Search Results

Search found 32753 results on 1311 pages for 'row number'.

Page 226/1311 | < Previous Page | 222 223 224 225 226 227 228 229 230 231 232 233  | Next Page >

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Hide/Unhide rows based on more than one cell value

    - by Mike
    Please help me I am using the following code to hide rows if cell values are 0: Private Sub Worksheet_Calculate() Dim LastRow As Long, c As Range Application.EnableEvents = False LastRow = Cells(Cells.Rows.Count, "I").End(xlUp).Row On Error Resume Next For Each c In Range("I9:I48") If c.Value = 0 Then c.EntireRow.Hidden = True ElseIf c.Value > 0 Then c.EntireRow.Hidden = False End If Next On Error GoTo 0 Application.EnableEvents = True End Sub It works perfectly, but I would like for the code to also check column K (the same range K9:K48) if both cells in a row are 0 then the row must be hidden. How can I change the code to do this?

    Read the article

  • C# Bind DataTable to Existing DataGridView Column Definitions

    - by Timothy
    I've been struggling with a NullReferenceException and hope someone here will be able to point me in the right direction. I'm trying to create and populate a DataTable and then show the results in a DataGridView control. The basic code follows, and Execution stops with a NullReferenceException at the point where I invoke the new UpdateResults_Delegate. Oddly enough, I can trace entries.Rows.Count successfully before I return it from QueryEventEntries, so I can at least show 1) entries is not a null reference, and 2) the DataTable contains rows of data. I know I have to be doing something wrong, but I just don't know what. private void UpdateResults(DataTable entries) { dataGridView.DataSource = entries; } private void button_Click(object sender, EventArgs e) { PerformQuery(); } private void PerformQuery() { DateTime start = new DateTime(dateTimePicker1.Value.Year, dateTimePicker1.Value.Month, dateTimePicker1.Value.Day, 0, 0, 0); DateTime stop = new DateTime(dateTimePicker2.Value.Year, dateTimePicker2.Value.Month, dateTimePicker2.Value.Day, 0, 0, 0); DataTable entries = QueryEventEntries(start, stop); UpdateResults(entries); } private DataTable QueryEventEntries(DateTime start, DateTime stop) { DataTable entries = new DataTable(); entries.Columns.AddRange(new DataColumn[] { new DataColumn("event_type", typeof(Int32)), new DataColumn("event_time", typeof(DateTime)), new DataColumn("event_detail", typeof(String))}); using (SqlConnection conn = new SqlConnection(DSN)) { using (SqlDataAdapter adapter = new SqlDataAdapter( "SELECT event_type, event_time, event_detail FROM event_log " + "WHERE event_time >= @start AND event_time <= @stop", conn)) { adapter.SelectCommand.Parameters.AddRange(new Object[] { new SqlParameter("@start", start), new SqlParameter("@stop", stop)}); adapter.Fill(entries); } } return entries; } Update I'd like to summarize and provide some additional information I've learned from the discussion here and debugging efforts since I originally posted this question. I am refactoring old code that retrieved records from a database, collected those records as an array, and then later iterated through the array to populate a DataGridView row by row. Threading was originally implemented to compensate and keep the UI responsive during the unnecessary looping. I have since stripped out Thread/Invoke; everything now occurs on the same execution thread (thank you, Sam). I am attempting to replace the slow, unwieldy approach using a DataTable which I can fill with a DataAdapter, and assign to the DataGridView through it's DataSource property (above code updated). I've iterated through the entries DataTable's rows to verify the table contains the expected data before assigning it as the DataGridView's DataSource. foreach (DataRow row in entries.Rows) { System.Diagnostics.Trace.WriteLine( String.Format("{0} {1} {2}", row[0], row[1], row[2])); } One of the column of the DataGridView is a custom DataGridViewColumn to stylize the event_type value. I apologize I didn't mention this before in the original post but I wasn't aware it was important to my problem. I have converted this column temporarily to a standard DataGridViewTextBoxColumn control and am no longer experiencing the Exception. The fields in the DataTable are appended to the list of fields that have been pre-specified in Design view of the DataGridView. The records' values are being populated in these appended fields. When the run time attempts to render the cell a null value is provided (as the value that should be rendered is done so a couple columns over). In light of this, I am re-titling and re-tagging the question. I would still appreciate it if others who have experienced this can instruct me on how to go about binding the DataTable to the existing column definitions of the DataGridView.

    Read the article

  • Getting values from Dynamic elements.

    - by nCdy
    I'm adding some dynamic elements to my WebApp this way : (Language used is Nemerele (It has a simple C#-like syntax)) unless (GridView1.Rows.Count==0) { foreach(index with row = GridView1.Rows[index] in [0..GridView1.Rows.Count-1]) { row.Cells[0].Controls.Add ({ def TB = TextBox(); TB.EnableViewState = false; unless(row.Cells[0].Text == "&nbsp;") { TB.Text = row.Cells[0].Text; row.Cells[0].Text = ""; } TB.ID=TB.ClientID; TB.Width = 60; TB }); row.Cells[0].Controls.Add ({ def B = Button(); B.EnableViewState = false; B.Width = 80; B.Text = "?????????"; B.UseSubmitBehavior=false; // Makes no sense //B.OnClientClick="select(5);"; // HERE I CAN KNOW ABOUT TB.ID //B.Click+=EventHandler(fun(_,_) : void { }); // POST BACK KILL THAT ALL B }); } } This textboxes must make first field of GridView editable so ... but now I need to save a values. I can't do it on server side because any postback will Destroy all dynamic elements so I must do it without Post Back. So I try ... <script type="text/javascript" src="Scripts/jquery-1.4.1.min.js"></script> <script type="text/javascript"> function CallPageMethod(methodName, onSuccess, onFail) { var args = ''; var l = arguments.length; if (l > 3) { for (var i = 3; i < l - 1; i += 2) { if (args.length != 0) args += ','; args += '"' + arguments[i] + '":"' + arguments[i + 1] + '"'; } } var loc = window.location.href; loc = (loc.substr(loc.length - 1, 1) == "/") ? loc + "Report.aspx" : loc; $.ajax({ type: "POST", url: loc + "/" + methodName, data: "{" + args + "}", contentType: "application/json; charset=utf-8", dataType: "json", success: onSuccess, fail: onFail }); } function select(index) { var id = $("#id" + index).html(); CallPageMethod("SelectBook", success, fail, "id",id); } function success(response) { alert(response.d); } function fail(response) { alert("&#1054;&#1096;&#1080;&#1073;&#1082;&#1072;."); } </script> So... here is a trouble string : var id = $("#id" + index).html(); I know what is ID here : TB.ID=TB.ClientID; (when I add it) but I have no idea how to send it on Web Form. If I can add something like this div : <div id="Result" onclick="select(<%= " TB.ID " %>);"> Click here. </div> from the code it will be really goal, but I can't add this element as from CodeBehind as a dynamic element. So how can I transfer TB.ID or TB.ClientID to some static div Or how can I add some clickable dynamic element without PostBack to not destroy all my dynamic elements. Thank you.

    Read the article

  • How to have two UIPickerViews together in one ViewController?

