Search Results

Search found 1817 results on 73 pages for 'kevin 82'.

Page 22/73 | < Previous Page | 18 19 20 21 22 23 24 25 26 27 28 29  | Next Page >

  • Banshee gapless playback does not work when playing mp3s

    - by ComputerGuy505
    Even though I have gapless playback enabled in Banshee's settings menu, there is a very short pause between songs. This might be due to the fact that my hard drive's partitions seem wierd. fdisk -l produces this output: Disk /dev/sda: 750.2 GB, 750156374016 bytes 255 heads, 63 sectors/track, 91201 cylinders, total 1465149168 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 4096 bytes I/O size (minimum/optimal): 4096 bytes / 4096 bytes Disk identifier: 0x4a73c3cb Device Boot Start End Blocks Id System /dev/sda1 * 2048 409599 203776 7 HPFS/NTFS/exFAT /dev/sda2 409600 724153740 361872070+ 7 HPFS/NTFS/exFAT /dev/sda3 1456826368 1465145343 4159488 c W95 FAT32 (LBA) /dev/sda4 724154366 1456826367 366336001 5 Extended Partition 4 does not start on physical sector boundary. /dev/sda5 1440159744 1456826367 8333312 82 Linux swap / Solaris /dev/sda6 724154368 1440159743 358002688 83 Linux Partition table entries are not in disk order Playing mp3's from /dev/sda2 or /dev/sda6 produces this problem. I don't seem to have gapless playback on Rhythmbox or Clementine either, if those media players are supposed to have it. I'm not sure what other info to provide. This is just annoying to me. Thanks for any help.

    Read the article

  • Are Windows partitions gone?

    - by Gigili
    I had Windows 7 on my laptop (factory setting), because of some performance issues, I decided to use recovery options to restore it to its factory condition but I don't know what has happened or what I have done that the whole operating system was gone after playing around with recovery options from the boot menu. I couldn't find Windows, so I installed Ubuntu 11.04 on my laptop. Last time I had Ubuntu on it, it was not really compatible with laptop's configuration and I had a bit of problems trying to do normal tasks I used to do on Windows. Now I want to make sure that Windows and its drivers are gone so that I can try to install a newer version of Ubuntu or Windows. I tried the command sudo fdisk -l And the result shown was: myaccount@myaccount-VPCS116FG:~$ sudo fdisk -l [sudo] password for myaccount: Disk /dev/sda: 320.1 GB, 320072933376 bytes 255 heads, 63 sectors/track, 38913 cylinders Units = cylinders of 16065 * 512 = 8225280 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x00025b5f Device Boot Start End Blocks Id System /dev/sda1 * 1 38409 308515840 83 Linux /dev/sda2 38409 38914 4052993 5 Extended /dev/sda5 38409 38914 4052992 82 Linux swap / Solaris Disk /dev/dm-0: 4150 MB, 4150263808 bytes 255 heads, 63 sectors/track, 504 cylinders Units = cylinders of 16065 * 512 = 8225280 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0xa668cfe8 Disk /dev/dm-0 doesn't contain a valid partition table Is it gone? If not, what command should I try to have access to Windows partitions? Thank you.

    Read the article

  • Partition does not start on physical sector boundary?

    - by jasmines
    I've one HD on my laptop, with two partitions (one ext3 with Ubuntu 12.04 installed and one swap). fdisk is giving me a Partition 1 does not start on physical sector boundary warning. What is the cause and do I need to fix it? If so, how? This is sudo fdisk -l: Disk /dev/sda: 750.2 GB, 750156374016 bytes 255 testine, 63 settori/tracce, 91201 cilindri, totale 1465149168 settori Unità = settori di 1 * 512 = 512 byte Sector size (logical/physical): 512 bytes / 4096 bytes I/O size (minimum/optimal): 4096 bytes / 4096 bytes Identificativo disco: 0x5a25087f Dispositivo Boot Start End Blocks Id System /dev/sda1 * 63 1448577023 724288480+ 83 Linux Partition 1 does not start on physical sector boundary. /dev/sda2 1448577024 1465147391 8285184 82 Linux swap / Solaris This is sudo lshw related result: *-disk description: ATA Disk product: WDC WD7500BPKT-0 vendor: Western Digital physical id: 0 bus info: scsi@0:0.0.0 logical name: /dev/sda version: 01.0 serial: WD-WX21CC1T0847 size: 698GiB (750GB) capabilities: partitioned partitioned:dos configuration: ansiversion=5 signature=5a25087f *-volume:0 description: EXT3 volume vendor: Linux physical id: 1 bus info: scsi@0:0.0.0,1 logical name: /dev/sda1 logical name: / version: 1.0 serial: cc5c562a-bc59-4a37-b589-805b27b2cbd7 size: 690GiB capacity: 690GiB capabilities: primary bootable journaled extended_attributes large_files recover ext3 ext2 initialized configuration: created=2010-02-27 09:18:28 filesystem=ext3 modified=2012-06-23 18:33:59 mount.fstype=ext3 mount.options=rw,relatime,errors=remount-ro,user_xattr,barrier=1,data=ordered mounted=2012-06-28 00:20:47 state=mounted *-volume:1 description: Linux swap volume physical id: 2 bus info: scsi@0:0.0.0,2 logical name: /dev/sda2 version: 1 serial: 16a7fee0-be9e-4e34-9dc3-28f4eeb61bf6 size: 8091MiB capacity: 8091MiB capabilities: primary nofs swap initialized configuration: filesystem=swap pagesize=4096 These are related /etc/fstab lines: UUID=cc5c562a-bc59-4a37-b589-805b27b2cbd7 / ext3 errors=remount-ro,user_xattr 0 1 UUID=16a7fee0-be9e-4e34-9dc3-28f4eeb61bf6 none swap sw 0 0

