Search Results

Search found 17079 results on 684 pages for 'exception logging'.

Page 225/684 | < Previous Page | 221 222 223 224 225 226 227 228 229 230 231 232  | Next Page >

  • Django - I got TemplateSyntaxError when I try open the admin page. (http://DOMAIN_NAME/admin)

    - by user140827
    I use grappelly plugin. When I try open the admin page (/admin) I got TemplateSyntaxError. It says 'get_generic_relation_list' is invalid block tag. TemplateSyntaxError at /admin/ Invalid block tag: 'get_generic_relation_list', expected 'endblock' Request Method: GET Request URL: http://DOMAIN_NAME/admin/ Django Version: 1.4 Exception Type: TemplateSyntaxError Exception Value: Invalid block tag: 'get_generic_relation_list', expected 'endblock' Exception Location: /opt/python27/django/1.4/lib/python2.7/site-packages/django/template/base.py in invalid_block_tag, line 320 Python Executable: /opt/python27/django/1.4/bin/python Python Version: 2.7.0 Python Path: ['/home/vhosts/DOMAIN_NAME/httpdocs/media', '/home/vhosts/DOMAIN_NAME/private/new_malinnikov/lib', '/home/vhosts/DOMAIN_NAME/httpdocs/', '/home/vhosts/DOMAIN_NAME/private/new_malinnikov', '/home/vhosts/DOMAIN_NAME/private/new_malinnikov', '/home/vhosts/DOMAIN_NAME/private', '/opt/python27/django/1.4', '/home/vhosts/DOMAIN_NAME/httpdocs', '/opt/python27/django/1.4/lib/python2.7/site-packages/setuptools-0.6c12dev_r88846-py2.7.egg', '/opt/python27/django/1.4/lib/python2.7/site-packages/pip-0.8.1-py2.7.egg', '/opt/python27/django/1.4/lib/python27.zip', '/opt/python27/django/1.4/lib/python2.7', '/opt/python27/django/1.4/lib/python2.7/plat-linux2', '/opt/python27/django/1.4/lib/python2.7/lib-tk', '/opt/python27/django/1.4/lib/python2.7/lib-old', '/opt/python27/django/1.4/lib/python2.7/lib-dynload', '/opt/python27/lib/python2.7', '/opt/python27/lib/python2.7/plat-linux2', '/opt/python27/lib/python2.7/lib-tk', '/opt/python27/django/1.4/lib/python2.7/site-packages', '/opt/python27/lib/python2.7/site-packages/setuptools-0.6c11-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/flup-1.0.3.dev_20100525-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/virtualenv-1.5.1-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/SQLAlchemy-0.6.4-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/SQLObject-0.14.1-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/FormEncode-1.2.3dev-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/MySQL_python-1.2.3-py2.7-linux-x86_64.egg', '/opt/python27/lib/python2.7/site-packages/psycopg2-2.2.2-py2.7-linux-x86_64.egg', '/opt/python27/lib/python2.7/site-packages/pysqlite-2.6.0-py2.7-linux-x86_64.egg', '/opt/python27/lib/python2.7/site-packages', '/opt/python27/lib/python2.7/site-packages/PIL'] Server time: ???, 7 ??? 2012 04:19:42 +0700 Error during template rendering In template /home/vhosts/DOMAIN_NAME/httpdocs/templates/grappelli/admin/base.html, error at line 28 Invalid block tag: 'get_generic_relation_list', expected 'endblock' 18 <!--[if lt IE 8]> 19 <script src="http://ie7-js.googlecode.com/svn/version/2.0(beta3)/IE8.js" type="text/javascript"></script> 20 <![endif]--> 21 {% block javascripts %} 22 <script type="text/javascript" src="{% admin_media_prefix %}jquery/jquery-1.3.2.min.js"></script> 23 <script type="text/javascript" src="{% admin_media_prefix %}js/admin/Bookmarks.js"></script> 24 <script type="text/javascript"> 25 // Admin URL 26 var ADMIN_URL = "{% get_admin_url %}"; 27 // Generic Relations 28 {% get_generic_relation_list %} 29 // Get Bookmarks 30 $(document).ready(function(){ 31 $.ajax({ 32 type: "GET", 33 url: '{% url grp_bookmark_get %}', 34 data: "path=" + escape(window.location.pathname + window.location.search), 35 dataType: "html", 36 success: function(data){ 37 $('ul#bookmarks').replaceWith(data); 38 }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • XML validation in Java - why does this fail?