    - by 0SX
    I'm trying to put 2 UIPickerViews together in one ViewController. Each UIPickerView has different data arrays. I'm using interface builder to link the pickers up. I know I'll have to use separate delegates and dataSources but I can't seem to hook everything up with interface builder correctly. Here's all my code: pickerTesting.h #import <UIKit/UIKit.h> #import "picker2DataSource.h" @interface pickerTestingViewController : UIViewController <UIPickerViewDelegate, UIPickerViewDataSource>{ IBOutlet UIPickerView *picker; IBOutlet UIPickerView *picker2; NSMutableArray *pickerViewArray; } @property (nonatomic, retain) IBOutlet UIPickerView *picker; @property (nonatomic, retain) IBOutlet UIPickerView *picker2; @property (nonatomic, retain) NSMutableArray *pickerViewArray; @end pickerTesting.m #import "pickerTestingViewController.h" @implementation pickerTestingViewController @synthesize picker, picker2, pickerViewArray; - (void)viewDidLoad { [super viewDidLoad]; pickerViewArray = [[NSMutableArray alloc] init]; [pickerViewArray addObject:@" 100 "]; [pickerViewArray addObject:@" 200 "]; [pickerViewArray addObject:@" 400 "]; [pickerViewArray addObject:@" 600 "]; [pickerViewArray addObject:@" 1000 "]; [picker selectRow:1 inComponent:0 animated:NO]; picker2.delegate = self; picker2.dataSource = self; } - (NSInteger)numberOfComponentsInPickerView:(UIPickerView *)picker; { return 1; } - (void)pickerView:(UIPickerView *)picker didSelectRow:(NSInteger)row inComponent:(NSInteger)component { } - (NSInteger)pickerView:(UIPickerView *)picker numberOfRowsInComponent:(NSInteger)component; { return [pickerViewArray count]; } - (NSString *)pickerView:(UIPickerView *)picker titleForRow:(NSInteger)row forComponent:(NSInteger)component; { return [pickerViewArray objectAtIndex:row]; } - (void)didReceiveMemoryWarning { // Releases the view if it doesn't have a superview. [super didReceiveMemoryWarning]; // Release any cached data, images, etc that aren't in use. } - (void)viewDidUnload { // Release any retained subviews of the main view. // e.g. self.myOutlet = nil; } - (void)dealloc { [super dealloc]; } @end And I have a separate class for the other datasource. picker2DataSource.h @interface picker2DataSource : NSObject <UIPickerViewDataSource, UIPickerViewDelegate> { NSMutableArray *customPickerArray; } @property (nonatomic, retain) NSMutableArray *customPickerArray; @end picker2DataSource.m #import "picker2DataSource.h" @implementation picker2DataSource @synthesize customPickerArray; - (id)init { // use predetermined frame size self = [super init]; if (self) { customPickerArray = [[NSMutableArray alloc] init]; [customPickerArray addObject:@" a "]; [customPickerArray addObject:@" b "]; [customPickerArray addObject:@" c "]; [customPickerArray addObject:@" d "]; [customPickerArray addObject:@" e "]; } return self; } - (void)dealloc { [customPickerArray release]; [super dealloc]; } - (NSInteger)numberOfComponentsInPickerView:(UIPickerView *)picker2; { return 1; } - (void)pickerView:(UIPickerView *)picker2 didSelectRow:(NSInteger)row inComponent:(NSInteger)component { } - (NSInteger)pickerView:(UIPickerView *)picker2 numberOfRowsInComponent:(NSInteger)component; { return [customPickerArray count]; } - (NSString *)pickerView:(UIPickerView *)picker2 titleForRow:(NSInteger)row forComponent:(NSInteger)component; { return [customPickerArray objectAtIndex:row]; } @end Any help or code examples would be great. Thanks.

    Read the article

  • How do I go about overloading C++ operators to allow for chaining?

    - by fneep
    I, like so many programmers before me, am tearing my hair out writing the right-of-passage-matrix-class-in-C++. I have never done very serious operator overloading and this is causing issues. Essentially, by stepping through This is what I call to cause the problems. cMatrix Kev = CT::cMatrix::GetUnitMatrix(4, true); Kev *= 4.0f; cMatrix Baz = Kev; Kev = Kev+Baz; //HERE! What seems to be happening according to the debugger is that Kev and Baz are added but then the value is lost and when it comes to reassigning to Kev, the memory is just its default dodgy values. How do I overload my operators to allow for this statement? My (stripped down) code is below. //header class cMatrix { private: float* _internal; UInt32 _r; UInt32 _c; bool _zeroindexed; //fast, assumes zero index, no safety checks float cMatrix::_getelement(UInt32 r, UInt32 c) { return _internal[(r*this->_c)+c]; } void cMatrix::_setelement(UInt32 r, UInt32 c, float Value) { _internal[(r*this->_c)+c] = Value; } public: cMatrix(UInt32 r, UInt32 c, bool IsZeroIndexed); cMatrix( cMatrix& m); ~cMatrix(void); //operators cMatrix& operator + (cMatrix m); cMatrix& operator += (cMatrix m); cMatrix& operator = (const cMatrix &m); }; //stripped source file cMatrix::cMatrix(cMatrix& m) { _r = m._r; _c = m._c; _zeroindexed = m._zeroindexed; _internal = new float[_r*_c]; UInt32 size = GetElementCount(); for (UInt32 i = 0; i < size; i++) { _internal[i] = m._internal[i]; } } cMatrix::~cMatrix(void) { delete[] _internal; } cMatrix& cMatrix::operator+(cMatrix m) { return cMatrix(*this) += m; } cMatrix& cMatrix::operator*(float f) { return cMatrix(*this) *= f; } cMatrix& cMatrix::operator*=(float f) { UInt32 size = GetElementCount(); for (UInt32 i = 0; i < size; i++) { _internal[i] *= f; } return *this; } cMatrix& cMatrix::operator+=(cMatrix m) { if (_c != m._c || _r != m._r) { throw new cCTException("Cannot add two matrix classes of different sizes."); } if (!(_zeroindexed && m._zeroindexed)) { throw new cCTException("Zero-Indexed mismatch."); } for (UInt32 row = 0; row < _r; row++) { for (UInt32 column = 0; column < _c; column++) { float Current = _getelement(row, column) + m._getelement(row, column); _setelement(row, column, Current); } } return *this; } cMatrix& cMatrix::operator=(const cMatrix &m) { if (this != &m) { _r = m._r; _c = m._c; _zeroindexed = m._zeroindexed; delete[] _internal; _internal = new float[_r*_c]; UInt32 size = GetElementCount(); for (UInt32 i = 0; i < size; i++) { _internal[i] = m._internal[i]; } } return *this; }

    Read the article

  • How do I call up values in PHP for user input in forms (radio buttons and selects)

    - by Derek
    Ok so my admin sets to edit a book which was created. I know how to bring in the values that were initially entered via a simple text field like 'bookname'. On the edit book page the book name field stores the currently assigned 'bookname' in the field (which is what I want! :) ) However I have other field types like selects and radio button entries...I'm having trouble calling in the already set value when the book was created. For example, there is a 'booklevel' field, which I have set as radio button entries as; Hard, Normal, and Easy. When the user goes to edit the book, I'm not too sure on how to have the current value drawn up (its stored as text) and the radio button being checked. I.e. 'Normal' is checked if this is what was set when the book was created. So far I have this as the code for the adding book level: <label>Book Level:</label> <label for="booklevel1" class="radio">Hard <input type="radio" name="booklevel" id="booklevel1" value="<?php echo 'Hard'; if (isset($_POST['booklevel'])); ?>"></label> <label for="booklevel2" class="radio">Medium<input type="radio" name="booklevel" id="booklevel2" value="<?php echo 'Normal'; if (isset($_POST['booklevel'])); ?>"></label> <label for="booklevel" class="radio">Low<input type="radio" name="booklevel" id="booklevel3" value="<?php echo 'Easy'; if (isset($_POST['booklevel'])); ?>"></label> This all works fine by the way when the user adds the book... But does anyone know how in my update book form, I can draw the value of what level has been set, and have the box checked?? To draw up the values in the text fields, I'm simply using: <?php echo $row['bookname']?> I also noticed a small issue when I call up the values for my Select options. I have the drop down select field display the currently set user (to read the book!), however, the drop down menu again displays the user in the list available options to select - basically meaning 2 of the same names appear in the list! Is there a way to eliminate the value of the SELECTED option? So far my setup for this is like: <select name="user_id" id="user_id"> <option value="<?php echo $row['user_id']?>" SELECTED><?php echo $row['fullname']?></option> <?php while($row = mysql_fetch_array($result)) { ?> <option value="<?php echo $row['user_id']?>"><?php echo $row['name']?></option> <?php } ?> </select> If anyone can help me I'll be very greatful. Sorry for the incredibly long question!! :)

    Read the article

  • Changing the background color of a view in real-time.

    - by Tarmon
    Hey Everyone, I am trying to implement a ListView that is composed of rows that contain a View on the left followed by a TextView to the right of that. I want to be able to change the background color of the first View based on it's position in the ListView. Below is what I have at this point but it doesn't seem to due anything. public class Routes extends ListActivity { String[] ROUTES; TextView selection; /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); ROUTES = getResources().getStringArray(R.array.routes); setContentView(R.layout.routes); setListAdapter(new IconicAdapter()); selection=(TextView)findViewById(R.id.selection); } public void onListItemClick(ListView parent, View v, int position, long id) { selection.setText(ROUTES[position]); } class IconicAdapter extends ArrayAdapter<String> { IconicAdapter() { super(Routes.this, R.layout.row, R.id.label, ROUTES); } } public View getView(int position, View convertView, ViewGroup parent) { LayoutInflater inflater = getLayoutInflater(); View row = inflater.inflate(R.layout.row, parent, false); TextView label = (TextView) row.findViewById(R.id.label); label.setText(ROUTES[position]); View icon = (View) row.findViewById(R.id.icon); switch(position){ case 0: icon.setBackgroundColor(R.color.Red); break; case 1: icon.setBackgroundColor(R.color.Red); break; case 2: icon.setBackgroundColor(R.color.Green); break; case 3: icon.setBackgroundColor(R.color.Green); break; case 4: icon.setBackgroundColor(R.color.Blue); break; case 5: icon.setBackgroundColor(R.color.Blue); break; case 6: icon.setBackgroundColor(R.color.Gray); break; case 7: icon.setBackgroundColor(R.color.Yellow); break; case 8: icon.setBackgroundColor(R.color.Brown); break; case 9: icon.setBackgroundColor(R.color.Brown); break; case 10: icon.setBackgroundColor(R.color.Brown); break; case 11: icon.setBackgroundColor(R.color.Purple); break; case 12: icon.setBackgroundColor(R.color.Red); break; case 13: icon.setBackgroundColor(R.color.Gold); break; case 14: icon.setBackgroundColor(R.color.Orange); break; } return(row); } } Any input is appreciated and if you have any questions don't hesitate to ask! Thanks, Rob

