Search Results

Search found 130394 results on 5216 pages for 'run a sql script file in c'.

Page 221/5216 | < Previous Page | 217 218 219 220 221 222 223 224 225 226 227 228  | Next Page >

  • Converting FoxPro Date type to SQL Server 2005 DateTime using SSIS

    - by Avrom
    Hi, When using SSIS in SQL Server 2005 to convert a FoxPro database to a SQL Server database, if the given FoxPro database has a date type, SSIS assumes it is an integer type. The only way to convert it to a dateTime type is to manually select this type. However, that is not practical to do for over 100 tables. Thus, I have been using a workaround in which I use DTS on SQL Server 2000 which converts it to a smallDateTime, then make a backup, then a restore into SQL Server 2005. This workaround is starting to be a little annoying. So, my question is: Is there anyway to setup SSIS so that whenever it encounters a date type to automatically assume it should be converted to a dateTime in SQL Server and apply that rule across the board? Update To be specific, if I use the import/export wizard in SSIS, I get the following error: Column information for the source and the destination data could not be retrieved, or the data types of source columns were not mapped correctly to those available on the destination provider. Followed by a list of a given table's date columns. If I manually set each one to a dateTime, it imports fine. But I do not wish to do this for a hundred tables.

    Read the article

  • Validate a string in a table in SQL Server

    - by Ashish Gupta
    I need to check If a column value (string) in SQL server table starts with a small letter and can only contain '_', '-', numbers and alphabets. I know I can use a SQL server CLR function for that. However, I am trying to implement that validation using a scalar UDF and could make very little here...I can use 'NOT LIKE', but I am not sure how to make sure I validate the string irrespective of the order of characters or in other words write a pattern in SQL for this. Am I better off using a SQL CLR function? Any help will be appreciated.. Thanks in advance

    Read the article

  • Cleanest way to build an SQL string in Java

    - by Vidar
    I want to build an SQL string to do database manipulation (updates, deletes, inserts, selects, that sort of thing) - instead of the awful string concat method using millions of "+"'s and quotes which is unreadable at best - there must be a better way. I did think of using MessageFormat - but its supposed to be used for user messages, although I think it would do a reasonable job - but I guess there should be something more aligned to SQL type operations in the java sql libraries. Would Groovy be any good? Any help much appreciated.

    Read the article

  • return sql query in xml format in python

    - by Ramy
    When I first started working at the company that i work at now, I created a java application that would run batches of jasper-reports. In order to determine which parameters to use for each report in the set of reports, I run a sql query (on sqlserver). I wrote the application to take an xml file with a set of parameters for each report to be generated in the set. so, my process has become, effectively, three steps: run the sql query and return the results in XML format (using 'for XML auto') run the results of the sql query through an XSLT transformation so the xml is formatted in such a way that is friendly with the java application i wrote. run the java application with that final xml file As you can imagine, what I'd like to do is accomplish these steps in python, but i'm not quite sure how to get started. I know how to run an SQL query in Python. I see plenty of documentation about how to write your own xml document with Python. I even see documentation for xsl transformations in python. the big question is how to get the results of the sql query in XML through python. Any and all pointers would be very valuable. Thanks, _Ramy

    Read the article

  • Translate SQL to OCL ?

