint, true); while trying to use the first, I get the an error explaining that from in this method the Property DoubleBuffered is inaccessible due to its protection level. While I can't figure how to use the SetStyle method. Is it possible at all to double buffer while all the access I have is to the Graphics Object I get as input in the method? Thanks in Advance,

    Read the article

  • java partial classes

    - by Dewfy
    Hello colleagues, Small preamble. I was good java developer on 1.4 jdk. After it I have switched to another platforms, but here I come with problem so question is strongly about jdk 1.6 (or higher :) ). I have 3 coupled class, the nature of coupling concerned with native methods. Bellow is example of this 3 class public interface A { public void method(); } final class AOperations { static native method(. . .); } public class AImpl implements A { @Override public void method(){ AOperations.method( . . . ); } } So there is interface A, that is implemented in native way by AOperations, and AImpl just delegates method call to native methods. These relations are auto-generated. Everything ok, but I have stand before problem. Sometime interface like A need expose iterator capability. I can affect interface, but cannot change implementation (AImpl). Saying in C# I could be able resolve problem by simple partial: (C# sample) partial class AImpl{ ... //here comes auto generated code } partial class AImpl{ ... //here comes MY implementation of ... //Iterator } So, has java analogue of partial or something like.

    Read the article

  • -sizeWithFont Functions Differently on Device

    - by LucasTizma
    So I am seemingly encountering some strange behavior when using NSString's -sizeWithFont family of method calls depending on whether or not I'm invoking it on the iPhone Simulator or an actual device. Simply enough, when the receiver of the -sizeWithFont method call is nil, the resulting CGSize passed back on the Simulator is {0, 0}. However, on the device, it is the size of the bounding rectangle I specified in the method call. See the following log statements: Simulator: someString: (null) someStringSize: {0, 0} Device: someString: (null) someStringSize: {185, 3.40282e+38} The behavior on the Simulator is what I would expect. Not that this issue is difficult to circumvent, but 1) I'm a little confused why this family of functions would behave differently on the Simulator and an actual device, and 2) why does calling a method on a nil receiving return a particular result? Thanks for any pointers or insight you guys can provide! EDIT: I suppose I should mention that I'm building against the 3.1 SDK.

    Read the article

  • android numberformat exception

    - by asifkt
    my application shows this number format exception errror while running. 1 0-22 11:09:06.095: WARN/System.err(290): at java.lang.Long.parseLong(Long.java:330) 10-22 11:09:06.095: WARN/System.err(290): at java.lang.Long.parseLong(Long.java:307) 10-22 11:09:06.105: WARN/System.err(290): at com.htc.socialnetwork.facebook.FacebookUtils.getSyncInterval(FacebookUtils.java:54) 10-22 11:09:06.105: WARN/System.err(290): at com.htc.socialnetwork.facebook.remote.FacebookReceiver.getSyncInterval(FacebookReceiver.java:269) 10-22 11:09:06.105: WARN/System.err(290): at com.htc.socialnetwork.facebook.remote.FacebookReceiver.onReceive(FacebookReceiver.java:196) 10-22 11:09:06.105: WARN/System.err(290): at android.app.ActivityThread.handleReceiver(ActivityThread.java:2751) 10-22 11:09:06.105: WARN/System.err(290): at android.app.ActivityThread.access$3100(ActivityThread.java:126) 10-22 11:09:06.105: WARN/System.err(290): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:1982) 10-22 11:09:06.105: WARN/System.err(290): at android.os.Handler.dispatchMessage(Handler.java:99) 10-22 11:09:06.105: WARN/System.err(290): at android.os.Looper.loop(Looper.java:123) 10-22 11:09:06.105: WARN/System.err(290): at android.app.ActivityThread.main(ActivityThread.java:4603) 10-22 11:09:06.105: WARN/System.err(290): at java.lang.reflect.Method.invokeNative(Native Method) 10-22 11:09:06.105: WARN/System.err(290): at java.lang.reflect.Method.invoke(Method.java:521) 10-22 11:09:06.105: WARN/System.err(290): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:860) 10-22 11:09:06.105: WARN/System.err(290): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:618) 10-22 11:09:06.115: WARN/System.err(290): at dalvik.system.NativeStart.main(Native Method) anybody please help me to get the reason for this error

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Error: java.lang.ClassCastException

