Search Results

Search found 39682 results on 1588 pages for 'text pattern'.

Page 22/1588 | < Previous Page | 18 19 20 21 22 23 24 25 26 27 28 29  | Next Page >

  • Extracting pure content / text from HTML Pages by excluding navigation and chrome content

    - by Ankur Gupta
    Hi, I am crawling news websites and want to extract News Title, News Abstract (First Paragraph), etc I plugged into the webkit parser code to easily navigate webpage as a tree. To eliminate navigation and other non news content I take the text version of the article (minus the html tags, webkit provides api for the same). Then I run the diff algorithm comparing various article's text from same website this results in similar text being eliminated. This gives me content minus the common navigation content etc. Despite the above approach I am still getting quite some junk in my final text. This results in incorrect News Abstract being extracted. The error rate is 5 in 10 article i.e. 50%. Error as in Can you Suggest an alternative strategy for extraction of pure content, Would/Can learning Natural Language rocessing help in extracting correct abstract from these articles ? How would you approach the above problem ?. Are these any research papers on the same ?. Regards Ankur Gupta

    Read the article

  • Sunspot / Solr full text search - how to index Rails associations

    - by Sam
    Is it possible to index through an association with Sunspot? For example, if a Customer has_many Contacts, I want a 'searchable' block on my Customer model that indexes the Contact#first_name and Contact#last_name columns for use in searches on Customer. acts_as_solr has an :include option for this. I've simply been combining the associated column names into a text field on Customer like shown below, but this doesn't seem very flexible. searchable do text :organization_name, :default_boost => 2 text :billing_address1, :default_boost => 2 text :contact_names do contacts.map { |contact| contact.to_s } end Any suggestions?

    Read the article

  • Sublime Text LaTeXTools console autohide

    - by DCh
    The build script in the LaTeXTools plugin for Sublime Text editor pops up the console, where the result of the compilation is written. I would like the console to auto-hide once the compilation is finished and there are no errors (and to stay open otherwise). I knew how to achieve this with Sublime Text 2. (I think I inserted two lines sublime.active_window().run_command("show_panel", {"panel": "console", "toggle": True})) somewhere in the build script.) How to achieve this behavior with Sublime Text 3? How to (properly) achieve this behavior with Sublime Text 2?

    Read the article

  • Mysql german accents not-sensitive search in full-text searches

    - by lukaszsadowski
    Let`s have a example hotels table: CREATE TABLE `hotels` ( `HotelNo` varchar(4) character set latin1 NOT NULL default '0000', `Hotel` varchar(80) character set latin1 NOT NULL default '', `City` varchar(100) character set latin1 default NULL, `CityFR` varchar(100) character set latin1 default NULL, `Region` varchar(50) character set latin1 default NULL, `RegionFR` varchar(100) character set latin1 default NULL, `Country` varchar(50) character set latin1 default NULL, `CountryFR` varchar(50) character set latin1 default NULL, `HotelText` text character set latin1, `HotelTextFR` text character set latin1, `tagsforsearch` text character set latin1, `tagsforsearchFR` text character set latin1, PRIMARY KEY (`HotelNo`), FULLTEXT KEY `fulltextHotelSearch` (`HotelNo`,`Hotel`,`City`,`CityFR`,`Region`,`RegionFR`,`Country`,`CountryFR`,`HotelText`,`HotelTextFR`,`tagsforsearch`,`tagsforsearchFR`) ) ENGINE=MyISAM DEFAULT CHARSET=latin1 COLLATE=latin1_german1_ci; In this table for example we have only one hotel with Region name = "Graubünden" (please note umlaut ü character) And now I want to achieve same search match for phrases: 'graubunden' and 'graubünden' This is simple with use of MySql built in collations in regular searches as follows: SELECT * FROM `hotels` WHERE `Region` LIKE CONVERT(_utf8 '%graubunden%' USING latin1) COLLATE latin1_german1_ci This works fine for 'graubunden' and 'graubünden' and as a result I receive proper result, but problem is when we make MySQL full text search Whats wrong with this SQL statement?: SELECT * FROM hotels WHERE MATCH (`HotelNo`,`Hotel`,`Address`,`City`,`CityFR`,`Region`,`RegionFR`,`Country`,`CountryFR`, `HotelText`, `HotelTextFR`, `tagsforsearch`, `tagsforsearchFR`) AGAINST( CONVERT('+graubunden' USING latin1) COLLATE latin1_german1_ci IN BOOLEAN MODE) ORDER BY Country ASC, Region ASC, City ASC This doesn`t return any result. Any ideas where the dog is buried ?