    - by Roland Bengtsson
    I have a piece of SQL that I want to translate to OCL. I'm not good at SQL so I want to increase maintainability by this. We are using Interbase 2009, Delphi 2007 with Bold and modeldriven development. Now my hope is that someone here both speaks good SQL and OCL :-) The original SQL: Select Bold_Id, MessageId, ScaniaId, MessageType, MessageTime, Cancellation, ChassieNumber, UserFriendlyFormat, ReceivingOwner, Invalidated, InvalidationReason, (Select Parcel.MCurrentStates From Parcel Where ScaniaEdiSolMessage.ReceivingOwner = Parcel.Bold_Id) as ParcelState From ScaniaEdiSolMessage Where MessageType = 'IFTMBP' and not Exists (Select * From ScaniaEdiSolMessage EdiSolMsg Where EdiSolMsg.ChassieNumber = ScaniaEdiSolMessage.ChassieNumber and EdiSolMsg.ShipFromFinland = ScaniaEdiSolMessage.ShipFromFinland and EdiSolMsg.MessageType = 'IFTMBF') and invalidated = 0 Order By MessageTime desc After a small simplification: Select Bold_Id, (Select Parcel.MCurrentStates From Parcel where ScaniaEdiSolMessage.ReceivingOwner = Parcel.Bold_Id) From ScaniaEdiSolMessage Where MessageType = 'IFTMBP' and not Exists (Select * From ScaniaEdiSolMessage EdiSolMsg Where EdiSolMsg.ChassieNumber = ScaniaEdiSolMessage.ChassieNumber and EdiSolMsg.ShipFromFinland = ScaniaEdiSolMessage.ShipFromFinland and EdiSolMsg.MessageType = 'IFTMBF') and invalidated = 0 NOTE: There are 2 cases for MessageType, 'IFTMBP' and 'IFTMBF'. So the table to be listed is ScaniaEdiSolMessage. It has attributes like: MessageType: String ChassiNumber: String ShipFromFinland: Boolean Invalidated: Boolean It has also a link to table Parcel named ReceivingOwner with BoldId as key. So it seems like it list all rows of ScaniaEdiSolMessage and then have a subquery that also list all rows of ScaniaEdiSolMessage and name it EdiSolMsg. The it exclude almost all rows. In fact the query above give one hit from 28000 records. In OCL it is easy to list all instances: ScaniaEdiSolMessage.allinstances Also easy to filter rows by select for example: ScaniaEdiSolMessage.allinstances->select(shipFromFinland and not invalidated) But I do not understand how I should make a OCL to match the SQL above.

    Read the article

  • SQL: script to create country, state tables

    - by pcampbell
    Consider writing an application that requires registration for an entity, and the schema has been defined to require the country, state/prov/county data to be normalized. This is fairly typical stuff here. Naming also is important to reflect. Each country has a different name for this entity: USA = states Australia = states + territories Canada = provinces + territories Mexico = states Brazil = states Sweden = provinces UK = counties, principalities, and perhaps more! Most times when approaching this problem, I have to scratch together a list of good countries, and the states/prov/counties of each. The app may be concerned with a few countries and not others. The process is full of pain. It typically involves one of two approaches: opening up some previous DB and creating a CREATE script based on those tables. Run that script in the context of the new system. creating a DTS package from database1 to database2, with all the DDL and data included in the transfer. My goal now is to script the creation and insert of the countries that I'd be concerned with in the app of the day. When I want to roll out Countries X/Y/Z, I'll open CountryX.sql, and load its states into the ProvState table. Question: do you have a set of scripts in your toolset to create schema and data for countries and state/province/county? If so, would you share your scripts here? (U.K. citizens, please feel free to correct me by way of a comment in the use of counties.)

    Read the article

  • is there an equivalent of a trigger for general stored procedure execution on sql server

    - by Arj
    Hi All, Hope you can help. Is there a way to detect when a stored proc is being run on SQL Server without altering the SP itself? Here's the requirement. We need to track users running reports from our enterprise data warehouse as the core product we use doesn't allow for this. Both core product reports and a slew of in-house ones we've added all return their data from individual stored procs. We don't have a practical way of altering the parts of the product webpages where reports are called from. We also can't change the stored procs for the core product reports. (It would be trivial to add a logging line to the start/end of each of our inhouse ones). What I'm trying to find therefore, is whether there's a way in SQL Server (2005 / 2008) to execute a logging stored proc whenever any other stored procedure runs, without altering those stored procedures themselves. We have general control over the SQL Server instance itself as it's local, we just don't want to change the product stored procs themselves. Any one have any ideas? Is there a kind of "stored proc executing trigger"? Is there an event model for SQL Server that we can hook custom .Net code into? (Just to discount it from the start, we want to try and make a change to SQL Server rather than get into capturing the report being run from the products webpages etc) Thoughts appreciated Thanks

    Read the article

  • Any good SQL Anywhere database schema comparison tools?

