Search Results

Search found 25585 results on 1024 pages for 'multiple variables'.

Page 231/1024 | < Previous Page | 227 228 229 230 231 232 233 234 235 236 237 238  | Next Page >

  • Hover/Fadeto/Toggle Multiple Class Changing

    - by Slick Willis
    So my problem is rather simple and complex at the same time. I am trying to create links that fade in when you mouseover them and fade out when you mouseout of them. At the same time that you are going over them I would like a pic to slide from the left. This is the easy part, I have every thing working. The image fades and another image slides. I did this by using a hover, fadeto, and toggle("slide"). I would like to do this in a table format with multiple images being able to be scrolled over and sliding images out. The problem is that I am calling my sliding image to a class and when I hover over the letters both images slide out. Does anybody have a solution for this? I posted the code that I used below: <html> <head> <script type='text/javascript' src='http://accidentalwords.squarespace.com/storage/jquery/jquery-1.4.2.min.js'></script> <script type='text/javascript' src='http://accidentalwords.squarespace.com/storage/jquery/jquery-custom-181/jquery-ui-1.8.1.custom.min.js'></script> <style type="text/css"> .text-slide { display: none; margin: 0px; width: 167px; height: 50px; } </style> <script> $(document).ready(function(){ $(".letterbox-fade").fadeTo(1,0.25); $(".letterbox-fade").hover(function () { $(this).stop().fadeTo(250,1); $(".text-slide").toggle("slide", {}, 1000); }, function() { $(this).stop().fadeTo(250,0.25); $(".text-slide").toggle("slide", {}, 1000); }); }); </script> </head> <body style="background-color: #181818"> <table> <tr> <td><div class="letterbox-fade"><img src="http://accidentalwords.squarespace.com/storage/sidebar/icons/A-Letterbox-Selected.png" /></div></td> <td><div class="text-slide"><img src="http://accidentalwords.squarespace.com/storage/sidebar/icons/TEST.png" /></div></td> </tr> <tr> <td><div class="letterbox-fade"><img src="http://accidentalwords.squarespace.com/storage/sidebar/icons/B-Letterbox-Selected.png" /></div></td> <td><div class="text-slide"><img src="http://accidentalwords.squarespace.com/storage/sidebar/icons/TEST.png" /></div></td> </tr> </table> </body> </html>

    Read the article

  • multiple timer to one process (without linking to rt)

    - by Richard
    Hi, is there any way to register multiple timer to a single process? I have tried following code, yet without success. (Use "gcc -lrt" to compile it...). Program output nothing, which should atleast print "test". Is it possibly due to the dependence to linking to rt? #define TT_SIGUSR1 (SIGRTMAX) #define TT_SIGUSR2 (SIGRTMAX - 1) #define TIME_INTERVAL_1 1 #define TIME_INTERVAL_2 2 #include <signal.h> #include <time.h> #include <stdio.h> #include <unistd.h> #include <linux/unistd.h> #include <sys/syscall.h> #include <sys/time.h> #include <sys/types.h> #include <sched.h> #include <signal.h> #include <setjmp.h> #include <errno.h> #include <assert.h> timer_t create_timer(int signo) { timer_t timerid; struct sigevent se; se.sigev_signo = signo; if (timer_create(CLOCK_REALTIME, &se, &timerid) == -1) { fprintf(stderr, "Failed to create timer\n"); exit(-1); } return timerid; } void set_timer(timer_t timerid, int seconds) { struct itimerspec timervals; timervals.it_value.tv_sec = seconds; timervals.it_value.tv_nsec = 0; timervals.it_interval.tv_sec = seconds; timervals.it_interval.tv_nsec = 0; if (timer_settime(timerid, 0, &timervals, NULL) == -1) { fprintf(stderr, "Failed to start timer\n"); exit(-1); } return; } void install_sighandler2(int signo, void(*handler)(int)) { struct sigaction sigact; sigemptyset(&sigact.sa_mask); sigact.sa_flags = SA_SIGINFO; //register the Signal Handler sigact.sa_sigaction = handler; // Set up sigaction to catch signal first timer if (sigaction(signo, &sigact, NULL) == -1) { printf("sigaction failed"); return -1; } } void install_sighandler(int signo, void(*handler)(int)) { sigset_t set; struct sigaction act; /* Setup the handler */ act.sa_handler = handler; act.sa_flags = SA_RESTART; sigaction(signo, &act, 0); /* Unblock the signal */ sigemptyset(&set); sigaddset(&set, signo); sigprocmask(SIG_UNBLOCK, &set, NULL); return; } void signal_handler(int signo) { printf("receiving sig %d", signo); } int main() { printf("test"); timer_t timer1 = create_timer(TT_SIGUSR1); timer_t timer2 = create_timer(TT_SIGUSR2); set_timer(timer1, TIME_INTERVAL_1); set_timer(timer2, TIME_INTERVAL_2); install_sighandler2(TT_SIGUSR1, signal_handler); install_sighandler(TT_SIGUSR2, signal_handler); while (1) ; return 0; }