    Read the article

  • javascript normalize whitespace and other plain-text formatting routines

    - by dreftymac
    Background: The language is JavaScript. The goal is to find a library or pre-existing code to do low-level plain-text formatting. I can write it myself, but why re-invent the wheel. The issue is: it is tough to determine if a "wheel" is out there, since any search for JavaScript libraries pulls up an ocean of HTML-centric stuff. I am not interested in HTML necessarily, just text. Example: I need a JavaScript function that changes this: BEFORE: nisi ut aliquip | ex ea commodo consequat duis |aute irure dolor in esse cillum dolore | eu fugiat nulla pariatur |excepteur sint occa in culpa qui | officia deserunt mollit anim id |est laborum ... into this ... AFTER: nisi ut aliquip | ex ea commodo consequat duis | aute irure dolor in esse cillum dolore | eu fugiat nulla pariatur | excepteur sint occa in culpa qui | officia deserunt mollit anim id | est laborum Question: Does it exist, a JavaScript library that is non-html-web-development-centric that has functions for normalizing spaces in delimited plain text, justifying and spacing plain text? Rationale: Investigating JavaScript for use in a programmer's text editor.

    Read the article

  • How to make Excel strip ALL quotes from CSV text fields

    - by Klay
    When importing a CSV file into Excel, it only strips the double-quotes from the FIRST field on the line, but leaves them on all other fields. How can I force Excel to strip the quotes from ALL strings? For instance, I have a CSV file: "text1", "text2", "numeric1", "numeric 2" "abc", "def", 123, 456 "abc", "def", 123, 456 "abc", "def", 123, 456 "abc", "def", 123, 456 I import it into Excel using Data Import External Data Import Data. I specify that the fields are delimited by commas, and that the text delimiter is the double-quote character. Both the data preview and the actual Excel spreadsheet columns only strip the double-quotes from the first text field. All other text fields still have quotes around them. What's really strange is that Access is able to import this data correctly (i.e. strips quotes from every text field. Note that this is NOT a matter of internal commas or quotes or escape characters. This happens in Excel 2003 and Excel 2007.

    Read the article

  • Generic Text Only printer driver mangles control codes

    - by Terry
    If an escape character (or most other characters < 0x20) is sent to the generic / text only printer it gets printed as a period. Using the code in the WinDDK is it possible to 'correct' this behaviour so that it passes it through unmodified? The general scenario for this is that some application ('user app') outputs a document to a windows printer. My application requires this data in plain text form and so what I do is run a generic / text only printer that talks to a virtual com port. This generally works fine except where the 'user app' outputs binary data to the print queue without using the correct mechanism (which seems to work fine on some printer drivers, such as the Epson POS ones, but not the generic / text only one). I've tried changing the print processor selection without success and also tried looking at the gtt files to see if I could readily map in these characters as though they were printable, but the minidriver tool won't let me do that. Any suggestions?

    Read the article

  • flex textarea text attribute but still renders as html

    - by David
    actually i got to the cause of the issue. if you feed the textarea text attribute with an tag that has a valid src url, then for some reason flex will try to render everything as html. Eg, try this: <mx:TextArea id="textArea" width="100%" height="90%" text="<img src='http://url-to-a-valid-img"/> and instead of it rendering it as raw text it will render it as an html. any idea?

    Read the article

  • Inner text shadow with CSS

    - by eteubert
    Hey Folks, I am currently playing around with CSS3 and trying to achieve a text effect like this (the black blurry inner shadow): But I cannot find a way to create text shadows inside the text. I wonder whether it is still possible because the box-shadow element is able to render shadow inside like this: box-shadow: inset 0px -5px 10px 0px rgba(0, 0, 0, 0.5); Any ideas?

    Read the article

  • Objective C -- property lists or text files?