    - by theJava
    Updating the entire post. public Login authenticate(Login login) { String query = "SELECT email, id FROM Login WHERE email=? AND password=?"; Object[] parameters = { login.getEmail(), login.getPassword() }; List resultsList = getHibernateTemplate().find(query,parameters); if ( resultsList.size() == 1 ) { results = (Login)resultsList.get(0); System.out.println(results); } else { System.out.println("Error dude.... "); // error no entity or mutiple entities } return results; } I now return Login Objects. private void checkLogin() { form.commit(); Login newUser = new Login(); newUser = ilogin.authenticate(loginbean); System.out.println("Its Null Value" + newUser); if (newUser == null) { getWindow().showNotification("Login failed", LOGIN_ERROR_MSG, Notification.TYPE_WARNING_MESSAGE); } else { System.out.println(newUser); getApplication().setUser(newUser); } } When there is no matching email, i get there is no such user and also this statement does get printed out. System.out.println("Its Null Value" + newUser); But when there is a email and password matching. I get weird error. Caused by: java.lang.ClassCastException: [Ljava.lang.Object; cannot be cast to com.intermedix.domain.Login at com.intermedix.services.LoginService.authenticate(LoginService.java:30) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at org.springframework.aop.support.AopUtils.invokeJoinpointUsingReflection(AopUtils.java:301) at org.springframework.aop.framework.ReflectiveMethodInvocation.invokeJoinpoint(ReflectiveMethodInvocation.java:182) at org.springframework.aop.framework.ReflectiveMethodInvocation.proceed(ReflectiveMethodInvocation.java:149) at org.springframework.transaction.interceptor.TransactionInterceptor.invoke(TransactionInterceptor.java:106) at org.springframework.aop.framework.ReflectiveMethodInvocation.proceed(ReflectiveMethodInvocation.java:171) at org.springframework.aop.framework.JdkDynamicAopProxy.invoke(JdkDynamicAopProxy.java:204) at $Proxy32.authenticate(Unknown Source) at com.intermedix.ui.LoginDailog.checkLogin(LoginDailog.java:106) at com.intermedix.ui.LoginDailog.access$0(LoginDailog.java:102) at com.intermedix.ui.LoginDailog$1.buttonClick(LoginDailog.java:52) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at com.vaadin.event.ListenerMethod.receiveEvent(ListenerMethod.java:487) ... 26 more

    Read the article

  • Wondering about a way to conserve memory in C# using List<> with structs

    - by Michael Ryan
    I'm not even sure how I should phrase this question. I'm passing some CustomStruct objects as parameters to a class method, and storing them in a List. What I'm wondering is if it's possible and more efficient to add multiple references to a particular instance of a CustomStruct if a equivalent instance it found. This is a dummy/example struct: public struct CustomStruct { readonly int _x; readonly int _y; readonly int _w; readonly int _h; readonly Enum _e; } Using the below method, you can pass one, two, or three CustomStruct objects as parameters. In the final method (that takes three parameters), it may be the case that the 3rd and possibly the 2nd will have the same value as the first. List<CustomStruct> _list; public void AddBackground(CustomStruct normal) { AddBackground(normal, normal, normal); } public void AddBackground(CustomStruct normal, CustomStruct hover) { AddBackground(normal, hover, hover); } public void AddBackground(CustomStruct normal, CustomStruct hover, CustomStruct active) { _list = new List<CustomStruct>(3); _list.Add(normal); _list.Add(hover); _list.Add(active); } As the method stands now, I believe it will create new instances of CustomStruct objects, and then adds a reference of each to the List. It is my understanding that if I instead check for equality between normal and hover and (if equal) insert normal again in place of hover, when the method completes, hover will lose all references and eventually be garbage collected, whereas normal will have two references in the List. The same could be done for active. That would be better, right? The CustomStruct is a ValueType, and therefore one instance would remain on the Stack, and the three List references would just point to it. The overall List size is determined not by the object Type is contains, but by its Capacity. By eliminating the "duplicate" CustomStuct objects, you allow them to be cleaned up. When the CustomStruct objects are passed to these methods, new instances are created each time. When the structs are added to the List, is another copy made? For example, if i pass just one CustomStruct, AddBackground(normal) creates a copy of the original variable, and then passes it three times to Addbackground(normal, hover, active). In this method, three copies are made of the original copy. When the three local variables are added to the List using Add(), are additional copies created inside Add(), and does that defeat the purpose of any equality checks as previously mentioned? Am I missing anything here?