    Read the article

  • Win7 no longer available after installing 12.04

    - by Michael
    I have installed Ubuntu 12.04 but my Windows 7 partition seems to have been lost. It is in sda2. Can anyone help me how to get this Windows 7 partition back without having to reinstall Windows 7? Disk /dev/sda: 500.1 GB, 500107862016 bytes 255 heads, 63 sectors/track, 60801 cylinders, total 976773168 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0xd45cd45c Device Boot Start End Blocks Id System /dev/sda1 2048 61433855 30715904 83 Linux /dev/sda2 * 61433856 122873855 30720000 7 HPFS/NTFS/exFAT /dev/sda3 122873856 976769023 426947584 7 HPFS/NTFS/exFAT Disk /dev/sdb: 203.9 GB, 203928109056 bytes 255 heads, 63 sectors/track, 24792 cylinders, total 398297088 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x03ee03ee Device Boot Start End Blocks Id System /dev/sdb1 * 63 20482874 10241406 c W95 FAT32 (LBA) /dev/sdb2 20482875 40965749 10241437+ 1c Hidden W95 FAT32 (LBA) /dev/sdb3 40965750 398283479 178658865 f W95 Ext'd (LBA) /dev/sdb5 40965813 76694309 17864248+ 7 HPFS/NTFS/exFAT /dev/sdb6 76694373 108856439 16081033+ 7 HPFS/NTFS/exFAT /dev/sdb7 108856503 398283479 144713488+ 7 HPFS/NTFS/exFAT Disk /dev/sdc: 1000.2 GB, 1000204886016 bytes 240 heads, 63 sectors/track, 129201 cylinders, total 1953525168 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x00000001 Device Boot Start End Blocks Id System /dev/sdc1 * 63 20480543 10240240+ 82 Linux swap / Solaris /dev/sdc2 20480605 1953519119 966519257+ f W95 Ext'd (LBA) /dev/sdc5 20480607 1953519119 966519256+ 7 HPFS/NTFS/exFAT

    Read the article

  • Passenger 'premature end of script headers' error

    - by fatnic
    Hi. I really need help debugging an error I'm getting with Passenger on Apache. I've just made a fresh install of Ubuntu 10.4 and have Apache, Ruby and Passenger installed. I'm trying to run a simple rack app but keep getting this error in my Apache error.log [Tue Sep 28 05:54:41 2010] [error] [client 86.171.2.82] Premature end of script headers: The error then continues with The backend application (process 25574) did not send a valid HTTP response; instead, it sent nothing at all. It is possible that it has crashed; please check whether there are crashing bugs in this application. *** Exception NoMethodError in PhusionPassenger::Rack::ApplicationSpawner (undefined method `call' for nil:NilClass) (process 25574): I've tried older versions of passenger also but get the same error. Ubuntu 10.4 Apache 2.2.14 Ruby 1.9.2-p0 Passenger 2.2.15

    Read the article

  • How to mount drive in /media/userName/ like nautilus do using udisks

    - by Bsienn
    As of my current installation of Ubuntu 13.10 Unity, when i click on a drive in nautilus it get mounted in /media/username/mountedDrive i read that nautilus use udisks to do that. Basically i want to auto mount my drive using udisks in start up using this method But problem is, it mounts the drive in /media/mountedDrive, but i want it the way nautilus do in /media/username/mounteDrive I want NTFS Data drive to be auto mounted at /media/bsienn/ bsienn@bsienn-desktop:~$ blkid /dev/sda1: LABEL="System Reserved" UUID="8230744030743D6B" TYPE="ntfs" /dev/sda2: LABEL="Windows 7" UUID="60100EA5100E81F0" TYPE="ntfs" /dev/sda3: LABEL="Data" UUID="882C04092C03F14C" TYPE="ntfs" /dev/sda5: UUID="8768800f-59e1-41a2-9092-c0a8cb60dabf" TYPE="swap" /dev/sda6: LABEL="Ubuntu Drive" UUID="13ea474a-fb27-4c91-bae7-c45690f88954" TYPE="ext4" /dev/sda7: UUID="69c22e73-9f64-4b48-b854-7b121642cd5d" TYPE="ext4" bsienn@bsienn-desktop:~$ sudo fdisk -l Disk /dev/sda: 160.0 GB, 160000000000 bytes 255 heads, 63 sectors/track, 19452 cylinders, total 312500000 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x8d528d52 Device Boot Start End Blocks Id System /dev/sda1 * 2048 206847 102400 7 HPFS/NTFS/exFAT /dev/sda2 206848 117730069 58761611 7 HPFS/NTFS/exFAT /dev/sda3 158690072 312494116 76902022+ 7 HPFS/NTFS/exFAT /dev/sda4 117731326 158689279 20478977 5 Extended /dev/sda5 137263104 141260799 1998848 82 Linux swap / Solaris /dev/sda6 141262848 158689279 8713216 83 Linux /dev/sda7 117731328 137263103 9765888 83 Linux Partition table entries are not in disk order bsienn@bsienn-desktop:~$ cat /etc/fstab # /etc/fstab: static file system information. # # Use 'blkid' to print the universally unique identifier for a # device; this may be used with UUID= as a more robust way to name devices # that works even if disks are added and removed. See fstab(5). # # <file system> <mount point> <type> <options> <dump> <pass> # / was on /dev/sda7 during installation UUID=69c22e73-9f64-4b48-b854-7b121642cd5d / ext4 errors=remount-ro 0 1 # swap was on /dev/sda5 during installation UUID=8768800f-59e1-41a2-9092-c0a8cb60dabf none swap sw 0 0 Desired effect: Picture link

    Read the article

  • How to remove bad disk from LVM2 with the less data loss on other PVs?