    - by jd
    hi, first time dealing with xml, so please be patient. the code below is probably evil in a million ways (I'd be very happy to hear about all of them), but the main problem is of course that it doesn't work :-) public class Test { private static final String JSDL_SCHEMA_URL = "http://schemas.ggf.org/jsdl/2005/11/jsdl"; private static final String JSDL_POSIX_APPLICATION_SCHEMA_URL = "http://schemas.ggf.org/jsdl/2005/11/jsdl-posix"; public static void main(String[] args) { System.out.println(Test.createJSDLDescription("/bin/echo", "hello world")); } private static String createJSDLDescription(String execName, String args) { Document jsdlJobDefinitionDocument = getJSDLJobDefinitionDocument(); String xmlString = null; // create the elements Element jobDescription = jsdlJobDefinitionDocument.createElement("JobDescription"); Element application = jsdlJobDefinitionDocument.createElement("Application"); Element posixApplication = jsdlJobDefinitionDocument.createElementNS(JSDL_POSIX_APPLICATION_SCHEMA_URL, "POSIXApplication"); Element executable = jsdlJobDefinitionDocument.createElement("Executable"); executable.setTextContent(execName); Element argument = jsdlJobDefinitionDocument.createElement("Argument"); argument.setTextContent(args); //join them into a tree posixApplication.appendChild(executable); posixApplication.appendChild(argument); application.appendChild(posixApplication); jobDescription.appendChild(application); jsdlJobDefinitionDocument.getDocumentElement().appendChild(jobDescription); DOMSource source = new DOMSource(jsdlJobDefinitionDocument); validateXML(source); try { Transformer transformer = TransformerFactory.newInstance().newTransformer(); transformer.setOutputProperty(OutputKeys.INDENT, "yes"); StreamResult result = new StreamResult(new StringWriter()); transformer.transform(source, result); xmlString = result.getWriter().toString(); } catch (Exception e) { e.printStackTrace(); } return xmlString; } private static Document getJSDLJobDefinitionDocument() { DocumentBuilderFactory factory = DocumentBuilderFactory.newInstance(); DocumentBuilder builder = null; try { builder = factory.newDocumentBuilder(); } catch (Exception e) { e.printStackTrace(); } DOMImplementation domImpl = builder.getDOMImplementation(); Document theDocument = domImpl.createDocument(JSDL_SCHEMA_URL, "JobDefinition", null); return theDocument; } private static void validateXML(DOMSource source) { try { URL schemaFile = new URL(JSDL_SCHEMA_URL); Sche maFactory schemaFactory = SchemaFactory.newInstance(XMLConstants.W3C_XML_SCHEMA_NS_URI); Schema schema = schemaFactory.newSchema(schemaFile); Validator validator = schema.newValidator(); DOMResult result = new DOMResult(); validator.validate(source, result); System.out.println("is valid"); } catch (Exception e) { e.printStackTrace(); } } } it spits out a somewhat odd message: org.xml.sax.SAXParseException: cvc-complex-type.2.4.a: Invalid content was found starting with element 'JobDescription'. One of '{"http://schemas.ggf.org/jsdl/2005/11/jsdl":JobDescription}' is expected. Where am I going wrong here? Thanks a lot

    Read the article

  • problem burning DVD using IMAPI2 in Windows XP using c#.net..

    - by zoya
    i have used IMAPI2 for buring CD/DVD in windows XP..but it is giving me unhandeled exception...it is written as:- System.InvalidCastException: Unable to cast COM object of type 'IMAPI2.Interop.MsftFileSystemImageClass' to interface type 'IMAPI2.Interop.MsftFileSystemImage'. This operation failed because the QueryInterface call on the COM component for the interface with IID '{7CFF842C-7E97-4807-8304-910DD8F7C051}' failed due to the following error: No such interface supported (Exception from HRESULT: 0x80004002 (E_NOINTERFACE)) can anyone plz help me out to solve this pbm.. i have updated the XP storage 1.0 as written in the code project.. but still im not able to solve this error.. this project is working fine in Vista and Windows7 but unable to work with XP.. is there any solution to burn DVD in XP by using IMAPI or any other component..??? i have taken the sample code from http://www.codeproject.com/KB/miscctrl/imapi2.aspx