    Read the article

  • 3 matchers expected, 4 recorded.

    - by user564159
    I get this exception during the mock recording time. Searched for a solution in this forum. Made sure that i did not mess up any another parameter. The below mock expection is giving the error. EasyMock.expect(slotManager.addSlotPageletBinding(EasyMock.isA(String.class), EasyMock.isA(String.class), EasyMock.isA(helloWorld.class))).andReturn(true); before this statement i have another mock expection on the same method with TWO parameter(overloaded method).Below is that mock. EasyMock.expect(slotManager.addSlotPageletBinding(EasyMock.isA(String.class),EasyMock.isA(String.class))).andReturn(true).anyTimes(); Could any one guide me on this. Thanks. java.lang.IllegalStateException: 3 matchers expected, 4 recorded. at org.easymock.internal.ExpectedInvocation.createMissingMatchers(ExpectedInvocation.java:56) at org.easymock.internal.ExpectedInvocation.(ExpectedInvocation.java:48) at org.easymock.internal.ExpectedInvocation.(ExpectedInvocation.java:40) at org.easymock.internal.RecordState.invoke(RecordState.java:76) at org.easymock.internal.MockInvocationHandler.invoke(MockInvocationHandler.java:38) at org.easymock.internal.ObjectMethodsFilter.invoke(ObjectMethodsFilter.java:72) at org.easymock.classextension.internal.ClassProxyFactory$1.intercept(ClassProxyFactory.java:79) at com.amazon.inca.application.SlotManager$$EnhancerByCGLIB$$3bf5ac02.addSlotPageletBinding() at com.amazon.iris3.apps.Iris3YourAccountApplicationTest.testBuildIncaViewConfiguration(Iris3YourAccountApplicationTest.java:107) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at junit.framework.TestCase.runTest(TestCase.java:168) at junit.framework.TestCase.runBare(TestCase.java:134) at junit.framework.TestResult$1.protect(TestResult.java:110) at junit.framework.TestResult.runProtected(TestResult.java:128) at junit.framework.TestResult.run(TestResult.java:113) at junit.framework.TestCase.run(TestCase.java:124) at junit.framework.TestSuite.runTest(TestSuite.java:232) at junit.framework.TestSuite.run(TestSuite.java:227) at org.junit.internal.runners.JUnit38ClassRunner.run(JUnit38ClassRunner.java:83) at org.eclipse.jdt.internal.junit4.runner.JUnit4TestReference.run(JUnit4TestReference.java:46) at org.eclipse.jdt.internal.junit.runner.TestExecution.run(TestExecution.java:38) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.runTests(RemoteTestRunner.java:467) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.runTests(RemoteTestRunner.java:683) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.run(RemoteTestRunner.java:390) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.main(RemoteTestRunner.java:197)

    Read the article

  • ASP.NET MVC Ajax OnBegin/Complete Javascript Problem

    - by mrkcsc
    Hello, I am trying to fire off a javascript method using the OnBegin AjaxOption in an Ajax method. However, when debugging with firebug the callback in unable to find the Javascript method and I do not know why. My code is simple, first I use a basic Ajax method like this: <%= Ajax.ActionLink("Testing", "Testing", new AjaxOptions { OnBegin = "RunThisThing" }) % Then under it I decalre this script. <script type="text/javascript"> function RunThisThing { alert("WORK") } </script> Yet when I try running the page and clicking on the link, Firebug tells me "RunThisThing is not defined". Any idea what I might be doing wrong?

    Read the article

  • How to get `gcc` to generate `bts` instruction for x86-64 from standard C?

    - by Norman Ramsey
    Inspired by a recent question, I'd like to know if anyone knows how to get gcc to generate the x86-64 bts instruction (bit test and set) on the Linux x86-64 platforms, without resorting to inline assembly or to nonstandard compiler intrinsics. Related questions: Why doesn't gcc do this for a simple |= operation were the right-hand side has exactly 1 bit set? How to get bts using compiler intrinsics or the asm directive Portability is more important to me than bts, so I won't use and asm directive, and if there's another solution, I prefer not to use compiler instrinsics. EDIT: The C source language does not support atomic operations, so I'm not particularly interested in getting atomic test-and-set (even though that's the original reason for test-and-set to exist in the first place). If I want something atomic I know I have no chance of doing it with standard C source: it has to be an intrinsic, a library function, or inline assembly. (I have implemented atomic operations in compilers that support multiple threads.)