    - by Walkman
    I had a LVM2 volume with two disks. The larger disk became corrupt, so I cant pvmove. What is the best way to remove it from the group to save the most data from the other disk? Here is my pvdisplay output: Couldn't find device with uuid WWeM0m-MLX2-o0da-tf7q-fJJu-eiGl-e7UmM3. --- Physical volume --- PV Name unknown device VG Name media PV Size 1,82 TiB / not usable 1,05 MiB Allocatable yes (but full) PE Size 4,00 MiB Total PE 476932 Free PE 0 Allocated PE 476932 PV UUID WWeM0m-MLX2-o0da-tf7q-fJJu-eiGl-e7UmM3 --- Physical volume --- PV Name /dev/sdb1 VG Name media PV Size 931,51 GiB / not usable 3,19 MiB Allocatable yes (but full) PE Size 4,00 MiB Total PE 238466 Free PE 0 Allocated PE 238466 PV UUID oUhOcR-uYjc-rNTv-LNBm-Z9VY-TJJ5-SYezce So I want to remove the unknown device (not present in the system). Is it possible to do this without a new disk ? The filesystem is ext4.

    Read the article

  • ubuntu 11.10 can't find wireless after waking from sleep

    - by Colleen
    I've tried a lot of proposed solutions, most of them adding files to /etc/pm/config.d, as well as WiFi stops working after waking from suspend and nothing has worked. hardware info: [colleen@colleen-HP ~]$ sudo lshw -C network [sudo] password for colleen: *-network description: Ethernet interface product: RTL8111/8168B PCI Express Gigabit Ethernet controller vendor: Realtek Semiconductor Co., Ltd. physical id: 0 bus info: pci@0000:07:00.0 logical name: eth0 version: 06 serial: 2c:27:d7:b1:ea:67 size: 10Mbit/s capacity: 1Gbit/s width: 64 bits clock: 33MHz capabilities: pm msi pciexpress msix vpd bus_master cap_list ethernet physical tp mii 10bt 10bt-fd 100bt 100bt-fd 1000bt 1000bt-fd autonegotiation configuration: autonegotiation=on broadcast=yes driver=r8169 driverversion=2.3LK-NAPI duplex=half firmware=N/A latency=0 link=no multicast=yes port=MII speed=10Mbit/s resources: irq:41 ioport:4000(size=256) memory:c1404000-c1404fff memory:c1400000-c1403fff *-network description: Wireless interface product: Centrino Wireless-N 1000 vendor: Intel Corporation physical id: 0 bus info: pci@0000:0d:00.0 logical name: wlan0 version: 00 serial: 8c:a9:82:99:48:8c width: 64 bits clock: 33MHz capabilities: pm msi pciexpress bus_master cap_list ethernet physical wireless configuration: broadcast=yes driver=iwlagn driverversion=3.0.0-21-generic-pae firmware=39.31.5.1 build 35138 ip=192.168.0.4 latency=0 link=yes multicast=yes wireless=IEEE 802.11bgn resources: irq:48 memory:c5500000-c5501fff Is anyone else still having this problem? The two solutions I haven't tried are installing wicd and upgrading because I've heard both are kind of unstable/buggy and wicd frankly scares me.

    Read the article

  • how to access a mounted device, How can I access the partitions with the console

    - by user1796624
    Hi I'm new to ubuntu and linux so this might be a very begginers question. I have several partitions on my pc and I want to be able to access them with the console. When I type: sudo fdisk -l I get: /dev/sda1 * 2048 97656831 48827392 7 HPFS/NTFS/exFAT /dev/sda2 97656832 234375167 68359168 7 HPFS/NTFS/exFAT /dev/sda3 * 234375168 312500223 39062528 83 Linux /dev/sda4 312502270 625141759 156319745 5 Extended /dev/sda5 312502272 318359551 2928640 82 Linux swap / Solaris /dev/sda6 318361600 625141759 153390080 83 Linux But it seams that the address is existing. for example I cant do cd /dev/sda4. How can I access the partitions with the console?