    Read the article

  • java.io.IOException: Invalid argument

    - by Luixv
    Hi I have a web application running in cluster mode with a load balancer. It consists in two tomcats (T1, and T2) addressing only one DB. T2 is nfs mounted to T1. This is the only dofference between both nodes. I have a java method generating some files. If the request runs on T1 there is no problem but if the request is running on node 2 I get an exception as follows: java.io.IOException: Invalid argument at java.io.FileOutputStream.close0(Native Method) at java.io.FileOutputStream.close(FileOutputStream.java:279) The corresponding code is as follows: for (int i = 0; i < dataFileList.size(); i++) { outputFileName = outputFolder + fileNameList.get(i); FileOutputStream fileOut = new FileOutputStream(outputFileName); fileOut.write(dataFileList.get(i), 0, dataFileList.get(i).length); fileOut.flush(); fileOut.close(); } The exception appears at the fileOut.close() Any hint? Luis

    Read the article

  • Handle mysql restart in SQLAlchemy

    - by wRAR
    My Pylons app uses local MySQL server via SQLAlchemy and python-MySQLdb. When the server is restarted, open pooled connections are apparently closed, but the application doesn't know about this and apparently when it tries to use such connection it receives "MySQL server has gone away": File '/usr/lib/pymodules/python2.6/sqlalchemy/engine/default.py', line 277 in do_execute cursor.execute(statement, parameters) File '/usr/lib/pymodules/python2.6/MySQLdb/cursors.py', line 166 in execute self.errorhandler(self, exc, value) File '/usr/lib/pymodules/python2.6/MySQLdb/connections.py', line 35 in defaulterrorhandler raise errorclass, errorvalue OperationalError: (OperationalError) (2006, 'MySQL server has gone away') This exception is not caught anywhere so it bubbles up to the user. If I should handle this exception somewhere in my code, please show the place for such code in a Pylons WSGI app. Or maybe there is a solution in SA itself?

    Read the article

  • Class declaration bug

    - by aladine
    Please advise me what's wrong with this class declaration: ExchEngine.java package engine; public class ExchEngine { public ExchEngine() { } public static void main(String[] args) { ExchEngine engine=new ExchEngine() ; } } When I compile this file, I always get exception: java.lang.NoClassDefFoundError: test_engine/ExchEngine Caused by: java.lang.ClassNotFoundException: test_engine.ExchEngine at java.net.URLClassLoader$1.run(URLClassLoader.java:202) at java.security.AccessController.doPrivileged(Native Method) at java.net.URLClassLoader.findClass(URLClassLoader.java:190) at java.lang.ClassLoader.loadClass(ClassLoader.java:307) at sun.misc.Launcher$AppClassLoader.loadClass(Launcher.java:301) at java.lang.ClassLoader.loadClass(ClassLoader.java:248) Exception in thread "main" This seems very weird that ExchEngine.java is inside a package and it cannot run itself. Thanks for any help.

    Read the article

  • Hibernate constraint ConstraintViolationException. Is there an easy way to ignore duplicate entries?

    - by vincent
    Basically I've got the below schema and I'm inserting records if they don't exists. However when it comes to inserting a duplicate it throws and error as I would expect. My question is whether there is an easy way to make Hibernate to just ignore inserts which would in effect insert duplicates? CREATE TABLE IF NOT EXISTS `method` ( `id` bigint(20) NOT NULL AUTO_INCREMENT, `name` varchar(10) DEFAULT NULL, PRIMARY KEY (`id`), UNIQUE KEY `name` (`name`) ) ENGINE=MyISAM DEFAULT CHARSET=latin1 AUTO_INCREMENT=2 ; SEVERE: Duplicate entry 'GET' for key 'name' Exception in thread "pool-11-thread-4" org.hibernate.exception.ConstraintViolationException: could not insert:

    Read the article

  • Does Google App Engine allow creation of files and folders on the server ?

