Search Results

Search found 17554 results on 703 pages for 'runtime exception'.

Page 222/703 | < Previous Page | 218 219 220 221 222 223 224 225 226 227 228 229  | Next Page >

  • Opening a Silverlight project causes APPCRASH is Visual Studio 2008

    - by Ed Woodcock
    Hi guys I've got to add a Silverlight project to a solution for a deployment procedure (it's a pre-build dependency for the main project). I've installed Silverlight tools v3, silverlight itself and the silverlight sdk 3, and am using Visual Studio 2008 with ReSharper and the DevArt oracle database tools. Every time I go to open the relevant silverlight .csproj file VS crashes with the following error message: Problem Event Name: APPCRASH Application Name: devenv.exe Application Version: 9.0.30729.1 Application Timestamp: 488f2b50 Fault Module Name: StackHash_20af Fault Module Version: 6.0.6001.18000 Fault Module Timestamp: 4791a7a6 Exception Code: c0000374 Exception Offset: 000b015d This also happens if I try to create a new silverlight project from scratch. Does anyone have any suggestions?

    Read the article

  • help me "dry" out this .net XML serialization code

    - by Sarah Vessels
    I have a base collection class and a child collection class, each of which are serializable. In a test, I discovered that simply having the child class's ReadXml method call base.ReadXml resulted in an InvalidCastException later on. First, here's the class structure: Base Class // Collection of Row objects [Serializable] [XmlRoot("Rows")] public class Rows : IList<Row>, ICollection<Row>, IEnumerable<Row>, IEquatable<Rows>, IXmlSerializable { public Collection<Row> Collection { get; protected set; } public void ReadXml(XmlReader reader) { reader.ReadToFollowing(XmlNodeName); do { using (XmlReader rowReader = reader.ReadSubtree()) { var row = new Row(); row.ReadXml(rowReader); Collection.Add(row); } } while (reader.ReadToNextSibling(XmlNodeName)); } } Derived Class // Acts as a collection of SpecificRow objects, which inherit from Row. Uses the same // Collection<Row> that Rows defines which is fine since SpecificRow : Row. [Serializable] [XmlRoot("MySpecificRowList")] public class SpecificRows : Rows, IXmlSerializable { public new void ReadXml(XmlReader reader) { // Trying to just do base.ReadXml(reader) causes a cast exception later reader.ReadToFollowing(XmlNodeName); do { using (XmlReader rowReader = reader.ReadSubtree()) { var row = new SpecificRow(); row.ReadXml(rowReader); Collection.Add(row); } } while (reader.ReadToNextSibling(XmlNodeName)); } public new Row this[int index] { // The cast in this getter is what causes InvalidCastException if I try // to call base.ReadXml from this class's ReadXml get { return (Row)Collection[index]; } set { Collection[index] = value; } } } And here's the code that causes a runtime InvalidCastException if I do not use the version of ReadXml shown in SpecificRows above (i.e., I get the exception if I just call base.ReadXml from within SpecificRows.ReadXml): TextReader reader = new StringReader(serializedResultStr); SpecificRows deserializedResults = (SpecificRows)xs.Deserialize(reader); SpecificRow = deserializedResults[0]; // this throws InvalidCastException So, the code above all compiles and runs exception-free, but it bugs me that Rows.ReadXml and SpecificRows.ReadXml are essentially the same code. The value of XmlNodeName and the new Row()/new SpecificRow() are the differences. How would you suggest I extract out all the common functionality of both versions of ReadXml? Would it be silly to create some generic class just for one method? Sorry for the lengthy code samples, I just wanted to provide the reason I can't simply call base.ReadXml from within SpecificRows.

    Read the article

  • jQuery effect on iframe parent document

    - by Jabes88
    Just wondering if anyone else has experienced this or knows why I am getting an error. I'm using javascript from within an iframe to call a parent dom element then use jQuery UI's effect core to shake it. Here is an example: $(document).ready(function(){ if ($("form").length>0) { $("form").submit(function(){ var oParentDoc = $(parent.document).find("div#element"); var action = $(this).attr("action"); var postdata = $(this).serialize(); $(oParentDoc).addClass("loading"); $.post(action,postdata,function(data){ $(oParentDoc).removeClass("loading").effect("shake",{"times":3,"distance":10},60); }); return false; }); } }); It works without the effect, but when I use an effect it gives me this error: uncaught exception: [Exception... "Component returned failure code: 0x80040111 (NS_ERROR_NOT_AVAILABLE) [nsIDOMCSSStyleDeclaration.getPropertyValue]" nsresult: "0x80040111 (NS_ERROR_NOT_AVAILABLE)" Thanks in advance for any insight :)