    - by William Jockusch
    I need to import a list of about 40,000 words into my Iphone app. The list will be the same every time the app starts. It seems that property lists and text files are reasonable options. Any reason to prefer one over the other? For reasons I don't understand, finder says the property list on my mac is 1MB, while the text file is only 328K. The property list is an NSMutableArray of NSMutableArrays of NSStrings. The text file is a plain txt file. But amount of time the app takes to start up is also important. If I read in a text file, my app would have to do some simple processing on it each time it starts. Thanks.

    Read the article

  • Text Editor For Flash?

    - by JasonS
    Hi, I work for a company which produces flash websites. The CMS is built in PHP. The client can update the text on the CMS site. Currently it uses a really old, bad, flash text-editor. It needs to be upgraded to something much much better. I need a text editor that will produce 'flash-html' as well as 'valid-html'. Or even something that marks up the text in the way that would allow me to do this. I tried using TinyMCE and ran into problems trying to convert the HTML. Has anyone tried doing this? Can anyone recommend anything or give any tips on how I can do this?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Getting a asp:radiobutton text in javascript?

    - by bala3569
    How to get a asp:radiobutton text in javascript? I use this RbDriver1.Text = dt.Rows[0].ItemArray[5].ToString(); RbDriver2.Text = dt.Rows[0].ItemArray[6].ToString() ; and my javascript function is function getDriverwireless() { alert(document.getElementById("ctl00_ContentPlaceHolder1_RbDriver1")); alert(document.getElementById("ctl00_ContentPlaceHolder1_RbDriver1").innerHTML); } innerHTML doesnt seems to take the text of my radiobutton...any suggestion When i inspect throgh firebug i found this <input type="radio" onclick="getDriverwireless();" value="RbDriver1" name="ctl00$ContentPlaceHolder1$drivername" id="ctl00_ContentPlaceHolder1_RbDriver1"> <label for="ctl00_ContentPlaceHolder1_RbDriver1">kamal,9566454564</label> I want to get the value kamal,9566454564 in javascript...

    Read the article

  • Can you recommend a full-text search engine?

    - by Jen
    Can you recommend a full-text search engine? (Preferably open source) I have a database of many (though relatively short) HTML documents. I want users to be able to search this database by entering one or more search words in my C++ desktop application. Hence, I’m looking for a fast full-text search solution to integrate with my app. Ideally, it should: Skip common words, such as the, of, and, etc. Support stemming, i.e. search for run also finds documents containing runner, running and ran. Be able to update its index in the background as new documents are added to the database. Be able to provide search word suggestions (like Google Suggest) Have a well-documented API To illustrate, assume the database has just two documents: Document 1: This is a test of text search. Document 2: Testing is fun. The following words should be in the index: fun, search, test, testing, text. If the user types t in the search box, I want the application to be able to suggest test, testing and text (Ideally, the application should be able to query the search engine for the 10 most common search words starting with t). A search for testing should return both documents. Other points: I don't need multi-user support I don't need support for complex queries The database resides on the user's computer, so the indexing should be performed locally. Can you suggest a C or C++ based solution? (I’ve briefly reviewed CLucene and Xapian, but I’m not sure if either will address my needs, especially querying the search word indexes for the suggest feature).

    Read the article

  • Replace text in div when image is clicked

    - by Adam
    Hello, I'm trying to replace certain text inside the div "info" when an image (which serve as links) is clicked. I'm just unsure of what methods could do this. I would prefer this be jquery. My code so far looks like: <div class="info"> <p>I would like this text replaced</p> <script> </script> </div><!--end info--> <li><a href="1.jpg"><img src="1-s.png" width="55" height="55" alt="" class="latest_img" /></a><p>Replace the div "info" text with the text here when clicked on</p></li>

    Read the article

  • Convert Audio File to text using System.Speech

    - by Kushal Kalambi
    I am looking to convert a .wav file recorded through an android phone at 16000 to text using C#; namely the System.Speech namespace. My code is mentioned below; recognizer.SetInputToWaveFile(Server.MapPath("~/spoken.wav")); recognizer.LoadGrammar(new DictationGrammar()); RecognitionResult result = recognizer.Recognize(); label1.Text = result.Text; The is working perfectly with sample .wav "Hello world" file. However when i record something on teh phone and try to convert to on the pc, the converted text is no where close to what i had recoreded. Is there some way to make sure the audio file is transcribed accurately?