    Read the article

  • DataTable to JSON

    - by Joel Coehoorn
    I recently needed to serialize a datatable to JSON. Where I'm at we're still on .Net 2.0, so I can't use the JSON serializer in .Net 3.5. I figured this must have been done before, so I went looking online and found a number of different options. Some of them depend on an additional library, which I would have a hard time pushing through here. Others require first converting to List<Dictionary<>>, which seemed a little awkward and needless. Another treated all values like a string. For one reason or another I couldn't really get behind any of them, so I decided to roll my own, which is posted below. As you can see from reading the //TODO comments, it's incomplete in a few places. This code is already in production here, so it does "work" in the basic sense. The places where it's incomplete are places where we know our production data won't currently hit it (no timespans or byte arrays in the db). The reason I'm posting here is that I feel like this can be a little better, and I'd like help finishing and improving this code. Any input welcome. public static class JSONHelper { public static string FromDataTable(DataTable dt) { string rowDelimiter = ""; StringBuilder result = new StringBuilder("["); foreach (DataRow row in dt.Rows) { result.Append(rowDelimiter); result.Append(FromDataRow(row)); rowDelimiter = ","; } result.Append("]"); return result.ToString(); } public static string FromDataRow(DataRow row) { DataColumnCollection cols = row.Table.Columns; string colDelimiter = ""; StringBuilder result = new StringBuilder("{"); for (int i = 0; i < cols.Count; i++) { // use index rather than foreach, so we can use the index for both the row and cols collection result.Append(colDelimiter).Append("\"") .Append(cols[i].ColumnName).Append("\":") .Append(JSONValueFromDataRowObject(row[i], cols[i].DataType)); colDelimiter = ","; } result.Append("}"); return result.ToString(); } // possible types: // http://msdn.microsoft.com/en-us/library/system.data.datacolumn.datatype(VS.80).aspx private static Type[] numeric = new Type[] {typeof(byte), typeof(decimal), typeof(double), typeof(Int16), typeof(Int32), typeof(SByte), typeof(Single), typeof(UInt16), typeof(UInt32), typeof(UInt64)}; // I don't want to rebuild this value for every date cell in the table private static long EpochTicks = new DateTime(1970, 1, 1).Ticks; private static string JSONValueFromDataRowObject(object value, Type DataType) { // null if (value == DBNull.Value) return "null"; // numeric if (Array.IndexOf(numeric, DataType) > -1) return value.ToString(); // TODO: eventually want to use a stricter format // boolean if (DataType == typeof(bool)) return ((bool)value) ? "true" : "false"; // date -- see http://weblogs.asp.net/bleroy/archive/2008/01/18/dates-and-json.aspx if (DataType == typeof(DateTime)) return "\"\\/Date(" + new TimeSpan(((DateTime)value).ToUniversalTime().Ticks - EpochTicks).TotalMilliseconds.ToString() + ")\\/\""; // TODO: add Timespan support // TODO: add Byte[] support //TODO: this would be _much_ faster with a state machine // string/char return "\"" + value.ToString().Replace(@"\", @"\\").Replace(Environment.NewLine, @"\n").Replace("\"", @"\""") + "\""; } }

    Read the article

  • Trying to get a better understanding of SelectedValuePath and IsSynchronizedWithCurrentItem

    - by rasx
    The following XAML produces a run-time Binding error when I click on an item in the ListBox: <Window xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:sys="clr-namespace:System;assembly=mscorlib" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" x:Class="WpfApplication1.MainWindow" x:Name="Window" Title="MainWindow" Width="640" Height="480"> <Window.Resources> <x:Array x:Key="strings" Type="{x:Type sys:String}"> <sys:String>one</sys:String> <sys:String>two</sys:String> <sys:String>three</sys:String> <sys:String>four</sys:String> </x:Array> </Window.Resources> <Grid> <ListBox DataContext="{StaticResource strings}" IsSynchronizedWithCurrentItem="True" ItemsSource="{Binding}" SelectedValuePath="{Binding /Length}"> <ListBox.ItemTemplate> <DataTemplate> <Grid> <Grid.Resources> <Style TargetType="{x:Type Label}"> <Setter Property="Background" Value="Yellow"/> <Setter Property="Margin" Value="0,0,4,0"/> <Setter Property="Padding" Value="0"/> </Style> </Grid.Resources> <Grid.ColumnDefinitions> <ColumnDefinition/> <ColumnDefinition/> </Grid.ColumnDefinitions> <Grid.RowDefinitions> <RowDefinition/> <RowDefinition/> </Grid.RowDefinitions> <!-- Row 0 --> <Label Grid.Column="0" Grid.Row="0">String:</Label> <TextBlock Grid.Column="1" Grid.Row="0" Text="{Binding}"/> <!-- Row 1 --> <Label Grid.Column="0" Grid.Row="1">Length:</Label> <TextBlock Grid.Column="1" Grid.Row="1" Text="{Binding Length, Mode=Default}"/> </Grid> </DataTemplate> </ListBox.ItemTemplate> </ListBox> </Grid> </Window> This is the run-time Binding error message: System.Windows.Data Error: 39 : BindingExpression path error: '3' property not found on 'object' ''String' (HashCode=1191344027)'. BindingExpression:Path=3; DataItem='String' (HashCode=1191344027); target element is 'ListBox' (Name=''); target property is 'NoTarget' (type 'Object') I would like the selected value of the ListBox to be the Length of the selected String object. What is wrong with my SelectedValuePath Binding syntax? Are there any related issues with IsSynchronizedWithCurrentItem?

    Read the article

  • I can't upload mp3 files using Codeigniter

    - by Drew
    There are lots of suggested fixes for this but none of them work for me. I have tried making the upload class (using the following methods: http://codeigniter.com/forums/viewthread/148605/ and http://codeigniter.com/forums/viewthread/125441/). When i try to upload an mp3 i get the error message "The filetype you are attempting to upload is not allowed". Below is my code for my model and my form (i've got a very skinny controller). If someone could help me out with this I would be eternally grateful. --Model-- function do_upload() { $soundfig['upload_path'] = './uploads/nav'; $soundfig['allowed_types'] = 'mp3'; $this->load->library('upload', $soundfig); if ( ! $this->upload->do_upload()) { $error = array('error' => $this->upload->display_errors()); return $error; } else { /* $data = $this->upload->data('userfile'); */ $sound = $this->upload->data(); /* $full_path = 'uploads/nav/' . $data['file_name']; */ $sound_path = 'uploads/nav/' . $sound['file_name']; if($this->input->post('active') == '1'){ $active = '1'; }else{ $active = '0'; } $spam = array( /* 'image_url' => $full_path, */ 'sound' => $sound_path, 'active' => $active, 'url' => $this->input->post('url') ); $id = $this->input->post('id'); $this->db->where('id', $id); $this->db->update('NavItemData', $spam); return true; } } --View - Form-- <?php echo form_open_multipart('upload/do_upload');?> <?php if(isset($buttons)) : foreach($buttons as $row) : ?> <h2><?php echo $row->name; ?></h2> <!-- <input type="file" name="userfile" size="20" /><br /> --> <input type="file" name="userfile" size="20" /> <input type="hidden" name="oldfile" value="<?php echo $row->image_url; ?>" /> <input type="hidden" name="id" value="<?php echo $row->id; ?>" /> <br /><br /> <label>Url: </label><input type="text" name="url" value="<?php echo $row->url; ?>" /><br /> <input type="checkbox" name="active" value="1" <?php if($row->active == '1') { echo 'checked'; } ?> /><br /><br /> <input type="submit" value="submit" /> </form> <?php endforeach; ?> <?php endif; ?>