    - by Lurker Indeed
    Are there any good database schema comparison tools out there that support Sybase SQL Anywhere version 10? I've seen a litany of them for SQL Server, a few for MySQL and Oracle, but nothing that supports SQL Anywhere correctly. I tried using DB Solo, but it turned all my non-unique indexes into unique ones, and I didn't see any options to change that.

    Read the article

  • Converting from SQL Server 2000 to 2005 for ASP.NET web App

    - by Bazza Formez
    Hi there, I'm moving my ASP.NET website to a new provider. Only problem is, old host support my SQL Server 2000 db. New host only supports SQL Server 2005. How should I go about the conversion ? Can I simply produce a backup of the 2000 (.bak) file at the old host, and restore that file into SQL Server 2005 at the new host ? Or is there more to it ?? Note that I don't own a copy of SQL Server 2005 at home... and I'm trying to avoid having to do so. Thanks, Bazza

    Read the article

  • SQL server text

    - by Nick P
    I will be taking an independent study class on SQL server management. I will have to configure SQL Server 2008 on a Windows Server 2008 system. I was wondering if anyone could suggest decent text for configuration/administration of SQL Server 2008. The Murach text doesn't look like it will take me far.

    Read the article

  • Setting Connection Parameters via ADO for SQL Server

    - by taspeotis
    Is it possible to set a connection parameter on a connection to SQL Server and have that variable persist throughout the life of the connection? The parameter must be usable by subsequent queries. We have some old Access reports that use a handful of VBScript functions in the SQL queries (let's call them GetStartDate and GetEndDate) that return global variables. Our application would set these before invoking the query and then the queries can return information between date ranges specified in our application. We are looking at changing to a ReportViewer control running in local mode, but I don't see any convenient way to use these custom functions in straight T-SQL. I have two concept solutions (not tested yet), but I would like to know if there is a better way. Below is some pseudo code. Set all variables before running Recordset.OpenForward Connection->Execute("SET @GetStartDate = ..."); Connection->Execute("SET @GetEndDate = ..."); // Repeat for all parameters Will these variables persist to later calls of Recordset->OpenForward? Can anything reset the variables aside from another SET/SELECT @variable statement? Create an ADOCommand "factory" that automatically adds parameters to each ADOCommand object I will use to execute SQL // Command has been previously been created ADOParameter *Parameter1 = Command->CreateParameter("GetStartDate"); ADOParameter *Parameter2 = Command->CreateParameter("GetEndDate"); // Set values and attach etc... What I would like to know if there is something like: Connection->SetParameter("GetStartDate", "20090101"); Connection->SetParameter("GetEndDate", 20100101"); And these will persist for the lifetime of the connection, and the SQL can do something like @GetStartDate to access them. This may be exactly solution #1, if the variables persist throughout the lifetime of the connection.

    Read the article

  • how to detect sql server timeout from .NET application without using catch Exception

    - by haditeo
    Hi, In my current application, i am performing an update by invoking T-SQL Update command. The problem is when the same record is locked by other users at that time. At .NET application, the application will wait until SQL Server timeout, then it will throw the SqlException timeout. Is it possible to perform a check first whether a particular record is locked by other process rather than catching the exception ? Thanks, hadi teo Update : The SQL Server version used are 2000 and 2008