    Read the article

  • PHP-How to Pass Multiple Value In Form Field

    - by Tall boY
    hi i have a php based sorting method with drop down menu to sort no of rows, it is working fine. i have another sorting links to sort id & title, it is also working fine. but together they are not working fine. what happens is that when i sort(say by title) using links, result gets sorted by title, then if i sort rows using drop down menu rows get sorted but result gets back to default of id sort. sorting codes for id & tite is if ($orderby == 'title' && $sortby == 'asc') {echo " <li id='scurrent'><a href='?rpp=$rowsperpage&order=title&sort=asc'>title-asc:</a></li> ";} else {echo " <li><a href='?rpp=$rowsperpage&order=title&sort=asc'>title-asc:</a></li> ";} if ($orderby == 'title' && $sortby == 'desc') {echo " <li id='scurrent'><a href='?rpp=$rowsperpage&order=title&sort=desc'>title-desc:</a></li> ";} else {echo " <li><a href='?rpp=$rowsperpage&order=title&sort=desc'>title-desc:</a></li> ";} if ($orderby == 'id' && $sortby == 'asc') {echo " <li id='scurrent'><a href='?rpp=$rowsperpage&order=id&sort=asc'>id-asc:</a></li> ";} else {echo " <li><a href='?rpp=$rowsperpage&order=id&sort=asc'>id-asc:</a></li> ";} if ($orderby == 'id' && $sortby == 'desc') {echo " <li id='scurrent'><a href='?rpp=$rowsperpage&order=id&sort=desc'>id-desc:</a></li> ";} else {echo " <li><a href='?rpp=$rowsperpage&order=id&sort=desc'>id-desc:</a></li> ";} ?> sorting codes for rows is <form action="is-test.php" method="get"> <select name="rpp" onchange="this.form.submit()"> <option value="10" <?php if ($rowsperpage == 10) echo 'selected="selected"' ?>>10</option> <option value="20" <?php if ($rowsperpage == 20) echo 'selected="selected"' ?>>20</option> <option value="30" <?php if ($rowsperpage == 30) echo 'selected="selected"' ?>>30</option> </select> </form> this method passes only rows per page(rpp) into url. i want it to pass order, sort& rpp. is there a way around to pass multiple values in form fields like this. <form action="is-test.php" method="get"> <select name="rpp, order, sort" onchange="this.form.submit()"> <option value="10, $orderby, $sortby" <?php if ($rowsperpage == 10) echo 'selected="selected"' ?>>10</option> <option value="20, $orderby, $sortby" <?php if ($rowsperpage == 20) echo 'selected="selected"' ?>>20</option> <option value="30, $orderby, $sortby" <?php if ($rowsperpage == 30) echo 'selected="selected"' ?>>30</option> </select> </form> this may seem silly but it just to give you an idea of what i am trying to implement,(i am very new to php) please suggest any way to make this work. thanks