    Read the article

  • Problems uploading different file types in codeigniter

    - by Drew
    Below is my script that i'm using to upload different files. All the solutions I've found deal only with multiple image uploads. I am totally stumped for a solution on this. Can someone tell me what it is i'm supposed to be doing to upload different files in the same form? Thanks function do_upload() { $config['upload_path'] = './uploads/nav'; $config['allowed_types'] = 'gif|jpg|png'; $config['max_size'] = '2000'; $this->load->library('upload', $config); if ( ! $this->upload->do_upload('userfile')) { $error = array('error' => $this->upload->display_errors()); return $error; } else { $soundfig['upload_path'] = './uploads/nav'; $soundfig['allowed_types'] = 'mp3|wav'; $this->load->library('upload', $soundfig); if ( ! $this->upload->do_upload('soundfile')) { $error = array('error' => $this->upload->display_errors()); return $error; } else { $data = $this->upload->data('userfile'); $sound = $this->upload->data('soundfile'); $full_path = 'uploads/nav/' . $data['file_name']; $sound_path = 'uploads/nav/' . $sound['file_name']; if($this->input->post('active') == '1'){ $active = '1'; }else{ $active = '0'; } $spam = array( 'image_url' => $full_path, 'sound' => $sound_path, 'active' => $active, 'url' => $this->input->post('url') ); $id = $this->input->post('id'); $this->db->where('id', $id); $this->db->update('NavItemData', $spam); return true; } } } Here is my form: <?php echo form_open_multipart('upload/do_upload');?> <?php if(isset($buttons)) : foreach($buttons as $row) : ?> <h2><?php echo $row->name; ?></h2> <input type="file" name="userfile" size="20" /><br /> <input type="file" name="soundfile" size="20" /> <input type="hidden" name="oldfile" value="<?php echo $row->image_url; ?>" /> <input type="hidden" name="id" value="<?php echo $row->id; ?>" /> <br /><br /> <label>Url: </label><input type="text" name="url" value="<?php echo $row->url; ?>" /><br /> <input type="checkbox" name="active" value="1" <?php if($row->active == '1') { echo 'checked'; } ?> /><br /><br /> <input type="submit" value="submit" /> </form> <?php endforeach; ?> <?php endif; ?>

    Read the article

  • How to select all options from a drop list in php / mysql

    - by Mirage81
    Thanks to stackoverflow.com's frienly experts I've managed to create my first php + mysql application. The code searches a mysql database for last names and cities. The choices are made through two drop lists like these: Choose city: All cities Liverpool Manchester Choose last name: All last names Lennon Gallagher The code would return eg. all the Lennons living in Liverpool. However, I haven't been able to make the options "All cities" and "All last names" to work so that the code would return eg. all the Lennons living in any city or all the people living in Liverpool. So, how can that be done? The code so far: index.php <?php $conn = mysql_connect('localhost', 'user', 'password') or die("Connection failed"); mysql_select_db("database", $conn) or die("Switch database failed"); //this gets the cities from the database to the drop list $query = "SELECT DISTINCT city FROM user".mysql_real_escape_string($city); $result = mysql_query($query, $conn); $options=""; while ($row=mysql_fetch_array($result)) { $city=$row["city"]; $options.="<OPTION VALUE=\"$city\">".$city; } //this gets the last names from the database to the drop list $query2 = "SELECT DISTINCT lastname FROM user".mysql_real_escape_string($lastname); $result2 = mysql_query($query2, $conn); $options2=""; while ($row2=mysql_fetch_array($result2)) { $lastname=$row2["lastname"]; $options2.="<OPTION VALUE=\"$lastname\">".$lastname; } ?> <!DOCTYPE html PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN"> <html> <head> <meta content="text/html; charset=ISO-8859-1" http-equiv="content-type"> <title>test</title> </head> <body> <form action="get.php" method="post"> <p> <select name="city"> <option value=0>Choose <option value=1>All cities <?=$options?> </select> </p> <p> <select name="lastname"> <option value=0>Choose <option value=1>All last names <?=$options2?> </select> </p> <p> <input value="Search" type="submit"> </p> </form> <br> </body> </html> get.php <?php $conn = mysql_connect('localhost', 'user', 'password') or die("Connection failed"); mysql_select_db("database", $conn) or die("Switch database failed"); $query = "SELECT * FROM user WHERE city = '".mysql_real_escape_string($_POST['city'])."' AND lastname = '".mysql_real_escape_string($_POST['lastname'])."'"; $result = mysql_query($query, $conn); echo $rowcount; $zerorows=true; while ($row = mysql_fetch_assoc($result)) { $zerorows=false; echo '<b>City: </b>'.htmlspecialchars($row[city]).'<br />'; echo '<b>Last name: </b>'.htmlspecialchars($row[lastname]).'<br />'; echo '<b>Information: </b>'.htmlspecialchars($row[information]).'<br />'.'<br />'; } if($zerorows) echo "No results"; mysql_close($conn); ?>

    Read the article

  • Decentralized synchronized secure data storage

    - by Alberich
    Introduction Hi, I am going to ask a question which seems utopic for me, but I need to know if there is a way to achieve what I need. And if not, I need to know why not. The idea Suppose I have a database structure, in MySql. I want to create some solution to allow anyone (no matter who, no matter where) to have a synchronized copy (updated clone) of this database (with its content) Well, and it is not going to be just one synchronized copy, it could (and should) be a multiple replication (supposing the basic, this means, for example, ten copies all over the world) And, the most important thing: It must be secure. By secure I mean only real-accepted transactions will be synchronized with all the others (no matter how many) database copies/clones. Note: Since it would be quite difficult to make the synchronization in real-time, I will design everything to make this feature dispensable. So it is not required. My auto-suggestion This is how I am thinking to manage it: Time identifiers and Updates checking: Every action (insert, update, delete...) will be stored as the action instruction itself, associated to the time identifier. [I think better than a DATETIME field, it'll be an INT one, with the number of miliseconds passed from 1st january 2013 on, for example]. So each copy is going to ask to the "neighbour copy" for new actions done since last update, and execute them after checking they are allowed. Problem 1: the "neighbour copy" could be outdated too. Solution 1: do not ask just one neighbour, create a random list with some of the copies/clones and ask them for news (I could avoid the list and ask ALL the clones for updates, but this will be inefficient if clones number ascends too much). Problem 2: Real-time global synchronization is not active. What if... Someone at CLONE_ENTERPRISING inserts a row into TABLE. ... this row goes to every clone ... Someone at CLONE_FIXEMALL deletes this row. ... and at the same time, somewhere in an outdated clone ... Someone at CLONE_DROPOUT edits this row (now inexistent at the other clones) Solution 2: easy stuff, force a GLOBAL synchronization before doing any new "depending-on-third-data action" (edit, for example). This global synch. will be unnecessary when making an INSERT, for instance. Note: Well, someone could have some fun, and make the same insert in two clones... since they're not getting updated in real-time, this row will exist twice. But, it's the same as when we have one single database, in some needed cases we check if there is an existing same-row before doing the final action. Not a problem. Problem 3: It is possible to edit the code and do not filter actions, so someone could spread instructions to delete everything, or just make some trolling activity. This is not a problem, since good clones will always be somewhere. Those who got bad won't interest anymore. I really appreciate if you read. I know this is not the perfect solution, it has possibly hundred of holes, but it is my basic start. I will now appreciate anything you can teach me now. Thanks a lot. PS.: It could be that all this I am trying already exists and has its own name. Sorry for asking then (I'd anyway thank this name, if it exists)