    Read the article

  • How to get the place name by latitude and longitude using openstreetmap in android

    - by Gaurav kumar
    In my app i am using osm rather than google map.I have latitude and longitude.So from here how i will query to get the city name from osm database..please help me. final String requestString = "http://nominatim.openstreetmap.org/reverse?format=json&lat=" + Double.toString(lat) + "&lon=" + Double.toString(lon) + "&zoom=18&addressdetails=1"; RequestBuilder builder = new RequestBuilder(RequestBuilder.GET, URL.encode(requestString)); try { @SuppressWarnings("unused") Request request = builder.sendRequest(null, new RequestCallback() { @Override public void onResponseReceived(Request request, Response response) { if (response.getStatusCode() == 200) { String city = ""; try { JSONValue json = JSONParser.parseStrict(response); JSONObject address = json.isObject().get("address").isObject(); final String quotes = "^\"|\"$"; if (address.get("city") != null) { city = address.get("city").toString().replaceAll(quotes, ""); } else if (address.get("village") != null) { city = address.get("village").toString().replaceAll(quotes, ""); } } catch (Exception e) { } } } }); } catch (Exception e1) { }

    Read the article

  • show definition (browse) in *.pdb of *.dll file

    - by ala
    I have built a Library project (DLL) in .NET. And sometimes I use the DLL along with its PDB file as a reference in some other projects. Now in the new project, I cant browse through the code of the DLL to debug. I can only see the definitions of class/methods/variables. That's by using "show definition" by browsing through the "class view" However, only in case of an exception I the contents of the DLL opens and I could see the entire code of the DLL from the new project. How could I see the contents (code) of the DLL before an exception occur?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Issues with LINQ (to Entity) [adding records]

    - by Mario
    I am using LINQ to Entity in a project, where I pull a bunch of data (from the database) and organize it into a bunch of objects and save those to the database. I have not had problems writing to the db before using LINQ to Entity, but I have run into a snag with this particular one. Here's the error I get (this is the "InnerException", the exception itself is useless!): New transaction is not allowed because there are other threads running in the session. I have seen that before, when I was trying to save my changes inside a loop. In this case, the loop finishes, and it tries to make that call, only to give me the exception. Here's the current code: try { //finalResult is a list of the keys to match on for the records being pulled foreach (int i in finalResult) { var queryEff = (from eff in dbMRI.MemberEligibility where eff.Member_Key == i && eff.EffDate >= DateTime.Now select eff.EffDate).Min(); if (queryEff != null) { //Add a record to the Process table Process prRecord = new Process(); prRecord.GroupData = qa; prRecord.Member_Key = i; prRecord.ProcessDate = DateTime.Now; prRecord.RecordType = "F"; prRecord.UsernameMarkedBy = "Autocard"; prRecord.GroupsId = qa.GroupsID; prRecord.Quantity = 2; prRecord.EffectiveDate = queryEff; dbMRI.AddObject("Process", prRecord); } } dbMRI.SaveChanges(); //<-- Crashes here foreach (int i in finalResult) { var queryProc = from pro in dbMRI.Process where pro.Member_Key == i && pro.UsernameMarkedBy == "Autocard" select pro; foreach (var qp in queryProc) { Audit aud = new Audit(); aud.Member_Key = i; aud.ProcessId = qp.ProcessId; aud.MarkDate = DateTime.Now; aud.MarkedByUsername = "Autocard"; aud.GroupData = qa; dbMRI.AddObject("Audit", aud); } } dbMRI.SaveChanges(); //<-- AND here (if the first one is commented out) } catch (Exception e) { //Do Something here } Basically, I need it to insert a record, get the identity for that inserted record and insert a record into another table with the identity from the first record. Given some other constraints, it is not possible to create a FK relationship between the two (I've tried, but some other parts of the app won't allow it, AND my DBA team for whatever reason hates FK's, but that's for a different topic :)) Any ideas what might be causing this? Thank!