    Read the article

  • NoMethodError Rails multiple file uploads

    - by Danny McClelland
    Hi Everyone, I am working on getting multiple file uploads working for an model in my application, I have included the code below: delivers_controller.rb # POST /delivers def create @deliver = Deliver.new(params[:deliver]) process_file_uploads(@deliver) if @deliver.save flash[:notice] = 'Task was successfully created.' redirect_to(@deliver) else render :action => "new" end end protected def process_file_uploads(deliver) i = 0 while params[:attachment]['file_'+i.to_s] != "" && !params[:attachment]['file_'+i.to_s].nil? deliver.assets.build(:data => params[:attachment]['file_'+i.to_s]) i += 1 end end deliver.rb has_many :assets, :as => :attachable, :dependent => :destroy validate :validate_attachments Max_Attachments = 5 Max_Attachment_Size = 5.megabyte def validate_attachments errors.add_to_base("Too many attachments - maximum is #{Max_Attachments}") if assets.length > Max_Attachments assets.each {|a| errors.add_to_base("#{a.name} is over #{Max_Attachment_Size/1.megabyte}MB") if a.file_size > Max_Attachment_Size} end assets_controller.rb class AssetsController < ApplicationController def show asset = Asset.find(params[:id]) # do security check here send_file asset.data.path, :type => asset.data_content_type end def destroy asset = Asset.find(params[:id]) @asset_id = asset.id.to_s @allowed = Deliver::Max_Attachments - asset.attachable.assets.count asset.destroy end end asset.rb class Asset < ActiveRecord::Base has_attached_file :data, belongs_to :attachable, :polymorphic => true def url(*args) data.url(*args) end def name data_file_name end def content_type data_content_type end def file_size data_file_size end end Whenever I create a new deliver item and try to attach any files I get the following error: NoMethodError in DeliversController#create You have a nil object when you didn't expect it! You might have expected an instance of ActiveRecord::Base. The error occurred while evaluating nil.[] /Users/danny/Dropbox/SVN/railsapps/macandco/surveymanager/trunk/app/controllers/delivers_controller.rb:60:in `process_file_uploads' /Users/danny/Dropbox/SVN/railsapps/macandco/surveymanager/trunk/app/controllers/delivers_controller.rb:46:in `create' new.html.erb (Deliver view) <% content_for :header do -%> Deliver Repositories <% end -%> <% form_for(@deliver, :html => { :multipart => true }) do |f| %> <%= f.error_messages %> <p> <%= f.label :caseref %><br /> <%= f.text_field :caseref %> </p> <p> <%= f.label :casesubject %><br /> <%= f.text_area :casesubject %> </p> <p> <%= f.label :description %><br /> <%= f.text_area :description %> </p> <p>Pending Attachments: (Max of <%= Deliver::Max_Attachments %> each under <%= Deliver::Max_Attachment_Size/1.megabyte%>MB) <% if @deliver.assets.count >= Deliver::Max_Attachments %> <input id="newfile_data" type="file" disabled /> <% else %> <input id="newfile_data" type="file" /> <% end %> <div id="attachment_list"><ul id="pending_files"></ul></div> </p> <p> <%= f.submit 'Create' %> </p> <% end %> <%= link_to 'Back', delivers_path %> Show.html.erb (Delivers view) <% content_for :header do -%> Deliver Repositories <% end -%> <p> <b>Title:</b> <%=h @deliver.caseref %> </p> <p> <b>Body:</b> <%=h @deliver.casesubject %> </p> <p><b>Attached Files:</b><div id="attachment_list"><%= render :partial => "attachment", :collection => @deliver.assets %></div></p> <%= link_to 'Edit', edit_deliver_path(@deliver) %> | <%= link_to 'Back', deliver_path %> <%- if logged_in? %> <%= link_to 'Edit', edit_deliver_path(@deliver) %> | <%= link_to 'Back', delivers_path %> <% end %> _attachment.html.erb (Delivers view) <% if !attachment.id.nil? %><li id='attachment_<%=attachment.id %>'><a href='<%=attachment.url %>'><%=attachment.name %></a> (<%=attachment.file_size/1.kilobyte %>KB) <%= link_to_remote "Remove", :url => asset_path(:id => attachment), :method => :delete, :html => { :title => "Remove this attachment", :id => "remove" } %></li> <% end %> I have been banging my head against the wall with the error all day, if anyone can shed some light on it, I would be eternally grateful! Thanks, Danny