    Read the article

  • MasterDetails Loading on Demand problem

    - by devnet247
    Hi As an exercise to learn wpf and understand how binding works I have an example that works.However when I try to load on demand I fail miserably. I basically have 3 classes Country-City-Hotels If I load ALL in one go it all works if I load on demand it fails miserably. What Am I doing wrong? Works <Window x:Class="MasterDetailCollectionViewSource.CountryCityHotelWindow" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" Title="CountryCityHotelWindow" Height="300" Width="450"> <Window.Resources> <CollectionViewSource Source="{Binding}" x:Key="cvsCountryList"/> <CollectionViewSource Source="{Binding Source={StaticResource cvsCountryList},Path=Cities}" x:Key="cvsCityList"/> <CollectionViewSource Source="{Binding Source={StaticResource cvsCityList},Path=Hotels}" x:Key="cvsHotelList"/> </Window.Resources> <Grid> <Grid.ColumnDefinitions> <ColumnDefinition/> <ColumnDefinition/> <ColumnDefinition/> </Grid.ColumnDefinitions> <Grid.RowDefinitions> <RowDefinition Height="Auto"/> <RowDefinition/> </Grid.RowDefinitions> <TextBlock Grid.Column="0" Grid.Row="0" Text="Countries"/> <TextBlock Grid.Column="1" Grid.Row="0" Text="Cities"/> <TextBlock Grid.Column="2" Grid.Row="0" Text="Hotels"/> <ListBox Grid.Column="0" Grid.Row="1" Name="lstCountries" ItemsSource="{Binding Source={StaticResource cvsCountryList}}" DisplayMemberPath="Name" SelectionChanged="OnSelectionChanged"/> <ListBox Grid.Column="1" Grid.Row="1" Name="lstCities" ItemsSource="{Binding Source={StaticResource cvsCityList}}" DisplayMemberPath="Name" SelectionChanged="OnSelectionChanged"/> <ListBox Grid.Column="2" Grid.Row="1" Name="lstHotels" ItemsSource="{Binding Source={StaticResource cvsHotelList}}" DisplayMemberPath="Name" SelectionChanged="OnSelectionChanged"/> </Grid> </Window> DOES NOT WORK Xaml is the same as above, however I have added the following that fetches stuff on demand. It loads the countries only as opposed to the other one where it Loads everything at once and not code behind is necessary. public CountryCityHotelWindow() { InitializeComponent(); //Load only country Initially lstCountries.ItemsSource=Repository.GetCountries(); DataContext = lstCountries; } private void OnSelectionChanged(object sender, SelectionChangedEventArgs e) { var lstBox = (ListBox)e.OriginalSource; switch (lstBox.Name) { case "lstCountries": var country = lstBox.SelectedItem as Country; if (country == null) return; lstCities.ItemsSource = Repository.GetCities(country.Name); break; case "lstCities": var city = lstBox.SelectedItem as City; if (city == null) return; lstHotels.ItemsSource = Repository.GetHotels(city.Name); break; case "lstHotels": break; } } What Am I doing Wrong? Thanks

    Read the article

  • C# DotNetNuke Module: GridVIew AutoGenerateEditButton is skipping over a field on update.

    - by AlexMax
    I have a GridView with an automatically generated Edit button. I wanted some customized behavior for the Image column, since I wanted it to be a drop down list of items as opposed to a simple input field, and I also wanted some nice "fallback" in case the value in the database didn't actually exist in the drop down list. With the code I have done so far, I have gotten the behavior I desire out of the Image field. The problem is that when i attempt to update that particular field, I get an error spit out back at me that it can't find a method to update the form with: ObjectDataSource 'objDataSource' could not find a non-generic method 'UpdateDiscovery' that has parameters: ModuleId, Visible, Position, Title, Link, ItemId. That's not good, because I DO have an UpdateDiscovery method. However, between Title and Link, there is supposed to be another param that belongs to the Image field, and it's not being passed. I realize that it's probably the update button doesn't know to pass that field, since it's a TemplateField and not a BoundField, and when I use Bind('image') as the selected value for the drop down list, it seems to update fine...but only as long as the field in the database when I try and edit the row actually exists, otherwise it bombs out and gives me an error about the value not existing in the drop down list. I have the following GridView defined: <asp:GridView ID="grdDiscoverys" runat="server" DataSourceID="objDataSource" EnableModelValidation="True" AutoGenerateColumns="false" AutoGenerateEditButton="true" AutoGenerateDeleteButton="true" DataKeyNames="ItemId" OnRowDataBound="cmdDiscovery_RowDataBound"> <Columns> <asp:BoundField DataField="ItemId" HeaderText="#" ReadOnly="true" /> <asp:BoundField DataField="Visible" HeaderText="Visible" /> <asp:BoundField DataField="Position" HeaderText="Position" /> <asp:TemplateField HeaderText="Image"> <ItemTemplate> <asp:Label ID="lblViewImage" runat="server" /> </ItemTemplate> <EditItemTemplate> <asp:DropDownList ID="ddlEditImage" runat="server" title="Image" DataValueField="Key" DataTextField="Value" /> </EditItemTemplate> </asp:TemplateField> <asp:BoundField DataField="Title" HeaderText="Title" /> <asp:BoundField DataField="Link" HeaderText="Link" /> </Columns> </asp:GridView> The datasource that this is tied to: <asp:ObjectDataSource ID="objDataSource" runat="server" TypeName="MyCompany.Modules.Discovery.DiscoveryController" SelectMethod="GetDiscoverys" UpdateMethod="UpdateDiscovery" DeleteMethod="DeleteDiscovery"> <SelectParameters> <asp:QueryStringParameter Name="ModuleId" QueryStringField="mid" /> </SelectParameters> <UpdateParameters> <asp:QueryStringParameter Name="ModuleId" QueryStringField="mid" /> </UpdateParameters> <DeleteParameters> <asp:QueryStringParameter Name="ModuleId" QueryStringField="mid" /> </DeleteParameters> </asp:ObjectDataSource> The cmdDiscovery_RowDataBound method that gets called when the row's data is bound is the following C# code: protected void cmdDiscovery_RowDataBound(object sender, GridViewRowEventArgs e) { try { if (e.Row.RowIndex >= 0) { int intImage = ((DiscoveryInfo)e.Row.DataItem).Image; if (grdDiscoverys.EditIndex == -1) { // View Label lblViewImage = ((Label)e.Row.FindControl("lblViewImage")); if (GetFileDictionary().ContainsKey(intImage)) { lblViewImage.Text = GetFileDictionary()[intImage]; } else { lblViewImage.Text = "Missing Image"; } } else { // Edit DropDownList ddlEditImage = ((DropDownList)e.Row.FindControl("ddlEditImage")); ddlEditImage.DataSource = GetFileDictionary(); ddlEditImage.DataBind(); if (GetFileDictionary().ContainsKey(intImage)) { ddlEditImage.SelectedValue = intImage.ToString(); } } } } catch (Exception exc) { //Module failed to load Exceptions.ProcessModuleLoadException(this, exc); } } How do I make sure that the Image value in the drop down list is passed to the update function?

    Read the article

  • why the value is not passed to my contrller page in codeigniter?

    - by udaya
    Hi I am selecting state from country and city from state This is my select country Select box <td width=""><select name="country" onChange="getState(this.value)" class="text_box_width_190"> <option value="0">Select Country</option> <? foreach($country as $row) { ?> <option value="<?=$row['dCountry_id']?>"><?=$row['dCountryName']?></option> <? } ?> </select></td> This is my select state select box <select name="state" id="state" class="text_box_width_190" > <option value="0">Select State</option> </select> This is my select city selectbox <td width=""><div id="citydiv"><select name="city" class="text_box_width_190"> <option>Select City</option> </select></div></td> this is my script <script type ="text/javascript"> function getXMLHTTP() { //fuction to return the xml http object var xmlhttp=false; try{ xmlhttp=new XMLHttpRequest(); } catch(e) { try{ xmlhttp= new ActiveXObject("Microsoft.XMLHTTP"); } catch(e){ try{ xmlhttp = new ActiveXObject("Msxml2.XMLHTTP"); } catch(e1){ xmlhttp=false; } } } return xmlhttp; } function getState(countryId) { var strURL="http://localhost/ssit/system/application/views/findState.php?country="+countryId; var req = getXMLHTTP(); if (req) { req.onreadystatechange = function() { if (req.readyState == 4) { // only if "OK" if (req.status == 200) { document.getElementById('statediv').innerHTML=req.responseText; } else { alert("There was a problem while using XMLHTTP:\n" + req.statusText); } } } req.open("GET", strURL, true); req.send(null); } } function getCity(countryId,stateId) { var strURL="http://localhost/ssit/system/application/views/findCity.php?country="+countryId+"&state="+stateId; var req = getXMLHTTP(); if (req) { req.onreadystatechange = function() { if (req.readyState == 4) { // only if "OK" if (req.status == 200) { document.getElementById('citydiv').innerHTML=req.responseText; } else { alert("There was a problem while using XMLHTTP:\n" + req.statusText); } } } req.open("GET", strURL, true); req.send(null); } } </script> This is my findstate page <? $country=intval($_GET['country']); $link = mysql_connect('localhost', 'root', ''); //changet the configuration in required if (!$link) { die('Could not connect: ' . mysql_error()); } mysql_select_db('ssit'); $query="Select dStateName,dState_id FROM tbl_state Where dCountry_id='1'"; $result=mysql_query($query); ?> <select name="state" onchange="getCity(<?=$country?>,this.value)"> <option value="0">Select State</option> <? while($row=mysql_fetch_array($result)) { ?> <option value=<?=$row['dState_id']?>><?=$row['dStateName']?></option> <? } ?> </select> This is my find city page <? $countryId=intval($_GET['country']); $stateId=intval($_GET['state']); $link = mysql_connect('localhost', 'root', ''); //changet the configuration in required if (!$link) { die('Could not connect: ' . mysql_error()); } mysql_select_db('ssit'); $query="Select dCityName,dCity_id FROM tbl_city Where dState_id='30'"; $result=mysql_query($query); ?> <select na me="city" Select City when i post country i can receive it but i cant receive my state and city How to receive it