    Read the article

  • CouchDB Map/Reduce raises execption in reduce function?

    - by fuzzy lollipop
    my view generates keys in this format ["job_id:1234567890", 1271430291000] where the first key element is a unique key and the second is a timestamp in milliseconds. I run my view with this elapsed_time?startkey=["123"]&endkey=["123",{}]&group=true&group_level=1 and here is my reduce function, the intention is to reduce the output to get the earliest and latest timestamps and return the difference between them and now function(keys,values,rereduce) { var now = new Date().valueOf(); var first = Number.MIN_VALUE; var last = Number.MAX_VALUE; if (rereduce) { first = Math.max(first,values[0].first); last = Math.min(last,values[0].last); } else { first = keys[0][0][1]; last = keys[keys.length-1][0][1]; } return {first:now - first, last:now - last}; } and when processing a query it constantly raises the following execption: function raised exception (new TypeError("keys has no properties", "", 1)) I am making sure not to reference keys inside my rereduce block. Why does this function constantly raise this exception?

    Read the article

  • Why do I get a nullpointerexception at line ds.getPort in class L1?

    - by Fred
    import java.awt.; import java.awt.event.; import javax.swing.; import java.io.; import java.net.; import java.util.; public class Draw extends JFrame { /* * Socket stuff */ static String host; static int port; static int localport; DatagramSocket ds; Socket socket; Draw d; Paper p = new Paper(ds); public Draw(int localport, String host, int port) { d = this; this.localport = localport; this.host = host; this.port = port; try { ds = new DatagramSocket(localport); InetAddress ia = InetAddress.getByName(host); System.out.println("Attempting to connect DatagramSocket. Local port " + localport + " , foreign host " + host + ", foreign port " + port + "..."); ds.connect(ia, port); System.out.println("Success, ds.localport: " + ds.getLocalPort() + ", ds.port: " + ds.getPort() + ", address: " + ds.getInetAddress()); Reciever r = new Reciever(ds); r.start(); } catch (Exception e) { e.printStackTrace(); } setDefaultCloseOperation(EXIT_ON_CLOSE); getContentPane().add(p, BorderLayout.CENTER); setSize(640, 480); setVisible(true); } public static void main(String[] args) { int x = 0; for (String s : args){ if (x==0){ localport = Integer.parseInt(s); x++; } else if (x==1){ host = s; x++; } else if (x==2){ port = Integer.parseInt(s); } } Draw d = new Draw(localport, host, port); } } class Paper extends JPanel { DatagramSocket ds; private HashSet hs = new HashSet(); public Paper(DatagramSocket ds) { this.ds=ds; setBackground(Color.white); addMouseListener(new L1(ds)); addMouseMotionListener(new L2()); } public void paintComponent(Graphics g) { super.paintComponent(g); g.setColor(Color.black); Iterator i = hs.iterator(); while(i.hasNext()) { Point p = (Point)i.next(); g.fillOval(p.x, p.y, 2, 2); } } private void addPoint(Point p) { hs.add(p); repaint(); } class L1 extends MouseAdapter { DatagramSocket ds; public L1(DatagramSocket ds){ this.ds=ds; } public void mousePressed(MouseEvent me) { addPoint(me.getPoint()); Point p = me.getPoint(); String message = Integer.toString(p.x) + " " + Integer.toString(p.y); System.out.println(message); try{ byte[] data = message.getBytes("UTF-8"); //InetAddress ia = InetAddress.getByName(ds.host); String convertedMessage = new String(data, "UTF-8"); System.out.println("The converted string is " + convertedMessage); DatagramPacket dp = new DatagramPacket(data, data.length); System.out.println(ds.getPort()); //System.out.println(message); //System.out.println(ds.toString()); //ds.send(dp); /*System.out.println("2Sending a packet containing data: " +data +" to " + ia + ":" + d.port + "...");*/ } catch (Exception e){ e.printStackTrace(); } } } class L2 extends MouseMotionAdapter { public void mouseDragged(MouseEvent me) { addPoint(me.getPoint()); Point p = me.getPoint(); String message = Integer.toString(p.x) + " " + Integer.toString(p.y); //System.out.println(message); } } } class Reciever extends Thread{ DatagramSocket ds; byte[] buffer; Reciever(DatagramSocket ds){ this.ds = ds; buffer = new byte[65507]; } public void run(){ try { DatagramPacket packet = new DatagramPacket(buffer, buffer.length); while(true){ try { ds.receive(packet); String s = new String(packet.getData()); System.out.println(s); } catch (Exception e) { e.printStackTrace(); } } } catch (Exception e) { e.printStackTrace(); } } }