    Read the article

  • How to publish multiple jar files to maven on a clean install

    - by Abhijit Hukkeri
    I have a used the maven assembly plugin to create multiple jar from one jar now the problem is that I have to publish these jar to the local repo, just like other maven jars publish by them self when they are built maven clean install how will I be able to do this here is my pom file <project> <parent> <groupId>parent.common.bundles</groupId> <version>1.0</version> <artifactId>child-bundle</artifactId> </parent> <modelVersion>4.0.0</modelVersion> <groupId>common.dataobject</groupId> <artifactId>common-dataobject</artifactId> <packaging>jar</packaging> <name>common-dataobject</name> <version>1.0</version> <dependencies> </dependencies> <build> <plugins> <plugin> <groupId>org.jibx</groupId> <artifactId>maven-jibx-plugin</artifactId> <version>1.2.1</version> <configuration> <directory>src/main/resources/jibx_mapping</directory> <includes> <includes>binding.xml</includes> </includes> <verbose>false</verbose> </configuration> <executions> <execution> <goals> <goal>bind</goal> </goals> </execution> </executions> </plugin> <plugin> <artifactId>maven-assembly-plugin</artifactId> <executions> <execution> <id>make-business-assembly</id> <phase>package</phase> <goals> <goal>single</goal> </goals> <configuration> <appendAssemblyId>false</appendAssemblyId> <finalName>flight-dto</finalName> <descriptors> <descriptor>src/main/assembly/car-assembly.xml</descriptor> </descriptors> <attach>true</attach> </configuration> </execution> <execution> <id>make-gui-assembly</id> <phase>package</phase> <goals> <goal>single</goal> </goals> <configuration> <appendAssemblyId>false</appendAssemblyId> <finalName>app_gui</finalName> <descriptors> <descriptor>src/main/assembly/bike-assembly.xml</descriptor> </descriptors> <attach>true</attach> </configuration> </execution> </executions> </plugin> </plugins> </build> </project> Here is my assembly file <assembly> <id>app_business</id> <formats> <format>jar</format> </formats> <baseDirectory>target</baseDirectory> <includeBaseDirectory>false</includeBaseDirectory> <fileSets> <fileSet> <directory>${project.build.outputDirectory}</directory> <outputDirectory></outputDirectory> <includes> <include>com/dataobjects/**</include> </includes> </fileSet> </fileSets> </assembly>

    Read the article

  • Searching a set of data with multiple terms using Linq

    - by Cj Anderson
    I'm in the process of moving from ADO.NET to Linq. The application is a directory search program to look people up. The users are allowed to type the search criteria into a single textbox. They can separate each term with a space, or wrap a phrase in quotes such as "park place" to indicate that it is one term. Behind the scenes the data comes from a XML file that has about 90,000 records in it and is about 65 megs. I load the data into a DataTable and then use the .Select method with a SQL query to perform the searches. The query I pass is built from the search terms the user passed. I split the string from the textbox into an array using a regular expression that will split everything into a separate element that has a space in it. However if there are quotes around a phrase, that becomes it's own element in the array. I then end up with a single dimension array with x number of elements, which I iterate over to build a long query. I then build the search expression below: query = query & _ "((userid LIKE '" & tempstr & "%') OR " & _ "(nickname LIKE '" & tempstr & "%') OR " & _ "(lastname LIKE '" & tempstr & "%') OR " & _ "(firstname LIKE '" & tempstr & "%') OR " & _ "(department LIKE '" & tempstr & "%') OR " & _ "(telephoneNumber LIKE '" & tempstr & "%') OR " & _ "(email LIKE '" & tempstr & "%') OR " & _ "(Office LIKE '" & tempstr & "%'))" Each term will have a set of the above query. If there is more than one term, I put an AND in between, and build another query like above with the next term. I'm not sure how to do this in Linq. So far, I've got the XML file loading correctly. I'm able to search it with specific criteria, but I'm not sure how to best implement the search over multiple terms. 'this works but far too simple to get the job done Dim results = From c In m_DataSet...<Users> _ Where c.<userid>.Value = "XXXX" _ Select c The above code also doesn't use the LIKE operator either. So partial matches don't work. It looks like what I'd want to use is the .Startswith but that appears to be only in Linq2SQL. Any guidance would be appreciated. I'm new to Linq, so I might be missing a simple way to do this. The XML file looks like so: <?xml version="1.0" standalone="yes"?> <theusers> <Users> <userid>person1</userid> <nickname></nickname> <lastname></lastname> <firstname></firstname> <department></department> <telephoneNumber></telephoneNumber> <email></email> </Users> <Users> <userid>person2</userid> <nickname></nickname> <lastname></lastname> <firstname></firstname> <department></department> <telephoneNumber></telephoneNumber> <email></email> </Users>