    Read the article

  • Form gets submitted Multiple times

    - by rasika vijay
    While clicking inside the form , the form automatically tried to resubmit , I cannot figure out which part of the code causes it to behave like this . In the createTable function , a table is created after the domain is given . But I am unable to select any of the controls in the output . I have attached the jsfiddle code link here : http://jsfiddle.net/rasikaceg/S7kWM/ function createTable() { document.getElementById("table_container").innerHTML = ""; var input_domain = document.forms["form1"]["DomainName"].value; if (input_domain == null || input_domain == "") return; var table = document.createElement("table"), tablehead = document.createElement("thead"), theadrow = document.createElement("tr"), th1 = document.createElement("th"), th2 = document.createElement("th"), th3 = document.createElement("th"), th4 = document.createElement("th"); th1.appendChild(document.createTextNode("Website")); th2.appendChild(document.createTextNode("Enable/Disable Live Update for LM and CBD")); th3.appendChild(document.createTextNode("From Date")); th4.appendChild(document.createTextNode("To Date")); theadrow.appendChild(th1); theadrow.appendChild(th2); theadrow.appendChild(th3); theadrow.appendChild(th4); tablehead.appendChild(theadrow); table.appendChild(tablehead); var names = ["website1", "website2"]; var container = document.getElementById("table_container"); var tablebody = document.createElement("tbody"); for (var i = 0, len = names.length; i < len; ++i) { var row = document.createElement("tr"), column1 = document.createElement("td"), column2 = document.createElement("td"), column3 = document.createElement("td"), column4 = document.createElement("td"), checkbox = document.createElement('input'); checkbox.type = "checkbox"; checkbox.name = names[i]; checkbox.value = names[i]; checkbox.id = names[i]; var label = document.createElement('label') label.htmlFor = names[i]; label.appendChild(document.createTextNode(names[i])); column1.appendChild(checkbox); column1.appendChild(label); var dropdown = document.createElement("select"); dropdown.name = names[i] + "_select"; var op1 = new Option(); op1.value = "enable"; op1.text = "enable"; var op2 = new Option(); op2.value = "disable"; op2.text = "disable"; dropdown.options.add(op1); dropdown.options.add(op2); column2.appendChild(dropdown); var datetime_from = document.createElement('input'); datetime_from.type = "datetime-local"; datetime_from.name = names[i] + "_from"; column3.appendChild(datetime_from); var datetime_to = document.createElement('input'); datetime_to.type = "datetime-local"; datetime_to.name = names[i] + "_to"; column4.appendChild(datetime_to); row.appendChild(column1); row.appendChild(column2); row.appendChild(column3); row.appendChild(column4); tablebody.appendChild(row); } table.appendChild(tablebody); document.getElementById("table_container").appendChild(table); }

    Read the article

  • replaceAll() method using parameter from text file

    - by Herman Plani Ginting
    i have a collection of raw text in a table in database, i need to replace some words in this collection using a set of words. i put all the term to be replace and its substitutes in a text file as below min=admin lelet=lambat lemot=lambat nii=nih ntu=itu and so on. i have successfully initiate a variabel of File and Scanner to read the collection of the term and its substitutes. i loop all the dataset and save the raw text in a string in the same loop i loop all the term collection and save its row to a string name 'pattern', and split the pattern into two string named 'term' and 'replacer' in this loop i initiate a new string which its value is the string from the dataset modified by replaceAll(term,replacer) end loop for term collection then i insert the new string to another table in database end loop for dataset i do it manualy as below replaceAll("min","admin") and its works but its really something to code it manually for almost 2000 terms to be replace it. anyone ever face this kind of really something.. i really need a help now desperate :( package sentimenrepo; import javax.swing.*; import java.sql.*; import java.io.*; //import java.util.HashMap; import java.util.Scanner; //import java.util.Map; /** * * @author herman */ public class synonimReplaceV2 extends SwingWorker { protected Object doInBackground() throws Exception { new skripsisentimen.sentimenttwitter().setVisible(true); Integer row = 0; File synonimV2 = new File("synV2/catatan_kata_sinonim.txt"); String newTweet = ""; DB db = new DB(); Connection conn = db.dbConnect("jdbc:mysql://localhost:3306/tweet", "root", ""); try{ Statement select = conn.createStatement(); select.executeQuery("select * from synonimtweet"); ResultSet RS = select.getResultSet(); Scanner scSynV2 = new Scanner(synonimV2); while(RS.next()){ row++; String no = RS.getString("no"); String tweet = " "+ RS.getString("tweet"); String published = RS.getString("published"); String label = RS.getString("label"); clean2 cleanv2 = new clean2(); newTweet = cleanv2.cleanTweet(tweet); try{ Statement insert = conn.createStatement(); insert.executeUpdate("INSERT INTO synonimtweet_v2(no,tweet,published,label) values('" +no+"','"+newTweet+"','"+published+"','"+label+"')"); String current = skripsisentimen.sentimenttwitter.txtAreaResult.getText(); skripsisentimen.sentimenttwitter.txtAreaResult.setText(current+"\n"+row+"original : "+tweet+"\n"+newTweet+"\n______________________\n"); skripsisentimen.sentimenttwitter.lblStat.setText(row+" tweet read"); skripsisentimen.sentimenttwitter.txtAreaResult.setCaretPosition(skripsisentimen.sentimenttwitter.txtAreaResult.getText().length() - 1); }catch(Exception e){ skripsisentimen.sentimenttwitter.lblStat.setText(e.getMessage()); } skripsisentimen.sentimenttwitter.lblStat.setText(e.getMessage()); } }catch(Exception e){ skripsisentimen.sentimenttwitter.lblStat.setText(e.getMessage()); } return row; } class clean2{ public clean2(){} public String cleanTweet(String tweet){ File synonimV2 = new File("synV2/catatan_kata_sinonim.txt"); String pattern = ""; String term = ""; String replacer = ""; String newTweet=""; try{ Scanner scSynV2 = new Scanner(synonimV2); while(scSynV2.hasNext()){ pattern = scSynV2.next(); term = pattern.split("=")[0]; replacer = pattern.split("=")[1]; newTweet = tweet.replace(term, replacer); } }catch(Exception e){ e.printStackTrace(); } System.out.println(newTweet+"\n"+tweet); return newTweet; } } }

    Read the article

  • Button with cell inside to big

    - by josh_24_2
    When i load it loads its cell with the button inside to big.Link to an example image: http://i.stack.imgur.com/x5j40.jpg. Also is there a way to change size of cells :) Please help me, If you need more info please must ask and I will be happy to give more information. <div class="content"> <?php $con = mysql_connect("","",""); if (!$con) { die('Could not connect: ' . mysql_error()); } mysql_select_db("", $con); $result = mysql_query("SELECT * FROM users ORDER by user_id"); echo "<link rel='stylesheet' href='<?php echo URL; ?>public/css/style.css' /><div class='CSSTableGenerator' > <table > <tr> <td> </td> <td> ID </td> <td > Username </td> <td> Email </td> <td> Admin </td> <td> User Active </td> </tr>"; while($row = mysql_fetch_array($result)) { if ($row['user_perm_level'] == "2") { $admin = 'Yes'; } else { $admin = 'No'; } if ($row['user_active'] == "1") { $active = 'Yes'; } else { $active = 'No'; } echo "<tr>"; echo "<td><input type='checkbox' name='1' value='1'></td>"; echo "<td>" . $row['user_id'] . "</td>"; echo "<td>" . $row['user_name'] . "</td>"; echo "<td>" . $row['user_email'] . "</td>"; echo "<td>" . $admin . "</td>"; echo "<td>" . $active . "</td>"; echo "</tr>"; } echo "</table></div>"; mysql_close($con); ?> </div> Thanks josh_24_2