    Read the article

  • How to add ACTIVE DOMAIN user to Sharepoint group

    - by standley-nguyen
    Hi all. I got an exception when executing this snippet code SPSecurity.RunWithElevatedPrivileges(delegate() { using (SPSite site = new SPSite(siteUrl.Trim())) { using (SPWeb web = site.OpenWeb()) { try { web.AllowUnsafeUpdates = true; SPUser spUser = web.AllUsers[userName]; if (spUser != null) { SPGroup spGroup = web.Groups[groupName]; if (spGroup != null) spGroup.AddUser(spUser); } } catch (Exception ex) { this.TraceData(LogLevel.Error, "Error at function Named [AddUserToSPGroupWidget.AddUserToGroup] . With Error Message: " + ex.ToString()); } finally { web.AllowUnsafeUpdates = false; } } } }); PLease guide me. Thanks in advance.

    Read the article

  • Resizing uploaded files in django using PIL

    - by Nikunj
    I am using PIL to resize an uploaded file using this method: def resize_uploaded_image(buf): imagefile = StringIO.StringIO(buf.read()) imageImage = Image.open(imagefile) (width, height) = imageImage.size (width, height) = scale_dimensions(width, height, longest_side=240) resizedImage = imageImage.resize((width, height)) return resizedImage I then use this method to get the resizedImage in my main view method: image = request.FILES['avatar'] resizedImage = resize_uploaded_image(image) content = django.core.files.File(resizedImage) acc = Account.objects.get(account=request.user) acc.avatar.save(image.name, content) However, this gives me the 'read' error. Trace: Exception Type: AttributeError at /myapp/editAvatar Exception Value: read Any idea how to fix this? I have been at it for hours! Thanks! Nikunj

    Read the article

  • Handling exceptions raised in observers

    - by sparky
    I have a Rails (2.3.5) application where there are many groups, and each Group has_many People. I have a Group edit form where users can create new people. When a new person is created, they are sent an email (the email address is user entered on the form). This is accomplished with an observer on the Person model. The problem comes when ActionMailer throws an exception - for example if the domain does not exist. Clearly that cannot be weeded out with a validation. There would seem to be 2 ways to deal with this: A begin...rescue...end block in the observer around the mailer. The problem with this is that the only way to pass any feedback to the user would be to set a global variable - as the observer is out of the MVC flow, I can't even set a flash[:error] there. A rescue_from in the Groups controller. This works fine, but has 2 problems. Firstly, there is no way to know which person threw the exception (all I can get is the 503 exception, no way to know which person caused the problem). This would be useful information to be able to pass back to the user - at the moment, there is no way for me to let them know which email address is the problem - at the moment, I just have to chuck the lot back at them, and issue an unhelpful message saying that one of them is not correct. Secondly (and to a certain extent this make the first point moot) it seems that it is necessary to call a render in the rescue_from, or it dies with a rather bizarre "can't convert Array into String" error from webbrick, with no stack trace & nothing in the log. Thus, I have to throw it back to the user when I come across the first error and have to stop processing the rest of the emails. Neither of the solutions are optimal. It would seem that the only way to get Rails to do what I want is option 1, and loathsome global variables. This would also rely on Rails being single threaded. Can anyone suggest a better solution to this problem?

    Read the article

  • Out-of-the-box Eclipse PDT (PHP Development Tool) not capable of debugging PHP, why?

    - by Alex R
    I just finished reinstalling the "All-In-One Eclipse PDT" from zend.com. It's unable to debug even the simplest "Hello World" PHP script. How can such a major open-source app be released in such a bad shape? What am I doing wrong? This is the result of doing a "Debug As...": Problem signature: Problem Event Name: APPCRASH Application Name: php.exe Application Version: 5.2.9.9 Application Timestamp: 49dda267 Fault Module Name: ntdll.dll Fault Module Version: 6.0.6002.18005 Fault Module Timestamp: 49e03824 Exception Code: c0000130 Exception Offset: 0006f04e OS Version: 6.0.6002.2.2.0.768.3 Locale ID: 1033 Additional Information 1: 9d13 Additional Information 2: 1abee00edb3fc1158f9ad6f44f0f6be8 Additional Information 3: 9d13 Additional Information 4: 1abee00edb3fc1158f9ad6f44f0f6be8 Read our privacy statement: http://go.microsoft.com/fwlink/?linkid=50163&clcid=0x0409 I think it wants me to configure some additional stuff, but I have no clue what exactly to do.