    Read the article

  • Sql Server copying table information between databases

    - by Andrew
    Hi, I have a script that I am using to copy data from a table in one database to a table in another database on the same Sql Server instance. The script works great when I am connected to the Sql Server instance as myself as I have dbo access to both databases. The problem is that this won't be the case on the client's Sql Server. They have seperate logins for each database (Sql Authentication Logins). Does anyone know if there is a way to run a script under these circumstances. The script would be doing something like. use sourceDB Insert targetDB.dbo.tblTest (id, test_name) Select id, test_name from dbo.tblTest Thanks

    Read the article

  • C# DateTime Class and Datetime in database

    - by Spyros
    Hello . I have the following problem. I have an object with some DateTime properties , and a Table in database that I store all that objects , in Sql server I want to store the DateTime properties in some columns of DateTime Datatype, but the format of datetime in sql server is different from the DateTime class in c# and I got an sql exception saying "DateTime cannot be parsed". I know how to solve this by making the format yyyy-MM-dd but is this the proper and best solution to do this?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • whats wrong in this LINQ synatx?

    - by Saurabh Kumar
    Hi, I am trying to convert a SQL query to LINQ. Somehow my count(distinct(x)) logic does not seem to be working correctly. The original SQL is quite efficient(or so i think), but the generated SQL is not even returning the correct result. I am trying to fix this LINQ to do what the original SQL is doing, AND in an efficient way as the original query is doing. Help here would be really apreciated as I am stuck here :( SQL which is working and I need to make a comparable LINQ of: SELECT [t1].[PersonID] AS [personid] FROM [dbo].[Code] AS [t0] INNER JOIN [dbo].[phonenumbers] AS [t1] ON [t1].[PhoneCode] = [t0].[Code] INNER JOIN [dbo].[person] ON [t1].[PersonID]= [dbo].[Person].PersonID WHERE ([t0].[codetype] = 'phone') AND ( ([t0].[CodeDescription] = 'Home') AND ([t1].[PhoneNum] = '111') OR ([t0].[CodeDescription] = 'Work') AND ([t1].[PhoneNum] = '222') ) GROUP BY [t1].[PersonID] HAVING COUNT(DISTINCT([t1].[PhoneNum]))=2 The LINQ which I made is approximately as below: var ids = context.Code.Where(predicate); var rs = from r in ids group r by new { r.phonenumbers.person.PersonID} into g let matchcount=g.Select(p => p.phonenumbers.PhoneNum).Distinct().Count() where matchcount ==2 select new { personid = g.Key }; Unfortunately, the above LINQ is NOT generating the correct result, and is actually internally getting generated to the SQL shown below. By the way, this generated query is also reading ALL the rows(about 19592040) around 2 times due to the COUNTS :( Wich is a big performance issue too. Please help/point me to the right direction. Declare @p0 VarChar(10)='phone' Declare @p1 VarChar(10)='Home' Declare @p2 VarChar(10)='111' Declare @p3 VarChar(10)='Work' Declare @p4 VarChar(10)='222' Declare @p5 VarChar(10)='2' SELECT [t9].[PersonID], ( SELECT COUNT(*) FROM ( SELECT DISTINCT [t13].[PhoneNum] FROM [dbo].[Code] AS [t10] INNER JOIN [dbo].[phonenumbers] AS [t11] ON [t11].[PhoneType] = [t10].[Code] INNER JOIN [dbo].[Person] AS [t12] ON [t12].[PersonID] = [t11].[PersonID] INNER JOIN [dbo].[phonenumbers] AS [t13] ON [t13].[PhoneType] = [t10].[Code] WHERE ([t9].[PersonID] = [t12].[PersonID]) AND ([t10].[codetype] = @p0) AND ((([t10].[codetype] = @p1) AND ([t11].[PhoneNum] = @p2)) OR (([t10].[codetype] = @p3) AND ([t11].[PhoneNum] = @p4))) ) AS [t14] ) AS [cnt] FROM ( SELECT [t3].[PersonID], ( SELECT COUNT(*) FROM ( SELECT DISTINCT [t7].[PhoneNum] FROM [dbo].[Code] AS [t4] INNER JOIN [dbo].[phonenumbers] AS [t5] ON [t5].[PhoneType] = [t4].[Code] INNER JOIN [dbo].[Person] AS [t6] ON [t6].[PersonID] = [t5].[PersonID] INNER JOIN [dbo].[phonenumbers] AS [t7] ON [t7].[PhoneType] = [t4].[Code] WHERE ([t3].[PersonID] = [t6].[PersonID]) AND ([t4].[codetype] = @p0) AND ((([t4].[codetype] = @p1) AND ([t5].[PhoneNum] = @p2)) OR (([t4].[codetype] = @p3) AND ([t5].[PhoneNum] = @p4))) ) AS [t8] ) AS [value] FROM ( SELECT [t2].[PersonID] FROM [dbo].[Code] AS [t0] INNER JOIN [dbo].[phonenumbers] AS [t1] ON [t1].[PhoneType] = [t0].[Code] INNER JOIN [dbo].[Person] AS [t2] ON [t2].[PersonID] = [t1].[PersonID] WHERE ([t0].[codetype] = @p0) AND ((([t0].[codetype] = @p1) AND ([t1].[PhoneNum] = @p2)) OR (([t0].[codetype] = @p3) AND ([t1].[PhoneNum] = @p4))) GROUP BY [t2].[PersonID] ) AS [t3] ) AS [t9] WHERE [t9].[value] = @p5 Thanks!