    Read the article

  • Dual Boot Windows 8 and Ubuntu

    - by Nick
    My laptop has two hard drives, one 320GB HDD and a 30GB SSD. I installed Windows 8 on the HDD and Ubuntu on the SSD. However, after I installed Ubuntu, Windows 8 did not appear on the boot list. I tried boot-repair, but this didn't help.Here is the output of my fdisk -l: Disk /dev/sda: 320.1 GB, 320072933376 bytes 255 heads, 63 sectors/track, 38913 cylinders, total 625142448 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x6cd9314a Device Boot Start End Blocks Id System /dev/sda1 * 2048 625139711 312568832 7 HPFS/NTFS/exFAT Disk /dev/sdb: 30.0 GB, 30016659456 bytes 255 heads, 63 sectors/track, 3649 cylinders, total 58626288 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x6cd93132 Device Boot Start End Blocks Id System /dev/sdb1 * 2048 207126 102539+ 83 Linux /dev/sdb2 208894 58626047 29208577 5 Extended /dev/sdb5 208896 4112383 1951744 82 Linux swap / Solaris /dev/sdb6 4114432 58626047 27255808 83 Linux Disk /dev/mmcblk0: 3965 MB, 3965190144 bytes 49 heads, 48 sectors/track, 3292 cylinders, total 7744512 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x0009c694 Device Boot Start End Blocks Id System /dev/mmcblk0p1 * 8192 7744511 3868160 b W95 FAT32 I also tried sudo grub-update, but that also did nothing.

    Read the article

  • SD Card only mounted after a reboot

    - by evothur
    Hi everyone. I have a Kingston 2GB MicroSD and I plug it in via an inconix MicroSD Adapter to the internal card reader of my Samsung N210 Netbook with Ubuntu 10.10, but it doesn't show up. Only if I reboot the system when the card's plugged in it shows up. Why does it need a reboot for mounting? sudo fdisk -l gives the output below. But I can only see the drive when I reboot the computer while the card's plugged. Disk /dev/sda: 160.0 GB, 160041885696 bytes 255 heads, 63 sectors/track, 19457 cylinders Units = cylinders of 16065 * 512 = 8225280 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x9a5a7990 Device Boot Start End Blocks Id System /dev/sda1 1 1959 15728640 27 Unknown Partition 1 does not end on cylinder boundary. /dev/sda2 * 1959 1972 102400 7 HPFS/NTFS /dev/sda3 1972 18992 136718750 83 Linux /dev/sda4 18992 19458 3738625 5 Extended /dev/sda5 18992 19458 3738624 82 Linux swap / Solaris Disk /dev/sdb: 1973 MB, 1973420032 bytes 60 heads, 59 sectors/track, 1088 cylinders Units = cylinders of 3540 * 512 = 1812480 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x00000000 Device Boot Start End Blocks Id System /dev/sdb1 1 1089 1927100+ 6 FAT16

    Read the article

  • timeout duration on linux

    - by user1319451
    I'm trying to run a command for 5 hours and 10 minuts. I found out how to run it for 5 hours but I'm unable to run it for 5 hours and 10 minuts.. timeout -sKILL 5h mplayer -dumpstream http://82.201.100.23:80/slamfm -dumpfile slamfm.mp3 runs fine. But when I try timeout -sKILL 5h10m mplayer -dumpstream http://82.201.100.23:80/slamfm -dumpfile slamfm.mp3 I get this error timeout: invalid time interval `5h10m' Does anyone know a way to run this command for 5 hours and 10 minuts and then kill it?

    Read the article

  • ubuntu boots only with usb

    - by klimat
    Just installed Ubuntu 11.04. But it boots only from usb. Seems like I didn't pay attention during selecting boot device. sudo fdisk -l [sudo] password for klim: Disk /dev/sda: 500.1 GB, 500107862016 bytes 255 heads, 63 sectors/track, 60801 cylinders Units = cylinders of 16065 * 512 = 8225280 bytes Sector size (logical/physical): 512 bytes / 4096 bytes I/O size (minimum/optimal): 4096 bytes / 4096 bytes Disk identifier: 0x000177e1 Device Boot Start End Blocks Id System /dev/sda1 1 60045 482302976 83 Linux /dev/sda2 60045 60802 6080513 5 Extended Partition 2 does not start on physical sector boundary. /dev/sda5 60045 60802 6080512 82 Linux swap / Solaris Disk /dev/sdb: 4004 MB, 4004511744 bytes 124 heads, 62 sectors/track, 1017 cylinders Units = cylinders of 7688 * 512 = 3936256 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x000eee1a Device Boot Start End Blocks Id System /dev/sdb1 * 1 1017 3909317 b W95 FAT32 grub updating or another "grub" operations don't work as I've tried. Can I just copy whole boot folder from usb to HD or smth like that? Any kind of help is appreciated. Apologize for my newbie skills.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Wifi Hotspot not created in ubuntu 12.04

    - by user2406568
    I am using Hp Pavillion g4 with braodcom wireledd adpater. I have the following hardware configuration, for lan and wifi eth0 Link encap:Ethernet HWaddr 10:1f:74:b2:61:cc inet addr:10.3.10.45 Bcast:10.3.11.255 Mask:255.255.252.0 inet6 addr: fe80::121f:74ff:feb2:61cc/64 Scope:Link UP BROADCAST RUNNING MULTICAST MTU:1500 Metric:1 RX packets:190855 errors:0 dropped:0 overruns:0 frame:0 TX packets:133209 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:1000 RX bytes:77642990 (77.6 MB) TX bytes:25290447 (25.2 MB) Interrupt:44 Base address:0x6000 eth1 Link encap:Ethernet HWaddr 38:59:f9:7d:d6:b2 inet addr:10.3.9.180 Bcast:10.3.11.255 Mask:255.255.252.0 inet6 addr: fe80::3a59:f9ff:fe7d:d6b2/64 Scope:Link UP BROADCAST RUNNING MULTICAST MTU:1500 Metric:1 RX packets:245562 errors:82 dropped:0 overruns:0 frame:408011 TX packets:90383 errors:260 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:1000 RX bytes:140772881 (140.7 MB) TX bytes:13041542 (13.0 MB) Interrupt:16 lo Link encap:Local Loopback inet addr:127.0.0.1 Mask:255.0.0.0 inet6 addr: ::1/128 Scope:Host UP LOOPBACK RUNNING MTU:16436 Metric:1 RX packets:3230 errors:0 dropped:0 overruns:0 frame:0 TX packets:3230 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:0 RX bytes:435198 (435.1 KB) TX bytes:435198 (435.1 KB) whenever I click on create hotspot nothing happens. Any solution???