    Read the article

  • Can't add domain users to Reporting Services 2008

    - by Jeremy
    I have SSRS 2008 setup on the database server. The server is part of the domain. Reporting Services is running under NetworkService. When I try to add a domain user using the web interface (Site Settings -- Security -- New Role Assignment), the page posts back but the user is not in the list. The server's log file contains the following Unhandled Exception: ui!ReportManager_0-1!954!01/12/2009-10:14:52:: Unhandled exception: System.Security.Principal.IdentityNotMappedException: Some or all identity references could not be translated. at System.Security.Principal.SecurityIdentifier.Translate(IdentityReferenceCollection sourceSids, Type targetType, Boolean forceSuccess) at System.Security.Principal.SecurityIdentifier.Translate(Type targetType) at System.Security.Principal.WindowsIdentity.GetName() at System.Security.Principal.WindowsIdentity.get_Name() at ReportingServicesHttpRuntime.RsWorkerRequest.GetServerVariable(String name) at System.Web.Security.WindowsAuthenticationModule.OnEnter(Object source, EventArgs eventArgs) at System.Web.HttpApplication.SyncEventExecutionStep.System.Web.HttpApplication.IExecutionStep.Execute() at System.Web.HttpApplication.ExecuteStep(IExecutionStep step, Boolean& completedSynchronously) Any one have an idea on how to fix this?

    Read the article

  • input file cannot be found

    - by Eric Smith
    I am just messing around with reading input files with java until I got stumped at the most basic of steps... finding the input file! The input.txt file is in the same directory as my class file that is calling it yet eclipse still gives me an error that it cant be found: "Exception in thread "main" java.lang.Error: Unresolved compilation problem: Unhandled exception type FileNotFoundException" My code: package pa; import java.util.Scanner; public class Project { public static void main(String[] args) { java.io.File file = new java.io.File("input.txt"); System.out.println(file.getAbsolutePath()); Scanner input = new Scanner(file); } } input.txt is in the same package, same folder and everything. I'm confused :(

    Read the article

  • Adding/removing session variables on Page OnInit/OnLoad in C#

    - by MKS
    Hi Guys, I am using C#. I am having below code in C#: protected override void OnInit(EventArgs e) { try { if (Session["boolSignOn"].ToString() == "true".ToString()) { lblPanelOpen.Text = Session["panelOpen"].ToString(); } else { lblPanelOpen.Text = Session["panelOpen"].ToString(); } } catch (Exception ex) { Logger.Error("Error processing request:" + ex.Message); } } protected override void OnLoad(EventArgs e) { try { if (!string.IsNullOrEmpty(Session["panelOpen"].ToString())) { lblPanelOpen.Text = string.Empty; Session.Remove("panelOpen"); } } catch (Exception ex) { Logger.Error("Unable to remove the session variable:" + ex.Message); } } In above code I am having a Session["panelOpen"] variable which is created from another user control and once my page is trying to render, I am storing Session["panelOpen"] in my hidden lblPanelOpen.Text on page OnInit() method, however when page is loaded completely then I am trying to remove the session variable. Please suggest!

    Read the article

  • Loading embedded resource on Windows 7

    - by Flack
    Hello, I have an app that works just fine on my WinXP machine. However, when I try running it on my Win7 machine, it fails whenever it tries to load an embedded resource. The resources are all there (I can see them using Reflector). The lines that fail are all of the form: Splash.Image = new Bitmap(typeof(ContainerForm).Assembly.GetManifestResourceStream("SplashTest.Resources.Logo.gif")); And they all fail with the same exception: Exception='System.ArgumentException: Parameter is not valid. at System.Drawing.Bitmap..ctor(Stream stream) I don't understand why this is not working on my Win7 machine but does on my usual WinXP dev machine. Any ideas?