    - by Frank
    I know Google App Engine offers free space, but I wonder if it's for storing data in it's database only or does it also allow me to create files and directories on the server side to store my data ? For instance can I use the following method to save file ? public static void saveFile(String File_Path,StringBuffer Str_Buf,boolean Append) { FileOutputStream fos=null; BufferedOutputStream bos=null; try { fos=new FileOutputStream(File_Path,Append); bos=new BufferedOutputStream(fos); for (int j=0;j<Str_Buf.length();j++) bos.write(Str_Buf.charAt(j)); } catch (Exception e) { e.printStackTrace(); } finally { try { if (bos!=null) { bos.close(); bos=null; } if (fos!=null) { fos.close(); fos=null; } } catch (Exception ex) { ex.printStackTrace(); } } } Frank

    Read the article

  • Cross-thread operation not valid: Control accessed from a thread other than the thread it was create

    - by SilverHorse
    I have a scenario. (Windows Forms, C#, .NET) There is a main form which hosts some user control. The user control does some heavy data operation, such that if I directly call the Usercontrol_Load method the UI become nonresponsive for the duration for load method execution. To overcome this I load data on different thread (trying to change existing code as little as I can) I used a background worker thread which will be loading the data and when done will notify the application that it has done its work. Now came a real problem. All the UI (main form and its child usercontrols) was created on the primary main thread. In the LOAD method of the usercontrol I'm fetching data based on the values of some control (like textbox) on userControl. The pseudocode would look like this: //CODE 1 UserContrl1_LOadDataMethod() { if(textbox1.text=="MyName") <<======this gives exception { //Load data corresponding to "MyName". //Populate a globale variable List<string> which will be binded to grid at some later stage. } } The Exception it gave was Cross-thread operation not valid: Control accessed from a thread other than the thread it was created on. To know more about this I did some googling and a suggestion came up like using the following code //CODE 2 UserContrl1_LOadDataMethod() { if(InvokeRequired) // Line #1 { this.Invoke(new MethodInvoker(UserContrl1_LOadDataMethod)); return; } if(textbox1.text=="MyName") //<<======Now it wont give exception** { //Load data correspondin to "MyName" //Populate a globale variable List<string> which will be binded to grid at some later stage } } BUT BUT BUT... it seems I'm back to square one. The Application again become nonresponsive. It seems to be due to the execution of line #1 if condition. The loading task is again done by the parent thread and not the third that I spawned. I don't know whether I perceived this right or wrong. I'm new to threading. How do I resolve this and also what is the effect of execution of Line#1 if block? The situation is this: I want to load data into a global variable based on the value of a control. I don't want to change the value of a control from the child thread. I'm not going to do it ever from a child thread. So only accessing the value so that the corresponding data can be fetched from the database.

    Read the article

  • webservice - unknown web method parameter name methodname

    - by ch3r1f
    I called a webservice for fetching items in fullcalendar. The method is never called and firebug gives this error: *"POST [http]://localhost:50536/FullCalendar/ServicioFullCalendar.asmx/GetEventosCalendario POST [http]://localhost:50536/FullCalendar/ServicioFullCalendar.asmx/GetEventosCalendario 500 Internal Server Error 1.01s" "unknown web method parameter name methodname"* Here is the asmx.vb code: <System.Web.Script.Services.ScriptService()> _ <System.Web.Services.WebService(Namespace:="http://localhost/uva/")> _ <System.Web.Services.WebServiceBinding(ConformsTo:=WsiProfiles.BasicProfile1_1)> _ <ToolboxItem(False)> _ Public Class ServicioFullCalendar Inherits System.Web.Services.WebService <ScriptMethod(ResponseFormat:=ResponseFormat.Json)> _ <WebMethod(MessageName:="ObtieneEventos")> _ Public Shared Function GetEventosCalendario(ByVal startDate As String, ByVal endDate As String) As String Try Return CalendarioMensualDAO.Instance.getEventos(startDate, endDate) Catch ex As Exception Throw New Exception("FullCalendar:GetEventos: " & ex.Message) Finally End Try End Function The webservice is "loaded" from the fullcalendar as follows: events: "ServicioFullCalendar.asmx/GetEventosCalendario",