    Read the article

  • Multiple schema validation in Java

    - by user279554
    Hi, I am trying to do multiple schema validation in Java. I don't understand where I am doing wrong. Any help will be appreciated. abc.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:xn="project-xml-r4j_another.xsd"> <xsd:import namespace="project-xml-r4j_another.xsd"/> <xsd:element name="abc" type="abc"> </xsd:element> <xsd:complexType name="abc"> <xsd:sequence> <xsd:element name="test" type="test" minOccurs="0" maxOccurs="1"> </xsd:element> <!--<xsd:element name="proj" type="xn:proj"/>--> </xsd:sequence> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> <xsd:complexType name="test"> <xsd:attribute name="id" type="xsd:ID" use="required"></xsd:attribute> <xsd:attribute name="value" use="required"> <xsd:simpleType> <xsd:restriction base="xsd:string"> <xsd:maxLength value="100" /> </xsd:restriction> </xsd:simpleType> </xsd:attribute> </xsd:complexType> </xsd:schema> project-xml-r4j_another.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" targetNamespace="project-xml-r4j_another.xsd" xmlns="project-xml-r4j_another.xsd" elementFormDefault="qualified" attributeFormDefault="unqualified"> <xsd:element name="proj" type="proj"> <xsd:annotation> <xsd:documentation> The project is the root tag of a project-xml. </xsd:documentation> </xsd:annotation> </xsd:element> <xsd:complexType name="proj"> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> </xsd:schema> Test case package test; import java.io.File; import java.io.IOException; import javax.xml.XMLConstants; import javax.xml.transform.Source; import javax.xml.transform.stream.StreamSource; import javax.xml.validation.Schema; import javax.xml.validation.SchemaFactory; import javax.xml.validation.Validator; import org.apache.log4j.Logger; import org.junit.Test; import org.xml.sax.SAXException; import org.xml.sax.SAXParseException; import org.xml.sax.helpers.DefaultHandler; import com.ericsson.ccrtool.core.project.projectxml.InvalidProjectXmlException; public class TestSchema { private static final Logger logger = Logger.getLogger(TestSchema.class); static final String W3C_XML_SCHEMA = XMLConstants.W3C_XML_SCHEMA_NS_URI; @Test public void test() { System.out.println("TestSchema.test()"); try { SchemaFactory schemaFactory = SchemaFactory.newInstance(W3C_XML_SCHEMA); // create a grammar object. Source [] source = { new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\abc.xsd")), new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\project-xml-r4j.xsd"))}; Schema schemaGrammar = schemaFactory.newSchema(source); Validator schemaValidator = schemaGrammar.newValidator(); schemaValidator.setErrorHandler(new MessageHandler()); // validate xml instance against the grammar. schemaValidator.validate(new StreamSource("C:\\jaydeep\\Ericsson\\R5B\\project_tmmk17cells_xnaveen_project-xml.xml")); } catch (SAXException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } catch (IOException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } } class MessageHandler extends DefaultHandler { private String errMessage = ""; @Override public void warning(SAXParseException e) { logger.info("Warning Line " + e.getLineNumber() + ": " + e.getMessage()); } @Override public void error(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } @Override public void fatalError(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } } } Thanks, Jaydeep

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Android Multiple objects in SimpleAdapter