    Read the article

  • VS 2008 Profiler - Caller/Callee view showing bottom of stack

    - by Ncc
    Hello, I am currently trying to profile a class contained in a different assembly. To do this I created a small console application which calls into the public entry point of the class I want to profile. This enrty point is called Run(). This is working fine when I run my Console application in Debug mode and I can step into the Run() method. The Run() method calls a variety of other methods in its own assembly and other assemblies. However, when I create a new profiler of type "Instrumentation" in VS 2008, and run the profiler, the report shows my Main() function calling Run(), but in turn, when viewing the Caller/Callee report for my Run() method the report shows that the Run() method is the bottom of the stack. This is clearly not the case - could anyone please suggest why this is happening? Thanks.

    Read the article

  • Implementing an interface using an asynchronous WCF service?

    - by John K.
    Hello, I am trying to figure out if it is possible to implement a .NET interface, where the interface method has to return something and you are implementing that particular interface method with an asynchronous WCF service? Hopefully you should already see the issue I am encountering. Here is the interface: public interface IDataService { IDataServiceResponse SendDataRequest(); } IDataServiceResponse is supposed to represent a simple container that holds the result of my asynchronous WCF callback. Here is the code snippet where I am implementing the interface method, SendDataRequest() public IDataServiceResponse SendDataRequest() { InitializeDataServiceParameters(); // Call the web service asynchronously, here.... _client.BeginQueryJobs(_parameters, DataServiceQueryCallBack, _client); // How do I return _dataServiceResponse, if I am calling the WCF service // asynchronously?? return _dataServiceResponse; } And the callback method signature: void DataServiceQueryCallBack(IAsyncResult result) { // ... implementation code } Thanks in advance, John

    Read the article

  • Return ActionResult to a Dialog. ASP.NET MVC

    - by Stacey
    Given a method.. public ActionResult Method() { // program logic if(condition) { // external library // external library returns an ActionResult } return View(viewname); } I cannot control the return type or method of the external library. I want to catch its results and handle that in a dialog on the page - but I cannot figure out how to get back to the page to execute the jQuery that would be responsible for it. Any ideas?

    Read the article

  • Exception handling in biztalk 2006 R2

    - by IB
    Hello I have a Biztalk 2006 R2 project (used with ESB Guidance 1) I am calling from orchstration to a static method in c# code, this method uses a class to load a file data into xlang message body at part 0 When i pass filepath which doesnt exists the inside class catch the exception but dont throw it up (in the static method there is a catch block and in the orchstration there is the real handling of the exception) The static method is : public static XLANGMessage LoadFileIntoMessage(XLANGMessage message, string filePath,Encoding encoding) { try { IStreamFactory sf = new FileStreamFactory(filePath,encoding); message[0].LoadFrom(sf); return message; } catch (Exception ex) { throw ex; } } The Class which load the file stream is : private class FileStreamFactory : IStreamFactory { string _fname; Encoding _encoding; public FileStreamFactory(string fname,Encoding encoding) { _fname = fname; _encoding = encoding; } public Stream CreateStream() { try { StreamReader sr; sr = new StreamReader ( _fname, _encoding ); return sr.BaseStream; } catch (Exception ex) { throw ex; } } } I call the static method from the orchstration and expect to catch the exception in my orchstration after the class and the emthod gets it

    Read the article

  • Rails3. How do I display two different objects in a search?

    - by JZ
    I am using a simple search that displays search results: @adds = Add.search(params[:search]) In addition to the search results I'm trying to utilize a method, nearbys(), which displays objects that are close in proximity to the search result. The following method displays objects which are close to 2, but it does not display object 2. How do I display object 2 in conjunction with the nearby objects? @adds = Add.find(2).nearbys(10) While the above code functions, when I use search, @adds = Add.search(params[:search]).nearbys(10) a no method error is returned, undefined methodnearbys' for Array:0x30c3278` How can I search the model for an object AND use the nearbys() method AND display all results returned?