    Read the article

  • Using the login Details via Application

    - by ramin ss
    I have a CURL(in C++) to send my user and pass to remauth.php file so i think i do something wrong on remuth.php ( because i am basic in php and my program can not run because the auth not passed.) I use login via Application. my CURL: bool Auth_PerformSessionLogin(const char* username, const char* password) { curl_global_init(CURL_GLOBAL_ALL); CURL* curl = curl_easy_init(); if (curl) { char url[255]; _snprintf(url, sizeof(url), "http://%s/remauth.php", "SITEADDRESS.com"); char buf[8192] = {0}; char postBuf[8192]; _snprintf(postBuf, sizeof(postBuf), "%s&&%s", username, password); curl_easy_setopt(curl, CURLOPT_URL, url); curl_easy_setopt(curl, CURLOPT_WRITEFUNCTION, AuthDataReceived); curl_easy_setopt(curl, CURLOPT_WRITEDATA, (void*)&buf); curl_easy_setopt(curl, CURLOPT_USERAGENT, "IW4M"); curl_easy_setopt(curl, CURLOPT_FAILONERROR, true); curl_easy_setopt(curl, CURLOPT_POST, 1); curl_easy_setopt(curl, CURLOPT_POSTFIELDS, postBuf); curl_easy_setopt(curl, CURLOPT_POSTFIELDSIZE, -1); curl_easy_setopt(curl, CURLOPT_SSL_VERIFYPEER, false); CURLcode code = curl_easy_perform(curl); curl_easy_cleanup(curl); curl_global_cleanup(); if (code == CURLE_OK) { return Auth_ParseResultBuffer(buf); } else { Auth_Error(va("Could not reach the SITEADDRESS.comt server. Error code from CURL: %x.", code)); } return false; } curl_global_cleanup(); return false; } and my remauth.php: <?php ob_start(); $host=""; // Host name $dbusername=""; // Mysql username $dbpassword=""; // Mysql password $db_name=""; // Database name $tbl_name=""; // Table name // Connect to server and select databse. mysql_connect("$host", "$dbusername", "$dbpassword") or die(mysql_error()); mysql_select_db("$db_name") or die(mysql_error()); // Define $username and $password //$username=$username; //$password=md5($_POST['password']); //$password=$password; $username=$_POST['username']; $password=$_POST['password']; //$post_item[]='action='.$_POST['submit']; // To protect MySQL injection (more detail about MySQL injection) $username = stripslashes($username); $password = stripslashes($password); $username = mysql_real_escape_string($username); $password = mysql_real_escape_string($password); $sql="SELECT * FROM $tbl_name WHERE username='$username'"; $result=mysql_query($sql); // Mysql_num_row is counting table row $count=mysql_num_rows($result); // If result matched $username and $password, table row must be 1 row if($count==1){ $row = mysql_fetch_assoc($result); if (md5(md5($row['salt']).md5($password)) == $row['password']){ session_register("username"); session_register("password"); echo "#"; return true; } else { echo "o"; return false; } } else{ echo "o"; return false; } ob_end_flush(); ?> ///////////////////////////////////

    Read the article

  • Passing html attribute value to the next script in php

    - by NewBiL
    I have three php scripts. main.php questions.php and values.php Here's the code main.php <html> <head> <title></title> </head> <body> <h1>Be Prepare for the battle</h1> <?php $strTitle = "Begin"; $strLink = "<a href = 'question.php?ques_id=1'>" . $strTitle ."</a>"; echo $strLink; ?> </body> </html> questions.php <?php require_once('../connect.php'); $quesSQL = mysql_query("SELECT * FROM `questions` WHERE `ques_id`=". $_GET["ques_id"]); if(!mysql_num_rows($quesSQL)>=1) { die('Complete.'); } $next = $_GET["ques_id"]; while($row = mysql_fetch_array($quesSQL)) { $id = $row['ques_id']; $strTitle = $row['ques_title']; echo "<li>". $strTitle ."</li><br/>"; } $optSQL = mysql_query("SELECT `options`,`values` FROM questions_options WHERE ".$id."= ques_id"); echo "<form action=\"values.php\" method=\"POST\">"; while($row = mysql_fetch_array($optSQL) ) { $strOptions = $row['options']; $strValues = $row['values']; echo "<input type =\"radio\" name =\"valueIn\" value=".$strValues." />". $strOptions ."<br/>"; } echo "</form>"; $strTitle = "<input type =\"submit\" value=\"Next\">"; $next = $next+1; $strLink = "<a href = 'values.php?ques_id=".$next."'>" . $strTitle ."</a>"; echo $strLink; mysql_close(); ?> and values.php <?php require_once('../connect.php'); $input = $_POST['valueIn']; $ansSQL = mysql_query("SELECT `answer` FROM questions WHERE 1-".$_GET["ques_id"]."= ques_id"); $marks = 0; if($input == $ansSQL) { $marks = $marks+1; } else { $marks = $marks+0; } echo $marks; ?> Now problem is i have to pass one value from second script(questions.php) to third script(values.php). And it is from the <form> section in radio button's name value "valueIn". But I can't do that. Because I'm sending another value ques_id with $strLink variable at the end of the second script. So how can i do that?

    Read the article

  • Best way to program a call to php

    - by hairdresser-101
    I've recently posted here http://stackoverflow.com/questions/2627645/accessing-session-when-using-file-get-contents-in-php about a problem I was having and the general consensus is that I'm not doing it right... while I generally think "as long as it works..." I thought I'd get some feedback on how I could do it better... I was to send the exact same email in the exact same format from multiple different areas. When a job is entered (automatically as a part of the POST) Manually when reviewing jobs to re-assign to another installer The original script is a php page which is called using AJAX to send the work order request - this worked by simply calling a standard php page, returning the success or error message and then displaying within the calling page. Now I have tried to use the same page within the automated job entry so it accepts the job via a form, logs it and mails it. My problem is (as you can see from the original post) the function file_get_contents() is not good for this cause in the automated script... My problem is that from an AJAX call I need to do things like include the database connection initialiser, start the session and do whatever else needs to be done in a standalone page... Some or all of these are not required if it is an include so it makes the file only good for one purpose... How do I make the file good for both purposes? I guess I'm looking for recommendations for the best file layout and structure to cater for both scenarios... The current file looks like: <?php session_start(); $order_id = $_GET['order_id']; include('include/database.php'); function getLineItems($order_id) { $query = mysql_query("SELECT ...lineItems..."); //Print rows with data while($row = mysql_fetch_object($query)) { $lineItems .= '...Build Line Item String...'; } return $lineItems; } function send_email($order_id) { //Get data for current job to display $query = mysql_query("SELECT ...Job Details..."); $row = mysql_fetch_object($query); $subject = 'Work Order Request'; $email_message = '...Build Email... ...Include Job Details... '.getLineItems($order_id).' ...Finish Email...'; $headers = '...Create Email Headers...'; if (mail($row->primary_email, $subject, $email_message, $headers)) { $query = mysql_query("...log successful send..."); if (mysql_error()!="") { $message .= '...display mysqlerror()..'; } $message .= '...create success message...'; } else { $query = mysql_query("...log failed send..."); if (mysql_error()!="") { $message .= '...display mysqlerror()..'; } $message .= '...create failed message...'; } return $message; } // END send_email() function //Check supplier info $query = mysql_query("...get suppliers info attached to order_id..."); if (mysql_num_rows($query) > 0) { while($row = mysql_fetch_object($query)) { if ($row->primary_email=="") { $message .= '...no email message...'; } else if ($row->notification_email=="") { $message .= '...no notifications message...'; } else { $message .= send_email($order_id); } } } else { $message .= '...no supplier matched message...'; } print $message; ?>

    Read the article

  • SQLAuthority News – 1600 Blog Post Articles – A Milestone

    - by pinaldave
    It was really a very interesting moment for me when I was writing my 1600th milestone blog post. Now it`s a lot more exciting because this time it`s my 1600th blog post. Every time I write a milestone blog post such as this, I have the same excitement as when I was writing my very first blog post. Today I want to write about a few statistics of the blog. Statistics I am frequently asked about my blog stats, so I have already published my blog stats which are measured by WordPress.com. Currently, I have more than 22 Million+ Views on this blog from various sources. There are more than 6200+ feed subscribers in Google Reader only; I think I don`t have to count all other subscribers. My LinkedIn has 1250+ connection, while my Twitter has 2150+. Because I feel that I`m well connected with the Community, I am very thankful to you, my readers. Today I also want to say Thank You to those experts who have helped me to improve. I have maintained a list of all the articles I have written. If you go to my first articles, you will notice that they were a little different from the articles I am writing today. The reason for this is simple: I have two kinds of people helping me write all the better: readers and experts. To my Readers You read the articles and gave me feedback about what was right or wrong, what you liked or disliked. Quite often, you were helpful in writing guest posts, and I also recognize how you were a bit brutal in criticizing some articles, making me re-write them. Because of you, I was able to write better blog posts. To Experts You read the articles and helped me improve. I get inspiration from you and learned a lot from you. Just like everybody, I am a guy who is trying to learn. There are times when I had vague understanding of some subjects, and you did not hesitate to help me. Number of Posts Many ask me if the number of posts is important to me. My answer is YES. Actually, it`s just not about the number of my posts; it is about my blog, my routine, my learning experience and my journey. During the last four years, I have decided that I would be learning one thing a day. This blog has helped me accomplish this goal because in here I have been able to keep my notes and bookmarks. Whatever I learn or experience, I blog and share it with the Community. For me, the blog post number is more than just a number: it`s a summary of my experiences and memories. Once again, thanks for reading and supporting my blog! Reference: Pinal Dave (http://blog.SQLAuthority.com) Filed under: About Me, Pinal Dave, PostADay, SQL, SQL Authority, SQL Milestone, SQL Query, SQL Server, SQL Tips and Tricks, SQLAuthority News, SQLServer, T SQL, Technology