    Read the article

  • why in /proc file system have this infomation

    - by liutaihua
    run: lsof|grep delete can find some process open fd, but system dis that it had to delete: mingetty 2031 root txt REG 8,2 15256 49021039 /sbin/mingetty (deleted) I look the /proce filesystem: ls -l /proc/[pid] lrwxrwxrwx 1 root root 0 9? 17 16:12 exe -> /sbin/mingetty (deleted) but actually, the executable(/sbin/mingetty) is normal at /sbin/mingetty path. and some soket like this situation: ls -l /proc/[pid]/fd 82 -> socket:[23716953] but, use the commands: netstat -ae|grep [socket id] can find it. why the OS display this infomation??

    Read the article

  • How do I get 12.04 to recognize swap partition so that I can hibernate?

    - by Kayla
    I justed installed 12.04 and used gparted to erase and enlarge my swap partition. When I rebooted, gparted said that the file partition for the swap was unknown. Gparted doesn't let me change the file partition to "linux-swap". It does let me change it to NTFS, but when I reboot, it goes back to "unknown". Thanks in advance for your help. Output from sudo swapon -s: Filename Type Size Used Priority /dev/mapper/cryptswap1 partition 9025532 0 -1 Output from sudo fdisk -l: Disk /dev/sda: 250.1 GB, 250059350016 bytes 255 heads, 63 sectors/track, 30401 cylinders, total 488397168 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x9d63ac84 Device Boot Start End Blocks Id System /dev/sda1 * 2048 2459647 1228800 7 HPFS/NTFS/exFAT /dev/sda2 2459648 197836472 97688412+ 7 HPFS/NTFS/exFAT /dev/sda3 466890752 488395119 10752184 7 HPFS/NTFS/exFAT /dev/sda4 197836798 466890751 134526977 5 Extended /dev/sda5 197836800 448837631 125500416 83 Linux /dev/sda6 448839680 466890751 9025536 82 Linux swap / Solaris Partition table entries are not in disk order Disk /dev/mapper/cryptswap1: 9242 MB, 9242148864 bytes 255 heads, 63 sectors/track, 1123 cylinders, total 18051072 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x951b7f53 Disk /dev/mapper/cryptswap1 doesn't contain a valid partition table

    Read the article

  • Unable to mount location ubuntu 12.10

    - by Rajesh
    I'm new to Ubuntu. I installed Ubuntu 12.10 replacing windows. Now I'm getting Unable to mount location error while opening the drive. $ cat /etc/fstab # /etc/fstab: static file system information. # # Use 'blkid' to print the universally unique identifier for a # device; this may be used with UUID= as a more robust way to name devices # that works even if disks are added and removed. See fstab(5). # # <file system> <mount point> <type> <options> <dump> <pass> # / was on /dev/sda1 during installation UUID=5fa63194-c19e-4117-95c6-679eb6453d3b / ext4 errors=remount-ro 0 1 # swap was on /dev/sda5 during installation UUID=70f1ec8d-aa45-4de7-a206-747dccd2472b none swap sw 0 0 $ sudo fdisk -l Disk /dev/sda: 500.1 GB, 500107862016 bytes 255 heads, 63 sectors/track, 60801 cylinders, total 976773168 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x0001f10f Device Boot Start End Blocks Id System /dev/sda1 * 2048 970561535 485279744 83 Linux /dev/sda2 970563582 976771071 3103745 5 Extended /dev/sda5 970563584 976771071 3103744 82 Linux swap / Solaris

    Read the article

  • How can I get rid of the motd message "*** /dev/sdb1 will be checked for errors at next reboot ***"? [duplicate]

    - by kmm
    This question already has an answer here: Persistent “disk will be checked…” in the message of the day (motd) even after reboot 3 answers My motd persistently has: *** /dev/sdb1 will be checked for errors at next reboot *** The problem is that I don't have /dev/sdb1 on my system. I only have /dev/sdb2 (mouted as /) and /dev/sda1 which mounts to /media/backup. I delete that line from /etc/motd, but it reappears after reboot. Here's my df output: Filesystem Size Used Avail Use% Mounted on /dev/sdb2 73G 3.7G 66G 6% / udev 490M 4.0K 490M 1% /dev tmpfs 200M 760K 199M 1% /run none 5.0M 0 5.0M 0% /run/lock none 498M 0 498M 0% /run/shm /dev/sda1 1.9T 429G 1.4T 25% /media/backup Update Here is the output of sudo fdisk -l Disk /dev/sda: 2000.4 GB, 2000398934016 bytes 255 heads, 63 sectors/track, 243201 cylinders, total 3907029168 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x0003dfc2 Device Boot Start End Blocks Id System /dev/sda1 63 3907024064 1953512001 83 Linux Disk /dev/sdb: 80.0 GB, 80026361856 bytes 255 heads, 63 sectors/track, 9729 cylinders, total 156301488 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x00049068 Device Boot Start End Blocks Id System /dev/sdb1 152301568 156301311 1999872 82 Linux swap / Solaris /dev/sdb2 * 2048 152301567 76149760 83 Linux Partition table entries are not in disk order I guess /dev/sdb1 is my swap space.