    Read the article

  • Building libopenmetaverse on CentOS 5

    - by Gary
    I'm trying to build libopenmetaverse on CentOS however I get the following error. I'm not this kind of developer and am installing this for someone else to use. This is just the part of the build that fails. Any ideas? [nant] /opt/libomv/Programs/WinGridProxy/WinGridProxy.exe.build build Buildfile: file:///opt/libomv/Programs/WinGridProxy/WinGridProxy.exe.build Target framework: Mono 2.0 Profile Target(s) specified: build build: [echo] Build Directory is /opt/libomv/bin [csc] Compiling 15 files to '/opt/libomv/bin/WinGridProxy.exe'. [resgen] Error: Invalid ResX input. [resgen] Position: Line 2700, Column 5. [resgen] Inner exception: An exception was thrown by the type initializer for System.Drawing.GDIPlus BUILD FAILED External Program Failed: /tmp/tmp5a71a509.tmp/resgen.exe (return code was 1) Total time: 0.4 seconds. BUILD FAILED Nested build failed. Refer to build log for exact reason. Total time: 47 seconds. Build Exit Code: 1

    Read the article

  • WCF: what timeout property to use?

    - by Tom234
    I have a piece of code like so NetTcpBinding binding = new NetTcpBinding(SecurityMode.Transport); binding.Security.Message.ClientCredentialType = MessageCredentialType.Windows; binding.CloseTimeout = new TimeSpan(0, 0, 1); binding.OpenTimeout = new TimeSpan(0, 0, 1); binding.SendTimeout = new TimeSpan(0, 0, 1); binding.ReceiveTimeout = new TimeSpan(0, 0, 1); EndpointAddress endPoint = new EndpointAddress(new Uri(clientPath)); DuplexChannelFactory<Iservice> channel = new DuplexChannelFactory<Iservice>(new ClientCallBack(clientName), binding, endPoint); channel.Ping() When the endpoint doesn't exist it still waits 20seconds before throwing an EndpointNotFoundException. The weird thing is that when i changed the SendTimeout the exception message changed from The connection attempt lasted for a time span of 00:00:20 to ....01 but still took 20seconds to throw the exception! How can i change this timeout?

    Read the article

  • Use DLL and have it be as trusted as my own application is

    - by Binary255
    Hi, I am using a port of GNU GetOpts, to be specific I am using the one at: http://getopt.codeplex.com I have added the DLL as a reference. But when I run my application I receive an exception: System.IO.FileLoadException was unhandled Message="Could not load file or assembly 'Gnu.Getopt, Version=0.9.1.24287, Culture=neutral, PublicKeyToken=d014b4ccdc53511a' or one of its dependencies. Failed to grant permission to execute. (Exception from HRESULT: 0x80131418)" If it is possible I would like my application to say, "trust this DLL as much as you trust me". Is there a way to do that so I won't have to fiddle with security settings? And if there is not. What is the cleanest way to get the DLL working?

    Read the article

  • JPA getSingleResult() or null

    - by Eugene Ramirez
    Hi. I have an insertOrUpdate method which inserts an Entity when it doesn't exist or update it if it does. To enable this, I have to findByIdAndForeignKey, if it returned null insert if not then update. The problem is how do I check if it exists? So I tried getSingleResult. But it throws an exception if the public Profile findByUserNameAndPropertyName(String userName, String propertyName) { String namedQuery = Profile.class.getSimpleName() + ".findByUserNameAndPropertyName"; Query query = entityManager.createNamedQuery(namedQuery); query.setParameter("name", userName); query.setParameter("propName", propertyName); Object result = query.getSingleResult(); if(result==null)return null; return (Profile)result; } but "getSingleResult" throws an exception. Thanks