    - by Adam Sherratt
    I have a need (unless you can think of a better way) of passing multiple objects to a custom list adapter. I know that I'm barking up the wrong tree here, and would appreciate someone setting me on the right course! Thanks playlistadapter = new MyPlaylistAdapter(MyApplication.getAppContext(), songsList, retained_songsList, folderMode, R.layout.file_view, new String[] { "songTitle","songAlbum", "songPath" }, new int[] { R.id.checkTextView, R.id.text2, R.id.text3 }); And my adapter class: public class MyPlaylistAdapter extends SimpleAdapter{ private ArrayList <Song> songsList = new ArrayList<Song>(); private ArrayList <Song> retained_songsList = new ArrayList<Song>(); private ArrayList<Song> playlistcheck = new ArrayList<Song>(); private String folderMode; private String TAG = "AndroidMediaCenter"; public MyPlaylistAdapter(Context context,List<Song> SongsList, List<Song> Retained_songsList, String FolderMode,int resource, String[] from, int[] to) { super(context, null, resource, from, to); songsList.clear(); songsList.addAll(SongsList); Log.i(TAG, "MyPlayListAdapter Songslist = " + songsList.size()); retained_songsList.clear(); retained_songsList.addAll(Retained_songsList); folderMode = FolderMode; } public View getView(int position, View convertView, ViewGroup parent) { //PlayListViewHolder holder; CheckedTextView checkTextView; TextView text2; TextView text3; if (convertView == null) { LayoutInflater inflater = (LayoutInflater) MyApplication.getAppContext().getSystemService(Context.LAYOUT_INFLATER_SERVICE); //LayoutInflater inflater=getLayoutInflater(); convertView=inflater.inflate(R.layout.file_view, parent, false); //convertView.setBackgroundColor(0xFF00FF00 ); //holder = new PlayListViewHolder(); checkTextView = (CheckedTextView) convertView.findViewById(R.id.checkTextView); text2 = (TextView) convertView.findViewById(R.id.text2); text3 = (TextView) convertView.findViewById(R.id.text3); //convertView.setTag(holder); } else { //holder = (PlayListViewHolder) convertView.getTag(); } //put something into textviews String tracks = null; String tracks_Details = null; String trackspath = null; tracks = songsList.get(position).getSongTitle(); tracks_Details = songsList.get(position).getAlbum() + " (" + songsList.get(position).getArtist() + ")"; trackspath = songsList.get(position).getSongPath(); checkTextView = (CheckedTextView) convertView.findViewById(R.id.checkTextView); text2 = (TextView) convertView.findViewById(R.id.text2); text3 = (TextView) convertView.findViewById(R.id.text3); checkTextView.setText(tracks); if(folderMode.equals("Playlists")){ checkTextView.setBackgroundColor(Color.GREEN); checkTextView.setChecked(false); try { int listsize_rs = retained_songsList.size(); for (int j = 0; j<listsize_rs;j++){ if((retained_songsList.get(j).getSongPath()).equals(songsList.get(position).getSongPath())){ checkTextView.setBackgroundColor(Color.TRANSPARENT); //Need to check here whether the checkedtextview is ticked or not checkTextView.setChecked(true); playlistcheck.add(songsList.get(position)); break; } } } catch (Exception e) { e.printStackTrace(); } }else { //Need to check here whether the checkedtextview is ticked or not try { if (songsList.get(position).getSongCheckedStatus()==true){ checkTextView.setChecked(true); }else{ checkTextView.setChecked(false); } } catch (Exception e) { e.printStackTrace(); } } text2.setText(tracks_Details); text3.setText(trackspath); Log.i(TAG, "MyPlayListAdapter Songslist = " + songsList.size()); return convertView; } } However, this doesn't inflate, throwing the following errors: 10-26 23:11:09.464: E/AndroidRuntime(2826): FATAL EXCEPTION: main 10-26 23:11:09.464: E/AndroidRuntime(2826): java.lang.RuntimeException: Error receiving broadcast Intent { act=android.intent.action.GetMusicComplete flg=0x10 } in com.Nmidia.AMC.MusicActivity$18@414c5770 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.app.LoadedApk$ReceiverDispatcher$Args.run(LoadedApk.java:765) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.os.Handler.handleCallback(Handler.java:615) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.os.Handler.dispatchMessage(Handler.java:92) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.os.Looper.loop(Looper.java:137) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.app.ActivityThread.main(ActivityThread.java:4745) 10-26 23:11:09.464: E/AndroidRuntime(2826): at java.lang.reflect.Method.invokeNative(Native Method) 10-26 23:11:09.464: E/AndroidRuntime(2826): at java.lang.reflect.Method.invoke(Method.java:511) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:786) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:553) 10-26 23:11:09.464: E/AndroidRuntime(2826): at dalvik.system.NativeStart.main(Native Method) 10-26 23:11:09.464: E/AndroidRuntime(2826): Caused by: java.lang.NullPointerException 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.widget.SimpleAdapter.getCount(SimpleAdapter.java:93) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.widget.ListView.setAdapter(ListView.java:460) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.Nmidia.AMC.MusicActivity.setFilterMusic(MusicActivity.java:1230) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.Nmidia.AMC.MusicActivity$18.onReceive(MusicActivity.java:996) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.app.LoadedApk$ReceiverDispatcher$Args.run(LoadedApk.java:755) 10-26 23:11:09.464: E/AndroidRuntime(2826): ... 9 more