    Read the article

  • why Ubuntu 12.04.1 nautilus left panel, doesn't show other partitions and usb drives?

    - by amerllica
    how do you do friends will be fine I had Ubuntu 12.04 and all thing work well but at one day i decide to change my partition tables, and done it. at now I've windows 8, Ubuntu 12.04.1 and Backtrack5 R3 on my laptop. my partitions are: /dev/sda1 * 2048 58597375 29297664 7 HPFS/NTFS/exFAT /dev/sda2 58601472 976773119 459085824 5 Extended /dev/sda5 58605120 797020159 369207520 7 HPFS/NTFS/exFAT /dev/sda6 797030400 933763071 68366336 83 Linux /dev/sda7 933765120 972834815 19534848 83 Linux /dev/sda8 972836864 976773119 1968128 82 Linux swap / Solaris at first I install windows 8 and then Backtrack5 R3, and at last I install Ubuntu 12.04.1 and I realize that my Ubuntu nautilus doesn't show other partitions or usb/cd/dvd drives. I search in Google and various Linux or Ubuntu forums, But I can't find any solution, just one thing... that is "gvfs-gdu-volume" cause nautilus left panel show other partitions which didn't mounted. but when I see top there isn't this program. who can I solve this problem? how nautilus can show other partitions or drives in its left panel once again?

    Read the article

  • Mounting a new hard drive (sda1) to my existing filesystem

    - by shank22
    I tried to read some posts regarding mounting a new hard drive, but I am facing some problem. My new hard drive is sda1. The output of sudo fdisk -l is: sudo fdisk -l Disk /dev/sdb: 999.7 GB, 999653638144 bytes 255 heads, 63 sectors/track, 121534 cylinders, total 1952448512 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x00016485 Device Boot Start End Blocks Id System /dev/sdb1 * 2048 1935822847 967910400 83 Linux /dev/sdb2 1935824894 1952446463 8310785 5 Extended /dev/sdb5 1935824896 1952446463 8310784 82 Linux swap / Solaris Disk /dev/sda: 1000.2 GB, 1000204886016 bytes 255 heads, 63 sectors/track, 121601 cylinders, total 1953525168 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 4096 bytes I/O size (minimum/optimal): 4096 bytes / 4096 bytes Disk identifier: 0x78dbcdc1 Device Boot Start End Blocks Id System /dev/sda1 2048 1953521663 976759808 7 HPFS/NTFS/exFAT What should be done to add this new sda1 hard drive on booting up? What should be added in the /etc/fstab file? I have not performed any partition on the new sda1 drive. I need help on how to proceed from scratch and can't afford to take any risk. Please help!

    Read the article

  • domain works randomly

    - by mthenw
    Hi, I have problem with configuring bind9 on debian (lenny) server. Generaly speaking everything is working ok but sometimes I get 404 on few domains (eg. 4stopnie.com but after few refreshes in browser site loads) or I can't validate site with validator.w3.org (error '500 Can't connect to 4stopnie.com:80 (Bad hostname '4stopnie.com')'). Domains were moved from other server. After moving I changed serial number in zone file. $ttl 600 @ IN SOA ns.wpoznaniu.info. xxx.4stopnie.com. ( 2011011601 3600 600 86400 600) @ IN NS ns.wpoznaniu.info. @ IN A 80.82.21.196 www IN CNAME @