    Read the article

  • System.MissingMemberException was unhandled by user code

    - by AmRoSH
    I'm using this code: Dim VehiclesTable1 = dsVehicleList.Tables(0) Dim VT1 = (From d In VehiclesTable1.AsEnumerable _ Select VehicleTypeName = d.Item("VehicleTypeName") _ , VTypeID = d.Item("VTypeID") _ , ImageURL = d.Item("ImageURL") _ , DailyRate = d.Item("DailyRate") _ , RateID = d.Item("RateID")).Distinct its linq to dataset and I Take Data on THis Rotator: <telerik:RadRotator ID="RadRotatorVehicleType" runat="server" Width="620px" Height="145" ItemWidth="155" ItemHeight="145" ScrollDirection="Left" FrameDuration="1" RotatorType="Buttons"> <ItemTemplate> <div style="text-align: center; cursor: pointer; width: 150px"> <asp:Image ID="ImageVehicleType" runat="server" Width="150" ImageUrl='<%# Container.DataItem("ImageURL") %>' /> <asp:Label ID="lblVehicleType" runat="server" Text='<%# Container.DataItem("VehicleTypeName") %>' Font-Bold="true"></asp:Label> <br /> <asp:Label ID="lblDailyRate" runat="server" Text='<%# Container.DataItem("DailyRate") %>' Visible="False"></asp:Label> <input id="HiddenVehicleTypeID" type="hidden" value='<%# Container.DataItem("VTypeID") %>' name="HiddenVehicleTypeID" runat="server" /> <input id="HiddenRateID" type="hidden" value='<%# Container.DataItem("RateID") %>' name="HiddenRateID" runat="server" /> </div> </ItemTemplate> <ControlButtons LeftButtonID="img_left" RightButtonID="img_right" /> </telerik:RadRotator> and I got this Exception: No default member found for type 'VB$AnonymousType_0(Of Object,Object,Object,Object,Object)'. Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.MissingMemberException: No default member found for type 'VB$AnonymousType_0(Of Object,Object,Object,Object,Object)'. I don't know whats up ? Any help please. Thanks for who tried to solve this but I got solution: using '<%# DataBinder.Eval(Container.DataItem,"ImageURL") %>' instead of '<%# Container.DataItem("RateID") %>' Thanks,

    Read the article

  • unique_ptr boost equivalent?

    - by wowus
    Is there some equivalent class for C++1x's std::unique_ptr in the boost libraries? The behavior I'm looking for is being able to have an exception-safe factory function, like so... std::unique_ptr<Base> create_base() { return std::unique_ptr<Base>(new Derived); } void some_other_function() { std::unique_ptr<Base> b = create_base(); // Do some stuff with b that may or may not throw an exception... // Now b is destructed automagically. }

    Read the article

  • How to translate,use JSON in GWT?

    - by graybow
    I'm new in gwt. and need to know how to use JSON in gwt so i try this simple data loader but i'm still confuse. I create a project named 'tesdb3' in eclipse. I create the PHP side to access the database, and made the output as JSON.. I create the userdata.php in folder war. then I compile tesdb3 project. Folder tesdb3 and the userdata.php in war moved in local server(I use WAMP). I put the PHP in folder tesdb3. This is the result from my localhost/phpmyadmin/tesdb3/userdata.php [{"kode":"002","nama":"bambang gentolet"}{"kode":"012","nama":"Algiz"}] From that result I think the PHP side was working good.Then I create UserData.java as JSNI overlay like this: package com.tesdb3.client; import com.google.gwt.core.client.JavaScriptObject; class UserData extends JavaScriptObject{ protected UserData() {} public final native String getKode() /*-{ return this.kode; }-*/; public final native String getNama() /*-{ return this.nama; }-*/; public final String getFullData() { return getKode() + ":" + getNama(); } } Then Finally in the tesdb3.java: public class Tesdb3 implements EntryPoint { String url= "http://localhost/phpmyadmin/tesdb3/datauser.php"; private native JsArray<UserData> getuserdata(String Json) /*-{ return eval(json); }-*/; public void LoadData() throws RequestException{ RequestBuilder builder = new RequestBuilder(RequestBuilder.POST, URL.encode(url)); builder.sendRequest(null, new RequestCallback(){ @Override public void onError(Request request, Throwable exception) { Window.alert("error " + exception); } public void onResponseReceived(Request request, Response response) { getuserdata(response.getText()); //this is how i use the userdata json(is this already translated?) UserData UD = null; String LKode =UD.getKode(); String LName =UD.getNama(); Label L = new Label(LKode+""+LName); RootPanel.get().add(L); } }); } public void onModuleLoad() { try { LoadData(); } catch (RequestException e) { e.printStackTrace(); } } } The result is blank(i use development mode). and there was an eror like this:(I show it just some part) 10:46:29.984 [ERROR] [tesdb3] Uncaught exception escaped com.google.gwt.core.client.JavaScriptException: (ReferenceError): json is not defined fileName: http://localhost:1092 lineNumber: 2 stack: ("")@http://localhost:1092:2 My question is: How I use the translated Json in right way?? Is there any wrong use from my code? Is that necessary to move the compiled project to local server folder?(i do it following a tutorial from google). Sorry too many ask. but i'm really really confused.