    Read the article

  • pass object from JS to PHP and back

    - by Radu
    This is something that I don't think can't be done, or can't be done easy. Think of this, You have an button inside a div in HTML, when you click it, you call a php function via AJAX, I would like to send the element that start the click event(or any element as a parameter) to PHP and BACK to JS again, in a way like serialize() in PHP, to be able to restore the element in JS. Let me give you a simple example: PHP: function ajaxCall(element){ return element; } JS: callbackFunction(el){ el.color='red'; } HTML: <div id="id_div"> <input type="button" value="click Me" onClick="ajaxCall(this, callbackFunction);" /> </div> So I thing at 3 methods method 1. I can give each element in the page an ID. so the call to Ajax would look like this: ajaxCall(this.id, callbackFunction); and the callback function would be: document.getElementById(el).color='red'; This method I think is hard, beacause in a big page is hard to keep track of all ID's. method 2. I think that using xPath could be done, If i can get the exact path of an element, and in the callback function evaluate that path to reach the element. This method needs some googling, it is just an ideea. method 3. Modify my AJAX functions, so it retain the element that started the event, and pass it to the callback function as argument when something returns from PHP, so in my AJAX would look like this: eval(callbackFunction(argumentsFromPhp, element)); and the callback function would be: callbackFunction(someArgsFromPhp, el){ el.color='red'; // parse someArgsFromPhp } I think that the third option is my choise to start this experiment. Any of you has a better idea how I can accomplish this ? Thank you.

    Read the article

  • Why does the Java Collections Framework offer two different ways to sort?

    - by dvanaria
    If I have a list of elements I would like to sort, Java offers two ways to go about this. For example, lets say I have a list of Movie objects and I’d like to sort them by title. One way I could do this is by calling the one-argument version of the static java.util.Collections.sort( ) method with my movie list as the single argument. So I would call Collections.sort(myMovieList). In order for this to work, the Movie class would have to be declared to implement the java.lang.Comparable interface, and the required method compareTo( ) would have to be implemented inside this class. Another way to sort is by calling the two-argument version of the static java.util.Collections.sort( ) method with the movie list and a java.util.Comparator object as it’s arguments. I would call Collections.sort(myMovieList, titleComparator). In this case, the Movie class wouldn’t implement the Comparable interface. Instead, inside the main class that builds and maintains the movie list itself, I would create an inner class that implements the java.util.Comparator interface, and implement the one required method compare( ). Then I'd create an instance of this class and call the two-argument version of sort( ). The benefit of this second method is you can create an unlimited number of these inner class Comparators, so you can sort a list of objects in different ways. In the example above, you could have another Comparator to sort by the year a movie was made, for example. My question is, why bother to learn both ways to sort in Java, when the two-argument version of Collections.sort( ) does everything the first one-argument version does, but with the added benefit of being able to sort the list’s elements based on several different criteria? It would be one less thing to have to keep in your mind while coding. You’d have one basic mechanism of sorting lists in Java to know.

    Read the article

  • JUnit Rule TemporaryFolder

    - by Jeff Storey
    I'm creating a TemporaryFolder using the @Rule annotation in JUnit 4.7. I've tried to create a new folder that is a child of the temp folder using tempFolder.newFolder("someFolder") in the @Before (setup) method of my test. It seems as though the temporary folder gets initialized after the setup method runs, meaning I can't use the temporary folder in the setup method. Is this correct (and predictable) behavior? thanks, Jeff

    Read the article

  • ASP MVC - Getting Controller Level error handling

    - by RP
    How to get Controller-Level error handling: This is my map-route: routes.MapRoute( "Default", // Route name "{controller}/{action}/{id}", // URL with parameters new { controller = "Home", action = "Index", id = "" } // Parameter defaults ); And I have 2 controllers - HomeController and AwayController I want both both controllers to handle their own errors For example, a call to /Home/InvalidAction would be handled by one method and /Away/InvalidAction would be handled by another method Where InvalidAction currently results in a 404 as there's no Action method with that name

    Read the article

  • Getting started with nbehave

    - by dotnetdev
    Hi, I am looking at using BDD, however, when evaluating the stories/conditions I write (using nBehave), how do I check if the story passes? Do I write another library with test methods? For example, if I want to test a site for having a link called "About", do I write a method which can check this and then another method in another class library which can call the method to check the link via lambda syntax and add the relevant test and bdd attributes? Thanks

    Read the article

< Previous Page | 214 215 216 217 218 219 220 221 222 223 224 225  | Next Page >