    Read the article

  • Errors rose when a Netbean Maven Project tries to run

    - by Zakaria
    Hi everybody, I installed NetBeans 6.8 on Vista and and I'm trying to execute a simple Maven Project. When I ran the project, I got this set of errors: WARNING: You are running embedded Maven builds, some build may fail due to incompatibilities with latest Maven release. To set Maven instance to use for building, click here. Scanning for projects... [#process-resources] [resources:resources] Using default encoding to copy filtered resources. [#compile] [compiler:compile] Nothing to compile - all classes are up to date [exec:exec] [EL Info]: 2010-04-04 18:22:54.907--ServerSession(15532856)--EclipseLink, version: Eclipse Persistence Services - 2.0.0.v20091127-r5931 [EL Severe]: 2010-04-04 18:22:54.929--ServerSession(15532856)--Local Exception Stack: Exception [EclipseLink-4003] (Eclipse Persistence Services - 2.0.0.v20091127-r5931): org.eclipse.persistence.exceptions.DatabaseException Exception in thread "main" javax.persistence.PersistenceException: Exception [EclipseLink-4003] (Eclipse Persistence Services - 2.0.0.v20091127-r5931): org.eclipse.persistence.exceptions.DatabaseException Exception Description: Configuration error. Class [org.apache.derby.jdbc.ClientDriver] not found. Exception Description: Configuration error. Class [org.apache.derby.jdbc.ClientDriver] not found. at org.eclipse.persistence.exceptions.DatabaseException.configurationErrorClassNotFound(DatabaseException.java:82) at org.eclipse.persistence.sessions.DefaultConnector.loadDriverClass(DefaultConnector.java:267) at org.eclipse.persistence.sessions.DefaultConnector.connect(DefaultConnector.java:85) at org.eclipse.persistence.internal.jpa.EntityManagerSetupImpl.deploy(EntityManagerSetupImpl.java:392) at org.eclipse.persistence.sessions.DatasourceLogin.connectToDatasource(DatasourceLogin.java:162) at org.eclipse.persistence.internal.jpa.EntityManagerFactoryImpl.getServerSession(EntityManagerFactoryImpl.java:151) at org.eclipse.persistence.internal.sessions.DatabaseSessionImpl.loginAndDetectDatasource(DatabaseSessionImpl.java:584) at org.eclipse.persistence.internal.jpa.EntityManagerFactoryImpl.createEntityManagerImpl(EntityManagerFactoryImpl.java:207) at org.eclipse.persistence.internal.jpa.EntityManagerFactoryProvider.login(EntityManagerFactoryProvider.java:228) at org.eclipse.persistence.internal.jpa.EntityManagerFactoryImpl.createEntityManager(EntityManagerFactoryImpl.java:195) at com.mycompany.chapter2_ex1.Main.main(Main.java:31) Caused by: Exception [EclipseLink-4003] (Eclipse Persistence Services - 2.0.0.v20091127-r5931): org.eclipse.persistence.exceptions.DatabaseException Exception Description: Configuration error. Class [org.apache.derby.jdbc.ClientDriver] not found. at org.eclipse.persistence.internal.jpa.EntityManagerSetupImpl.deploy(EntityManagerSetupImpl.java:368) at org.eclipse.persistence.exceptions.DatabaseException.configurationErrorClassNotFound(DatabaseException.java:82) at org.eclipse.persistence.internal.jpa.EntityManagerFactoryImpl.getServerSession(EntityManagerFactoryImpl.java:151) at org.eclipse.persistence.sessions.DefaultConnector.loadDriverClass(DefaultConnector.java:267) at org.eclipse.persistence.internal.jpa.EntityManagerFactoryImpl.createEntityManagerImpl(EntityManagerFactoryImpl.java:207) at org.eclipse.persistence.sessions.DefaultConnector.connect(DefaultConnector.java:85) at org.eclipse.persistence.internal.jpa.EntityManagerFactoryImpl.createEntityManager(EntityManagerFactoryImpl.java:195) at org.eclipse.persistence.sessions.DatasourceLogin.connectToDatasource(DatasourceLogin.java:162) at com.mycompany.chapter2_ex1.Main.main(Main.java:31) at org.eclipse.persistence.internal.sessions.DatabaseSessionImpl.loginAndDetectDatasource(DatabaseSessionImpl.java:584) at org.eclipse.persistence.internal.jpa.EntityManagerFactoryProvider.login(EntityManagerFactoryProvider.java:228) at org.eclipse.persistence.internal.jpa.EntityManagerSetupImpl.deploy(EntityManagerSetupImpl.java:368) ... 4 more [ERROR]The following mojo encountered an error while executing: [ERROR]Group-Id: org.codehaus.mojo [ERROR]Artifact-Id: exec-maven-plugin [ERROR]Version: 1.1.1 [ERROR]Mojo: exec [ERROR]brought in via: Direct invocation [ERROR]While building project: [ERROR]Group-Id: com.mycompany [ERROR]Artifact-Id: chapter2_ex1 [ERROR]Version: 1.0-SNAPSHOT [ERROR]From file: C:\Users\Charlotte\Documents\NetBeansProjects\chapter2_ex1\pom.xml [ERROR]Reason: Result of cmd.exe /X /C ""C:\Program Files\Java\jdk1.6.0_11\bin\java.exe" -classpath C:\Users\Charlotte\Documents\NetBeansProjects\chapter2_ex1\target\classes;C:\Users\Charlotte\.m2\repository\javax\persistence\persistence-api\1.0\persistence-api-1.0.jar;C:\Users\Charlotte\.m2\repository\org\eclipse\persistence\javax.persistence\2.0.0\javax.persistence-2.0.0.jar;C:\Users\Charlotte\.m2\repository\org\eclipse\persistence\eclipselink\2.0.0-RC1\eclipselink-2.0.0-RC1.jar com.mycompany.chapter2_ex1.Main" execution is: '1'. ------------------------------------------------------------------------ For more information, run with the -e flag ------------------------------------------------------------------------ BUILD FAILED ------------------------------------------------------------------------ Total time: 3 seconds Finished at: Sun Apr 04 18:22:55 CEST 2010 Final Memory: 47M/94M ------------------------------------------------------------------------ Theses exceptions rose even if I can run the database by using the console (ij) and when I connect the Database, no errors are showing. Can you help me please? Thank you very much. Regards.

    Read the article

  • How do I send an email with embedded images AND regular attachments in JavaMail?