    Read the article

  • horizontal scroll bar of IE and input text box

    - by sharpboy2008
    I have a situation, where I have a text input box in IE(input type='text') But the horizontal scroll bar of IE will be shown when it has lots of texts , and the box is not fixed-size. What I would like to have is: 1. The input box should accommodate the whole text(not fixed -size). the horizontal scroll bar of IE will not be shown.

    Read the article

  • Algorithm for multiple word matching in a text, count the number of every matched word

    - by 66
    I have noticed that it has solutions for matching multiple words in a given text, such as below: http://stackoverflow.com/questions/1099985/algorithm-for-multiple-word-matching-in-text If I want to know exactly the number of appearances of each matched word in the text, my solution is like this: step 1: using ac-algorithm to obtain the maching words; step 2: count the number of each word obtained in step 1 is there a faster way? Thx~

    Read the article

  • How to overwrite specific lines on text files

    - by iTayb
    I have two text files. I'd like to copy a specific part in the first text file and replace it with a part of the second text file. This is how I read the files: List<string> PrevEp = File.ReadAllLines(string.Format(@"{0}naruto{1}.ass", url, PrevEpNum)).ToList(); List<string> Ep = File.ReadAllLines(string.Format(@"{0}naruto{1}.ass", url, EpNum)).ToList(); The part in PrevEp that I need: from the start until it meets a line that includes Creditw,,0000,0000,0000. The part I would like to overwrite in Ep: from the start to a line which is exactly Format: Layer, Start, End, Style, Name, MarginL, MarginR, MarginV, Effect, Text. I'm not so sure how may I do it. Could you lend me a hand? Thank you very much, gentlemen.

    Read the article

  • Reading a text file in c++

    - by Yavuz Karacabey
    string numbers; string fileName = "text.txt"; ifstream inputFile; inputFile.open(fileName.c_str(),ios_base::in); inputFile >> numbers; inputFile.close(); cout << numbers; And my text.txt file is: 1 2 3 4 5 basically a set of integers separated by tabs. The problem is the program only reads the first integer in the text.txt file and ignores the rest for some reason. If I remove the tabs between the integers it works fine, but with tabs between them, it won't work. What causes this? As far as I know it should ignore any white space characters or am I mistaken? If so is there a better way to get each of these numbers from the text file?

    Read the article

  • jQuery getting text-shadow variabile

    - by Mircea
    Hi, I want to get 4 variables when I click on a span that have the CSS3 text-shadow propriety. So for a css propriety of text-shadow: -4px 11px 8px rgb(30, 43, 2);, my code should be: $("#element").click(function () { var text-shadow = $("#element").css("text-shadow") }); Would it be possible to get it split like: var y = "-4px"; var x = "11px"; var blur = "8px"; color = "rgb(30, 43, 2)"; I need to somehow split the first variable to get this data. Thanx

    Read the article

  • Offering text in different sizes

    - by Simon R
    This is a general question of sorts, but do you think that it's important to offer text resizing tools on a website, which in essense only effect text as it seems that most browsers offer text resising or more commonly zooming?

    Read the article

  • Count word occurrences in a text field with LINQ

    - by Yoann. B
    How can i get the occurrences count of a Word in a database text field With LINQ ? Keyword token sample : ASP.NET EDIT 4 : Database Records : Record 1 : [TextField] = "Blah blah blah ASP.NET bli bli bli ASP.NET blu ASP.NET yop yop ASP.NET" Record 2 : [TextField] = "Blah blah blah bli bli bli blu ASP.NET yop yop ASP.NET" Record 3 : [TextField] = "Blah ASP.NET blah ASP.NET blah ASP.NET bli ASP.NET bli bli ASP.NET blu ASP.NET yop yop ASP.NET" So Record 1 Contains 4 occurrence of "ASP.NET" keyword Record 2 Contains 2 occurrence of "ASP.NET" keyword Record 3 Contains 7 occurrence of "ASP.NET" keyword Collection Extraction IList < RecordModel (ordered by word count descending) Record 3 Record 1 Record 2 LinqToSQL should be the best, but LinqToObject too :) NB : No issue about the "." of ASP.NET keyword (this is not the goal if this question)

    Read the article

< Previous Page | 18 19 20 21 22 23 24 25 26 27 28 29  | Next Page >