    Read the article

  • hibernate show real sql

    - by tommaso
    Hi all, if I set <property name="show_sql">true</property> in my hibernate.cfg.xml configuration file in the console I can see the sql. But it's not REAL sql... Can I see the SQL code that will be passed directly to database? Example: I see select this_.code from true.employee this_ where this_.code=? Can I see select employee.code from employee where employee.code=12 the real sql? thanks!

    Read the article

  • What permissions needed to connect to SQL Server Integration Services

    - by rwmnau
    I need to allow a consultant to connect to SSIS on a SQL Server 2008 box without making him a local administrator. If I add him to the local administrators group, he can connect to SSIS just fine, but it seems that I can't grant him enough permissions through SQL Server to give him these rights without being a local admin. I've added him to every role on the server, every database role in MSDB shy of DBO, and he's still not able to connect. I don't see any SSIS-related Windows groups on the server - Is membership in the Local Administrators group really required to connect to the SSIS instance on a SQL Server? It seems like there is somewhere I should be able to grant "SSIS Admin" rights to a user (even if it's a Windows account and not a SQL account), but I can't find that place. UPDATE: I've found an MSDN article (See the section titled "Eliminating the 'Access if Denied' Error") that describes how to resolve problem, but even after following the stepsI'm still not able to connect. Just wanted to add it to the discussion

    Read the article

  • SQL Server catch error from extended stored procedure

    - by haxelit
    Hello I have an extended stored procedure that sends an error message. srv_sendmsg(pSrvProc, SRV_MSG_ERROR, errorNum, SRV_FATAL_SERVER, 1, NULL, 0, (DBUSMALLINT) __LINE__, buff, SRV_NULLTERM); I've set the severity to SVR_FATAL_SERVER just as a test to see if I can cause the message to throw an exception in the sql. In my SQL i'm doing: BEGIN TRY EXEC dbo.xp_somethingCool SET @Error = @@ERROR END TRY BEGIN CATCH PRINT 'AN Error occoured!' SELECT ERROR_NUMBER() AS ErrorNumber ,ERROR_MESSAGE() AS ErrorMessage; END CATCH I would think that when my xp sends the error message the tsql would catch the error and select the error_number and error_message. Instead what ends up happening is that the xp sends the message and the T-SQL continues on its way like nothing happened. The @@Error variable doesn't get set either. So I was wondering if there was any trick to getting SQL to catch an error from an XP ? Thanks, Raul

    Read the article

  • SQL Server query replace for MySQL Instruction

    - by pojomx
    Hi, I'm new to SQL Server, and used mysql for a while now... SELECT A.acol, IF(A.acol<0,"Neg","Pos") as Column2 From Table I want to do something like that on SQL Server, but there doesn't exist the IF instruction. How do I replace that if, in a SQL Server 2008 Query?