    - by Chris
    Hi, I'd like to know how to build an SMTP multipart message in the correct order so that it will render correctly on the iPhone mail client (rendering correctly in GMail). I'm using Javamail to build up an email containing the following parts: A body part with content type "text/html; UTF-8" An embedded image attachment. A file attachment I am sending the mail via GMail SMTP (via SSL) and the mail is sent and rendered correctly using a GMail account, however, the mail does not render correctly on the iPhone mail client. On the iPhone mail client, the image is rendered before the "Before Image" text when it should be rendered afterwards. After the "Before Image" text there is an icon with a question mark (I assume it means it couldn't find the referenced CID). I'm not sure if this is a limitation of the iPhone mail client or a bug in my mail sending code (I strongly assume the latter). I think that perhaps the headers on my parts might by incorrect or perhaps I am providing the multiparts in the wrong order. I include the text of the received mail as output by gmail (which renders the file correc Message-ID: <[email protected]> Subject: =?UTF-8?Q?Test_from_=E3=82=AF=E3=83=AA=E3=82=B9?= MIME-Version: 1.0 Content-Type: multipart/mixed; boundary="----=_Part_0_20870565.1274154021755" ------=_Part_0_20870565.1274154021755 Content-Type: application/octet-stream Content-Transfer-Encoding: base64 Content-ID: <20100518124021763_368238_0> iVBORw0K ----- TRIMMED FOR CONCISENESS 6p1VVy4alAAAAABJRU5ErkJggg== ------=_Part_0_20870565.1274154021755 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: 7bit <html><head><title>Employees Favourite Foods</title> <style> body { font: normal 8pt arial; } th { font: bold 8pt arial; white-space: nowrap; } td { font: normal 8pt arial; white-space: nowrap; } </style></head><body> Before Image<br><img src="cid:20100518124021763_368238_0"> After Image<br><table border="0"> <tr> <th colspan="4">Employees Favourite Foods</th> </tr> <tr> <th align="left">Name</th><th align="left">Age</th><th align="left">Tel.No</th><th align="left">Fav.Food</th> </tr> <tr style="background-color:#e0e0e0"> <td>Chris</td><td>34</td><td>555-123-4567</td><td>Pancakes</td> </tr> </table></body></html> ------=_Part_0_20870565.1274154021755 Content-Type: text/plain; charset=us-ascii; name=textfile.txt Content-Transfer-Encoding: 7bit Content-Disposition: attachment; filename=textfile.txt This is a textfile with numbers counting from one to ten beneath this line: one two three four five six seven eight nine ten(no trailing carriage return) ------=_Part_0_20870565.1274154021755-- Even if you can't assist me with this, I would appreciate it if any members of the forum could forward me a (non-personal) mail that includes inline images (not external hyperlinked images though). I just need to find a working sample then I can move past this. Thanks, Chris.

    Read the article

  • Order of parts in SMTP multipart messages

    - by Chris
    Hi, I'd like to know how to build an SMTP multipart message in the correct order so that it will render correctly on the iPhone mail client (rendering correctly in GMail). I'm using Javamail to build up an email containing the following parts: A body part with content type "text/html; UTF-8" An embedded image attachment. A file attachment I am sending the mail via GMail SMTP (via SSL) and the mail is sent and rendered correctly using a GMail account, however, the mail does not render correctly on the iPhone mail client. On the iPhone mail client, the image is rendered before the "Before Image" text when it should be rendered afterwards. After the "Before Image" text there is an icon with a question mark (I assume it means it couldn't find the referenced CID). I'm not sure if this is a limitation of the iPhone mail client or a bug in my mail sending code (I strongly assume the latter). I think that perhaps the headers on my parts might by incorrect or perhaps I am providing the multiparts in the wrong order. I include the text of the received mail as output by gmail (which renders the file correc Message-ID: <[email protected]> Subject: =?UTF-8?Q?Test_from_=E3=82=AF=E3=83=AA=E3=82=B9?= MIME-Version: 1.0 Content-Type: multipart/mixed; boundary="----=_Part_0_20870565.1274154021755" ------=_Part_0_20870565.1274154021755 Content-Type: application/octet-stream Content-Transfer-Encoding: base64 Content-ID: <20100518124021763_368238_0> iVBORw0K ----- TRIMMED FOR CONCISENESS 6p1VVy4alAAAAABJRU5ErkJggg== ------=_Part_0_20870565.1274154021755 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: 7bit <html><head><title>Employees Favourite Foods</title> <style> body { font: normal 8pt arial; } th { font: bold 8pt arial; white-space: nowrap; } td { font: normal 8pt arial; white-space: nowrap; } </style></head><body> Before Image<br><img src="cid:20100518124021763_368238_0"> After Image<br><table border="0"> <tr> <th colspan="4">Employees Favourite Foods</th> </tr> <tr> <th align="left">Name</th><th align="left">Age</th><th align="left">Tel.No</th><th align="left">Fav.Food</th> </tr> <tr style="background-color:#e0e0e0"> <td>Chris</td><td>34</td><td>555-123-4567</td><td>Pancakes</td> </tr> </table></body></html> ------=_Part_0_20870565.1274154021755 Content-Type: text/plain; charset=us-ascii; name=textfile.txt Content-Transfer-Encoding: 7bit Content-Disposition: attachment; filename=textfile.txt This is a textfile with numbers counting from one to ten beneath this line: one two three four five six seven eight nine ten(no trailing carriage return) ------=_Part_0_20870565.1274154021755-- Even if you can't assist me with this, I would appreciate it if any members of the forum could forward me a (non-personal) mail that includes inline images (not external hyperlinked images though). I just need to find a working sample then I can move past this. Thanks, Chris.

    Read the article

< Previous Page | 18 19 20 21 22 23 24 25 26 27 28 29  | Next Page >