    Read the article

  • Parallelism in .NET – Part 9, Configuration in PLINQ and TPL

    - by Reed
    Parallel LINQ and the Task Parallel Library contain many options for configuration.  Although the default configuration options are often ideal, there are times when customizing the behavior is desirable.  Both frameworks provide full configuration support. When working with Data Parallelism, there is one primary configuration option we often need to control – the number of threads we want the system to use when parallelizing our routine.  By default, PLINQ and the TPL both use the ThreadPool to schedule tasks.  Given the major improvements in the ThreadPool in CLR 4, this default behavior is often ideal.  However, there are times that the default behavior is not appropriate.  For example, if you are working on multiple threads simultaneously, and want to schedule parallel operations from within both threads, you might want to consider restricting each parallel operation to using a subset of the processing cores of the system.  Not doing this might over-parallelize your routine, which leads to inefficiencies from having too many context switches. In the Task Parallel Library, configuration is handled via the ParallelOptions class.  All of the methods of the Parallel class have an overload which accepts a ParallelOptions argument. We configure the Parallel class by setting the ParallelOptions.MaxDegreeOfParallelism property.  For example, let’s revisit one of the simple data parallel examples from Part 2: Parallel.For(0, pixelData.GetUpperBound(0), row => { for (int col=0; col < pixelData.GetUpperBound(1); ++col) { pixelData[row, col] = AdjustContrast(pixelData[row, col], minPixel, maxPixel); } }); .csharpcode, .csharpcode pre { font-size: small; color: black; font-family: consolas, "Courier New", courier, monospace; background-color: #ffffff; /*white-space: pre;*/ } .csharpcode pre { margin: 0em; } .csharpcode .rem { color: #008000; } .csharpcode .kwrd { color: #0000ff; } .csharpcode .str { color: #006080; } .csharpcode .op { color: #0000c0; } .csharpcode .preproc { color: #cc6633; } .csharpcode .asp { background-color: #ffff00; } .csharpcode .html { color: #800000; } .csharpcode .attr { color: #ff0000; } .csharpcode .alt { background-color: #f4f4f4; width: 100%; margin: 0em; } .csharpcode .lnum { color: #606060; } Here, we’re looping through an image, and calling a method on each pixel in the image.  If this was being done on a separate thread, and we knew another thread within our system was going to be doing a similar operation, we likely would want to restrict this to using half of the cores on the system.  This could be accomplished easily by doing: var options = new ParallelOptions(); options.MaxDegreeOfParallelism = Math.Max(Environment.ProcessorCount / 2, 1); Parallel.For(0, pixelData.GetUpperBound(0), options, row => { for (int col=0; col < pixelData.GetUpperBound(1); ++col) { pixelData[row, col] = AdjustContrast(pixelData[row, col], minPixel, maxPixel); } }); Now, we’re restricting this routine to using no more than half the cores in our system.  Note that I included a check to prevent a single core system from supplying zero; without this check, we’d potentially cause an exception.  I also did not hard code a specific value for the MaxDegreeOfParallelism property.  One of our goals when parallelizing a routine is allowing it to scale on better hardware.  Specifying a hard-coded value would contradict that goal. Parallel LINQ also supports configuration, and in fact, has quite a few more options for configuring the system.  The main configuration option we most often need is the same as our TPL option: we need to supply the maximum number of processing threads.  In PLINQ, this is done via a new extension method on ParallelQuery<T>: ParallelEnumerable.WithDegreeOfParallelism. Let’s revisit our declarative data parallelism sample from Part 6: double min = collection.AsParallel().Min(item => item.PerformComputation()); Here, we’re performing a computation on each element in the collection, and saving the minimum value of this operation.  If we wanted to restrict this to a limited number of threads, we would add our new extension method: int maxThreads = Math.Max(Environment.ProcessorCount / 2, 1); double min = collection .AsParallel() .WithDegreeOfParallelism(maxThreads) .Min(item => item.PerformComputation()); This automatically restricts the PLINQ query to half of the threads on the system. PLINQ provides some additional configuration options.  By default, PLINQ will occasionally revert to processing a query in parallel.  This occurs because many queries, if parallelized, typically actually cause an overall slowdown compared to a serial processing equivalent.  By analyzing the “shape” of the query, PLINQ often decides to run a query serially instead of in parallel.  This can occur for (taken from MSDN): Queries that contain a Select, indexed Where, indexed SelectMany, or ElementAt clause after an ordering or filtering operator that has removed or rearranged original indices. Queries that contain a Take, TakeWhile, Skip, SkipWhile operator and where indices in the source sequence are not in the original order. Queries that contain Zip or SequenceEquals, unless one of the data sources has an originally ordered index and the other data source is indexable (i.e. an array or IList(T)). Queries that contain Concat, unless it is applied to indexable data sources. Queries that contain Reverse, unless applied to an indexable data source. If the specific query follows these rules, PLINQ will run the query on a single thread.  However, none of these rules look at the specific work being done in the delegates, only at the “shape” of the query.  There are cases where running in parallel may still be beneficial, even if the shape is one where it typically parallelizes poorly.  In these cases, you can override the default behavior by using the WithExecutionMode extension method.  This would be done like so: var reversed = collection .AsParallel() .WithExecutionMode(ParallelExecutionMode.ForceParallelism) .Select(i => i.PerformComputation()) .Reverse(); Here, the default behavior would be to not parallelize the query unless collection implemented IList<T>.  We can force this to run in parallel by adding the WithExecutionMode extension method in the method chain. Finally, PLINQ has the ability to configure how results are returned.  When a query is filtering or selecting an input collection, the results will need to be streamed back into a single IEnumerable<T> result.  For example, the method above returns a new, reversed collection.  In this case, the processing of the collection will be done in parallel, but the results need to be streamed back to the caller serially, so they can be enumerated on a single thread. This streaming introduces overhead.  IEnumerable<T> isn’t designed with thread safety in mind, so the system needs to handle merging the parallel processes back into a single stream, which introduces synchronization issues.  There are two extremes of how this could be accomplished, but both extremes have disadvantages. The system could watch each thread, and whenever a thread produces a result, take that result and send it back to the caller.  This would mean that the calling thread would have access to the data as soon as data is available, which is the benefit of this approach.  However, it also means that every item is introducing synchronization overhead, since each item needs to be merged individually. On the other extreme, the system could wait until all of the results from all of the threads were ready, then push all of the results back to the calling thread in one shot.  The advantage here is that the least amount of synchronization is added to the system, which means the query will, on a whole, run the fastest.  However, the calling thread will have to wait for all elements to be processed, so this could introduce a long delay between when a parallel query begins and when results are returned. The default behavior in PLINQ is actually between these two extremes.  By default, PLINQ maintains an internal buffer, and chooses an optimal buffer size to maintain.  Query results are accumulated into the buffer, then returned in the IEnumerable<T> result in chunks.  This provides reasonably fast access to the results, as well as good overall throughput, in most scenarios. However, if we know the nature of our algorithm, we may decide we would prefer one of the other extremes.  This can be done by using the WithMergeOptions extension method.  For example, if we know that our PerformComputation() routine is very slow, but also variable in runtime, we may want to retrieve results as they are available, with no bufferring.  This can be done by changing our above routine to: var reversed = collection .AsParallel() .WithExecutionMode(ParallelExecutionMode.ForceParallelism) .WithMergeOptions(ParallelMergeOptions.NotBuffered) .Select(i => i.PerformComputation()) .Reverse(); On the other hand, if are already on a background thread, and we want to allow the system to maximize its speed, we might want to allow the system to fully buffer the results: var reversed = collection .AsParallel() .WithExecutionMode(ParallelExecutionMode.ForceParallelism) .WithMergeOptions(ParallelMergeOptions.FullyBuffered) .Select(i => i.PerformComputation()) .Reverse(); Notice, also, that you can specify multiple configuration options in a parallel query.  By chaining these extension methods together, we generate a query that will always run in parallel, and will always complete before making the results available in our IEnumerable<T>.

    Read the article

< Previous Page | 222 223 224 225 226 227 228 229 230 231 232 233  | Next Page >