    Read the article

  • Delphi7 - How can i copy a file that is being written to

    - by Simon
    I have an application that logs information to a daily text file every second on a master PC. A Slave PC on the network using the same application would like to copy this text file to its local drive. I can see there is going to be file access issues. These files should be no larger than 30-40MB each. the network will be 100MB ethernet. I can see there is potential for the copying process to take longer than 1 second meaning the logging PC will need to open the file for writing while it is being read. What is the best method for the file writing(logging) and file copying procedures? I know there is the standard Windows CopyFile() procedure, however this has given me file access problems. There is also TFileStream using the fmShareDenyNone flag, but this also very occasionally gives me an access problem too (like 1 per week). What is this the best way of accomplishing this task? My current File Logging: procedure FSWriteline(Filename,Header,s : String); var LogFile : TFileStream; line : String; begin if not FileExists(filename) then begin LogFile := TFileStream.Create(FileName, fmCreate or fmShareDenyNone); try LogFile.Seek(0,soFromEnd); line := Header + #13#10; LogFile.Write(line[1],Length(line)); line := s + #13#10; LogFile.Write(line[1],Length(line)); finally logfile.Free; end; end else begin line := s + #13#10; Logfile:=tfilestream.Create(Filename,fmOpenWrite or fmShareDenyNone); try logfile.Seek(0,soFromEnd); Logfile.Write(line[1], length(line)); finally Logfile.free; end; end; end; My file copy procedure: procedure DoCopy(infile, Outfile : String); begin ForceDirectories(ExtractFilePath(outfile)); //ensure folder exists if FileAge(inFile) = FileAge(OutFile) then Exit; //they are the same modified time try { Open existing destination } fo := TFileStream.Create(Outfile, fmOpenReadWrite or fmShareDenyNone); fo.Position := 0; except { otherwise Create destination } fo := TFileStream.Create(OutFile, fmCreate or fmShareDenyNone); end; try { open source } fi := TFileStream.Create(InFile, fmOpenRead or fmShareDenyNone); try cnt:= 0; fi.Position := cnt; max := fi.Size; {start copying } Repeat dod := BLOCKSIZE; // Block size if cnt+dod>max then dod := max-cnt; if dod>0 then did := fo.CopyFrom(fi, dod); cnt:=cnt+did; Percent := Round(Cnt/Max*100); until (dod=0) finally fi.free; end; finally fo.free; end; end;

    Read the article

  • I am deploying a Silverlight APPlication that calls a WCF Service

    - by Rico
    It Runs It Loads but when it calls the service I get An exception occurred during the operation, making the result invalid. Check InnerException for exception details. at System.ComponentModel.AsyncCompletedEventArgs.RaiseExceptionIfNecessary() at SalesSimplicityPO_SL.POSvc.GetPurchaseOrdersCompletedEventArgs.get_Result() at SalesSimplicityPO_SL.About.mySvc_GetPurchaseOrdersCompleted(Object sender, GetPurchaseOrdersCompletedEventArgs e) at SalesSimplicityPO_SL.POSvc.POSvcClient.OnGetPurchaseOrdersCompleted(Object state) What is the problem does anyone know? I load and call my web service like.. BasicHttpBinding binding = new BasicHttpBinding(); EndpointAddress address = new EndpointAddress(new Uri("http://localhost/POSystem/POSvc.svc")); POSvc.POSvcClient mySvc = new POSvc.POSvcClient(binding, address); mySvc.InsertPOCompleted += new EventHandler<SalesSimplicityPO_SL.POSvc.InsertPOCompletedEventArgs>(mySvc_InsertPOCompleted); mySvc.InsertPOAsync(InitialsTextBox.Text.ToString(), DescTextBox.Text.ToString(), ClientTextBox.Text.ToString()); Works great in debug.... What am i Doing to get this error?

    Read the article

  • Operation can only be performed on cells that belong to a DataGridView control

    - by The Demigeek
    The following code throws an InvalidOperationException with the above message and I don't understand why. My code calls the following method when the user may have made changes to the datagridview's underlying data source. The goal is to update the display with any changed data, and preserve the sort column and order. private void ReloadDataGridBindingListFromDatabase() { DataGridView dgv = myDataGridViewControl; DataGridViewColumn sortedColumn = dgv.SortedColumn; SortOrder sortOrder = dgv.SortOrder; //do stuff here to refresh dgv.DataSource if (sortedColumn != null) { //this line throws an exception sortedColumn.HeaderCell.SortGlyphDirection = sortOrder; } //etc. } Clearly, sortedColumn.HeaderCell is a cell that belongs to a DataGridView control. So why am I getting this exception? Many thanks for your input.

    Read the article

  • How to acces File over the Network

    - by Polo
    Hi! I am having a hard time on this one, I have à folder over the network wit public accès (no credential restriction). I am trying to do à File.Exist or Directory.Exist and I keep on having a exception. Can somewone tell me the good way to do IO over the network. EDIT 1 FOR DETAILS: if i do execture = \agoodip\Public\test.txt I get the file etc etc In my code it look like a basic Directory.Exist(@"\agoodip\Public") or File.exist(@"\agoodip\Public\test.txt") The exception I get is Path not found. Thanks!