    Read the article

  • locked stored procedures in sql

    - by Greg
    Hi, I am not too familiar with sql server 2005. I have a schema in sql which has stored procedures with small lock on them. As I understand they were created using C#, all these locked procedures have a source file in C# with the code of the procedures. The thing is I can't access them. I need to modify one of these procedures but it doesn't let me modify them. I have the source code (from visual studio) with these procedures but when I change something in the code, it doesn't affect the procedures in the sql. How can I change the path to assembly in sql server 2005 or is there any other way I can access these stored procedures? Thanks in advance, Greg

    Read the article

  • Opaque tenant identification with SQL Server & NHibernate

    - by Anton Gogolev
    Howdy! We're developing a nowadays-fashionable multi-tenanted SaaS app (shared database, shared schema), and there's one thing I don't like about it: public class Domain : BusinessObject { public virtual long TenantID { get; set; } public virtual string Name { get; set; } } The TenantID is driving me nuts, as it has to be accounted for almost everywhere, and it's a hassle from security standpoint: what happens if a malicious API user changes TenantID to some other value and will mix things up. What I want to do is to get rid of this TenantID in our domain objects altogether, and to have either NHibernate or SQL Server deal with it. From what I've already read on the Internets, this can be done with CONTEXT_INFO (here's a NHibernatebased implementation), NHibernate filters, SQL Views and with combination thereof. Now, my requirements are as follows: Remove any mentions of TenantID from domain objects ...but have SQL Server insert it where appropriate (I guess this is achieved with default constraints) ...and obviously provide support for filtering based on this criteria, so that customers will never see each other's data If possible, avoid SQL Server views. Have a solution which plays nicely with NHibernate, SQL Servers' MARS and general nature of SaaS apps being highly concurrent What are your thoughts on that?

    Read the article

  • Extracting shell script from parameterised Hudson job

    - by Jonik
    I have a parameterised Hudson job, used for some AWS deployment stuff, which in one build step runs certain shell commands. However, that script has become sufficiently complicated that I want to "extract" it from Hudson to a separate script file, so that it can easily be versioned properly. The Hudson job would then simply update from VCS and execute the external script file. My main question is about passing parameters to the script. I have a Hudson parameter named AMI_ID and a few others. The script references those params as if they were environment variables: echo "Using AMI $AMI_ID and type $TYPE" Now, this works fine inside Hudson, but not if Hudson calls an external script. Could I somehow make Hudson set the params as environment variables so that I don't need to change the script? Or is my best option to alter the script to take command line parameters (and possibly assign those to named variables for readability: ami_id=$1; type=$2; ... )? I tried something like this but the script doesn't get correctly replaced values: export AMI_ID=$AMI_ID export TYPE=$TYPE external-script.sh # this tries to use e.g. $AMI_ID Bonus question: when the script is inside Hudson, the "console output" will contain both the executed commands and their output. This is extremely useful for debugging when something goes wrong with a build! For example, here the line starting with "+" is part of the script and the following line its output: + ec2-associate-address -K pk.pem -C cert.pem 77.125.116.139 -i i-aa3487fd ADDRESS 77.125.116.139 i-aa3487fd When calling an external script, Hudson output will only contain the latter line, making debugging harder. I could cat the script file to stdout before running it, but that's not optimal either. In effect, I'd like a kind of DOS-style "echo on" for the script which I'm calling from Hudson - anyone know a trick to achieve this?

    Read the article

< Previous Page | 217 218 219 220 221 222 223 224 225 226 227 228  | Next Page >