    Read the article

  • How can I use curl to login multiple users from one php script

    - by kamal
    Here is the scenario: I have configured multiple users with login names aa1, aa2 .. zz99 , all with the same password, now i want to login to a php based server with these login ID's. I have a working script that logs in one user with a username and password, and using curl, browses to a target page: // Assume php , since somehow the php encapsulation quotes were giving me trouble $sHost = $argv[2]; $sStart = $argv[3]; $sReqId = $argv[4]; $sPage = $argv[5]; $sReqLogFile = $argv[6]; $sRespLogFile = $argv[7]; $sUserName = $argv[8]; $sPassword = $argv[9]; $sExecDelay = $argv[10]; //optional args: if($argc 11) { $sCommonSID = $argv[11]; } //$sXhprofLogFile = ""; $sSysStatsLogFile= ""; $sBaseUrl = 'https://'.$sHost.'/'; $nExecTime = 0; $sCookieFileName = 'cookiejar/'.genRandomString().'.txt'; touch($sCookieFileName); // Set the execution delay: $sStart += $sExecDelay; // Get the PHP Session Id: if(isset($sCommonSID)) { $sSID = $sCommonSID; }else{ $sSID = getSID($sHost,$sBaseUrl, $sUserName, $sPassword); } // Sleep for 100us intervals until we reach the stated execution time: do { usleep(100); }while(getFullMicrotime()$sPage, "pageUrl"=$sBaseUrl, "execStart" =$nExecStart, "execEnd"=$nExecEnd, "respTime"=$nExecTime, "xhprofToken"=$sXhpToken, "xhprofLink"=$sXhpLink, "fiveMinLoad"=$nFiveMinLoad); }else{ $nExecStart = 0; $sUrl = "***ERROR***"; $aReturn = null; } writeReqLog($sReqId, $nExecStart, $sSID, $sUrl, $sReqLogFile); return $aReturn; } function getFullMicrotime() { $fMtime = microtime(true); if(strpos($fMtime, ' ') !== false) { list($nUsec, $nSec) = explode(' ', $fMtime); return $nSec + $nUsec; } return $fMtime; } function writeRespLog($nReqId, $sHost, $sPage, $sSID = "***ERROR***", $nExecStart = 0, $nExecEnd = 0, $nRespTime = 0, $sXhpToken = "", $sXhpLink = "", $nFiveMinLoad = 0, $sRespLogFile) { $sMsg = $nReqId; $sMsg .= "\t".$sHost; $sMsg .= "/".$sPage; $sMsg .= "\t".$sSID; $sMsg .= "\t".$nExecStart; $sMsg .= "\t".$nExecEnd; $sMsg .= "\t".$nRespTime; $sMsg .= "\t".$sXhpToken; $sMsg .= "\t".$nFiveMinLoad; error_log($sMsg."\n",3,$sRespLogFile); } function writeReqLog($nReqId, $nExecStart, $sSID, $sUrl, $sReqLogFile) { $sMsg = $nReqId; $sMsg .= "\t".$sUrl; $sMsg .= "\t".$sSID; $sMsg .= "\t".$nExecStart; error_log($sMsg."\n",3,$sReqLogFile); } function parseSIDValue($sText) { $sSID = ""; preg_match('/SID:(.*)/',$sText, $aSID); if (count($aSID)) { $sSID = $aSID[1]; } return $sSID; } function parseFiveMinLoad($sText) { $nLoad = 0; $aMatch = array(); preg_match('/--5-MIN-LOAD:(.*)--/',$sText, $aMatch); if (count($aMatch)) { $nLoad = $aMatch[1]; } return $nLoad; } function curlRequest($sUrl, $sSID="") { global $sCookieFileName; $ch = curl_init(); curl_setopt($ch, CURLOPT_URL, $sUrl); curl_setopt($ch, CURLOPT_SSL_VERIFYPEER, FALSE); curl_setopt($ch, CURLOPT_SSL_VERIFYHOST, 2); curl_setopt($ch, CURLOPT_HEADER, 1); curl_setopt($ch, CURLOPT_USERAGENT, "Mozilla/4.0 (compatible; MSIE 6.0; Windows NT 5.0)"); curl_setopt($ch, CURLOPT_RETURNTRANSFER,1); if($sSID == "") { curl_setopt($ch, CURLOPT_COOKIEJAR, $sCookieFileName); } else { curl_setopt($ch, CURLOPT_COOKIEFILE, $sCookieFileName); } $result =curl_exec ($ch); curl_close ($ch); return $result; } function parseXHProfToken($sPageContent) { //https://ktest.server.net/xhprof/xhprof_html/index.php?run=4d004b280a990&source=mybox $sToken = ""; $sRelLink = ""; $aMatch = array(); $aResp = array(); preg_match('/$sToken, "relLink"=$sRelLink); return $aResp; } function genRandomString() { $length = 10; $characters = '0123456789abcdefghijklmnopqrstuvwxyz'; $string = ''; for ($p = 0; $p