    Read the article

  • Unhandled exceptions in BackgroundWorker

    - by edg
    My WinForms app uses a number of BackgroundWorker objects to retrieve information from a database. I'm using BackgroundWorker because it allows the UI to remain unblocked during long-running database queries and it simplifies the threading model for me. I'm getting occasional DatabaseExceptions in some of these background threads, and I have witnessed at least one of these exceptions in a worker thread while debugging. I'm fairly confident these exceptions are timeouts which I suppose its reasonable to expect from time to time. My question is about what happens when an unhandled exception occurs in one of these background worker threads. I don't think I can catch an exception in another thread, but can I expect my WorkerCompleted method to be executed? Is there any property or method of the BackgroundWorker I can interrogate for exceptions?

    Read the article

  • How to get the place name by latitude and longitude using openstreetmap in android

    - by Gaurav kumar
    In my app i am using osm rather than google map.I have latitude and longitude.So from here how i will query to get the city name from osm database..please help me. final String requestString = "http://nominatim.openstreetmap.org/reverse?format=json&lat=" + Double.toString(lat) + "&lon=" + Double.toString(lon) + "&zoom=18&addressdetails=1"; RequestBuilder builder = new RequestBuilder(RequestBuilder.GET, URL.encode(requestString)); try { @SuppressWarnings("unused") Request request = builder.sendRequest(null, new RequestCallback() { @Override public void onResponseReceived(Request request, Response response) { if (response.getStatusCode() == 200) { String city = ""; try { JSONValue json = JSONParser.parseStrict(response); JSONObject address = json.isObject().get("address").isObject(); final String quotes = "^\"|\"$"; if (address.get("city") != null) { city = address.get("city").toString().replaceAll(quotes, ""); } else if (address.get("village") != null) { city = address.get("village").toString().replaceAll(quotes, ""); } } catch (Exception e) { } } } }); } catch (Exception e1) { }

    Read the article

  • Fleunt NHibernate not working outside of nunit test fixtures

    - by thorkia
    Okay, here is my problem... I created a Data Layer using the RTM Fluent Nhibernate. My create session code looks like this: _session = Fluently.Configure(). Database(SQLiteConfiguration.Standard.UsingFile("Data.s3db")) .Mappings( m => { m.FluentMappings.AddFromAssemblyOf<ProductMap>(); m.FluentMappings.AddFromAssemblyOf<ProductLogMap>(); }) .ExposeConfiguration(BuildSchema) .BuildSessionFactory(); When I reference the module in a test project, then create a test fixture that looks something like this: [Test] public void CanAddProduct() { var product = new Product {Code = "9", Name = "Test 9"}; IProductRepository repository = new ProductRepository(); repository.AddProduct(product); using (ISession session = OrmHelper.OpenSession()) { var fromDb = session.Get<Product>(product.Id); Assert.IsNotNull(fromDb); Assert.AreNotSame(fromDb, product); Assert.AreEqual(fromDb.Id, product.Id); } My tests pass. When I open up the created SQLite DB, the new Product with Code 9 is in it. the tables for Product and ProductLog are there. Now, when I create a new console application, and reference the same library, do something like this: Product product = new Product() {Code = "10", Name = "Hello"}; IProductRepository repository = new ProductRepository(); repository.AddProduct(product); Console.WriteLine(product.Id); Console.ReadLine(); It doesn't work. I actually get pretty nasty exception chain. To save you lots of head aches, here is the summary: Top Level exception: An invalid or incomplete configuration was used while creating a SessionFactory. Check PotentialReasons collection, and InnerException for more detail.\r\n\r\n The PotentialReasons collection is empty The Inner exception: The IDbCommand and IDbConnection implementation in the assembly System.Data.SQLite could not be found. Ensure that the assembly System.Data.SQLite is located in the application directory or in the Global Assembly Cache. If the assembly is in the GAC, use element in the application configuration file to specify the full name of the assembly. Both the unit test library and the console application reference the exact same version of System.Data.SQLite. Both projects have the exact same DLLs in the debug folder. I even tried copying SQLite DB the unit test library created into the debug directory of the console app, and removed the build schema lines and it still fails If anyone can help me figure out why this won't work outside of my unit tests it would be greatly appreciated. This crazy bug has me at a stand still.