    Read the article

  • How to handle sharepoint web services exceptions

    - by Royson
    Hi, I have developed an application of share point. I am using web services for that. the problem is that while working with my app sometimes i get some exceptions. like, Exception of type 'Microsoft.SharePoint.SoapServer.SoapServerException' was thrown. Stack Strace :: at System.Web.Services.Protocols.SoapHttpClientProtocol.ReadResponse(SoapClientMessage message, WebResponse response, Stream responseStream, Boolean asyncCall) at System.Web.Services.Protocols.SoapHttpClientProtocol.Invoke(String methodName, Object[] parameters) at ......... my methods From this exception i cannot understand the main problem. While developing i can debug the code, but now my application is getting launched..i can get error log file from my client which contains this type of excetions. But how to catch exact error.??? Thanks.

    Read the article

  • Is there anything wrong with my Factory class?

    - by Alex
    class PieceFactory { @SuppressWarnings("rawtypes") public Piece createPiece(String pieceType) throws Throwable{ Class pieceClass = Class.forName(pieceType); Piece piece = (Piece) pieceClass.newInstance(); return piece; } } I'm not all used to handling exceptions yet therefore I'm just throwing them, but everywhere I use a method that uses this factory it tells me I have to throw exceptions like throwable. For example, in one of my classes I have a method that instantiates a lot of objects using the method that uses the factory. I can use the method in that class by just throwing the exception, however it won't work if I try to pass a reference to that class to another class and then use the method from there. Then it forces me to try catch the exception. I probably don't need a factory but it seemed interesting and I'd like to try to use patterns. The reason I created the factory was that I have 6 subclasses of Piece and I wan't to use a method to instantiate them by passing the type of subclass I want as an argument to the method.

    Read the article

  • Class Destructor Problem

    - by user279691
    I am making a simple class that contains a StreamWrite class Logger { private StreamWriter sw; private DateTime LastTime; public Logger(string filename) { LastTime = DateTime.Now; sw = new StreamWriter(filename); } public void Write(string s) { sw.WriteLine((DateTime.Now-LastTime).Ticks/10000+":"+ s); LastTime = DateTime.Now; } public void Flush() { sw.Flush(); } ~Logger() { sw.Close();//Raises Exception! } } But when I close this StreamWriter in the destructor, it raises an exception that the StreamWriter was already deleted? Why? And how to make it work such that when the Logger class is deleted, the StreamWriter is closed before deletion? Thanks!

    Read the article

  • How to document thrown exceptions in c#/.net

    - by Arnold Zokas
    I am currently writing a small framework that will be used internally by other developers within the company. I want to provide good Intellisense information, but I am not sure how to document thrown exceptions. In the following example: public void MyMethod1() { MyMethod2(); // also may throw InvalidOperationException } public void MyMethod2() { System.IO.File.Open(somepath...); // this may throw FileNotFoundException // also may throw DivideByZeroException } I know the markup for documenting exceptions is: /// <exception cref="SomeException">when things go wrong.</exception> What I don't understand is how to document exceptions thrown by code called by MyMethod1()? Should I document exceptions thrown by MyMethod2() Should I document exceptions thrown by File.Open() ? What would be the best way to document possible exceptions?

    Read the article

< Previous Page | 218 219 220 221 222 223 224 225 226 227 228 229  | Next Page >