    Read the article

  • C# Assembly Xna.Framework.dll does not load

    - by jbsnorro
    When trying to load Microsoft.Xna.Framework.dll from any project, it throws a FileNotFoundException. The specified module could not be found. (Exception from HRESULT: 0x8007007E), with no innerException. Even the simple code like the following throws that exception: static void Main(string[] args) { Assembly.LoadFile(@"C:\Microsoft.Xna.Framework.dll"); } I run XP x64, but I've set the platform in the configuration manager to x86, because I know it shouldn't(doesn't) work on x64 or Any CPU. I've manually added the dll file to GAC, but that didn't solve the problem. I have also tried the M$ Assembly Binding Log Viewer to see if those logs had any useful information, but they didn't. Everything, the loading etc, was a success according to them. Any suggestions? please?

    Read the article

  • java.io.FileNotFoundException for valid URL

    - by Alexei
    Hello. I use library rome.dev.java.net to fetch RSS. Code is URL feedUrl = new URL("http://planet.rubyonrails.ru/xml/rss"); SyndFeedInput input = new SyndFeedInput(); SyndFeed feed = input.build(new XmlReader(feedUrl)); You can check that http://planet.rubyonrails.ru/xml/rss is valid URL and the page is shown in browser. But I get exception from my application java.io.FileNotFoundException: http://planet.rubyonrails.ru/xml/rss at sun.net.www.protocol.http.HttpURLConnection.getInputStream(HttpURLConnection.java:1311) at com.sun.syndication.io.XmlReader.<init>(XmlReader.java:237) at com.sun.syndication.io.XmlReader.<init>(XmlReader.java:213) at rssdaemonapp.ValidatorThread.run(ValidatorThread.java:32) at java.util.concurrent.ThreadPoolExecutor$Worker.runTask(ThreadPoolExecutor.java:886) at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:908) at java.lang.Thread.run(Thread.java:619) I don't use any proxy. I get this exception on my PC and on the production server and only for this URL, other URLs are working.

    Read the article

  • How to display specific data from a file

    - by user1067332
    My program is supposed to ask the user for firstname, lastname, and phone number till the users stops. Then when to display it asks for the first name and does a search in the text file to find all info with the same first name and display lastname and phones of the matches. import java.util.*; import java.io.*; import java.util.Scanner; public class WritePhoneList { public static void main(String[] args)throws IOException { BufferedWriter output = new BufferedWriter(new FileWriter(new File( "PhoneFile.txt"), true)); String name, lname, age; int pos,choice; try { do { Scanner input = new Scanner(System.in); System.out.print("Enter First name, last name, and phone number "); name = input.nextLine(); output.write(name); output.newLine(); System.out.print("Would you like to add another? yes(1)/no(2)"); choice = input.nextInt(); }while(choice == 1); output.close(); } catch(Exception e) { System.out.println("Message: " + e); } } } Here is the display code, when i search for a name, it finds a match but displays the last name and phone number of the same name 3 times, I want it to display all of the possible matches with the first name. import java.util.*; import java.io.*; import java.util.Scanner; public class DisplaySelectedNumbers { public static void main(String[] args)throws IOException { String name; String strLine; try { FileInputStream fstream = new FileInputStream("PhoneFile.txt"); // Get the object of DataInputStream DataInputStream in = new DataInputStream(fstream); BufferedReader br = new BufferedReader(new InputStreamReader(in)); Scanner input = new Scanner(System.in); System.out.print("Enter a first name"); name = input.nextLine(); strLine= br.readLine(); String[] line = strLine.split(" "); String part1 = line[0]; String part2 = line[1]; String part3 = line[2]; //Read File Line By Line while ((strLine= br.readLine()) != null) { if(name.equals(part1)) { // Print the content on the console System.out.print("\n" + part2 + " " + part3); } } }catch (Exception e) {//Catch exception if any System.out.println("Error: " + e.getMessage()); } } }

    Read the article

< Previous Page | 221 222 223 224 225 226 227 228 229 230 231 232  | Next Page >