    Read the article

  • Send mail to multiple recipient

    - by Ahmad Maslan
    Hi, i have already research on using the mail() to send to multiple recipient's but i just cant get it to work. What im trying to do is, for every order that i have, order 1,2,3, each having their own email addresses, when i change their order status from pending to confirm, the mail() will use that id to refer to the db table and send the email of those 3 orders. But for my case, it mailed just the latest order which is order 3. This is the form that i use to change the order status. <form action="results-action" method="post" enctype="multipart/form-data"> <fieldset> <table id ="table_id" class="display"> <thead> <tr><td><h2>Pending Order</h2></td></tr> <tr> <th scope="col">Order ID</th> <th scope="col"> </th> <th scope="col">Name</th> <th scope="col">Address</th> <th scope="col">Product Name</th> <th scope="col">Produt Quantity</th> <th scope="col">Price</th> <th scope="col">Order status</th> </tr> </thead> <tbody> <?php while ($row = mysqli_fetch_array($result)) { ?> <tr> <td><input type="text" value='<?=$row['virtuemart_order_id']?>' name="orderid" id="virtuemart_order_id"></td> <td><input type="hidden" value='<?=$row['virtuemart_product_id']?>' name="productid" id="virtuemart_product_id"></td> <td><?=$row['first_name']?></td> <td><?=$row['address_1']?></td> <td><?=$row['order_item_name']?></td> <td><?=$row['product_quantity']?></td> <td><?=$row['product_final_price'] ?></td> <td><select name='change[<?=$row['virtuemart_order_id']?>]'> <option value='C'> Confirmed</option> <option value='X'> Cancelled</option></select></td> </tr> <?php } ?> </tbody> </table> </fieldset> <fieldset> <table> <tr> <td><input type="submit" value="Update status" name="update status"> </td> </tr> </table> </fieldset> </form> This is the php, using the order id from the form to select the email addresses. <?php $orderid = $_POST['orderid']; // build SQL statement to select email addresses $query3 = "SELECT email from ruj3d_virtuemart_order_userinfos where virtuemart_order_id = '$orderid'"; // execute SQL statement $result3 = mysqli_query($link, $query3) or die(mysqli_error($link)); $subject = "Order confirmed by Home and decor"; $message = "Hello! This is a message to inform that your order has been confirmed"; $from = "[email protected]"; $headers = "From: $from"; while($row3 = mysqli_fetch_array($result3)){ $addresses[] = $row3['email']; } $to = implode(",", $addresses); mail($to, $subject, $message, $headers); ?>

    Read the article

  • Changing multiple objects with a new class name using Jquery

    - by liquilife
    I'd like to click on a trigger and show a specific image. There are multiple triggers which would show a specific image related to it within a set. There are 4 sets The challenge for me is toggling the other images to hide only in this 'set' when one of these triggers are clicked, as there can only be one image showing at a time in each set. Here is the HTML I've put together thus far: <!-- Thumbnails which can be clicked on to toggle the larger preview image --> <div class="materials"> <a href="javascript:;" id="shirtgrey"><img src="/grey_shirt.png" height="122" width="122" /></a> <a href="javascript:;" id="shirtred"><img src="red_shirt.png" height="122" width="122" /></a> <a href="javascript:;" id="shirtblue"><img src="hblue_shirt.png" height="122" width="122" /></a> <a href="javascript:;" id="shirtgreen"><img src="green_shirt.png" height="122" width="122" /></a> </div> <div class="collars"> <a href="javascript:;" id="collargrey"><img src="grey_collar.png" height="122" width="122" /></a> <a href="javascript:;" id="collarred"><img src="red_collar.png" height="122" width="122" /></a> <a href="javascript:;" id="collarblue"><img src="blue_collar.png" height="122" width="122" /></a> <a href="javascript:;" id="collargreen"><img src="green_collar.png" height="122" width="122" /></a> </div> <div class="cuffs"> <a href="javascript:;" id="cuffgrey"><img src="grey_cuff.png" height="122" width="122" /></a> <a href="javascript:;" id="cuffred"><img src="red_cuff.png" height="122" width="122" /></a> <a href="javascript:;" id="cuffblue"><img src="blue_cuff.png" height="122" width="122" /></a> <a href="javascript:;" id="cuffgreen"><img src="/green_cuff.png" height="122" width="122" /></a> </div> <div class="pockets"> <a href="javascript:;" id="pocketgrey"><img src="grey_pocket.png" height="122" width="122" /></a> <a href="javascript:;" id="pocketred"><img src=".png" height="122" width="122" /></a> <a href="javascript:;" id="pocketblue"><img src="blue_pocket.png" height="122" width="122" /></a> <a href="javascript:;" id="pocketgreen"><img src="green_pocket.png" height="122" width="122" /></a> </div> <!-- The larger images where one from each set should be viewable at one time, triggered by the thumb clicked above --> <div class="selectionimg"> <div class="selectShirt"> <img src="grey_shirt.png" height="250" width="250" class="selectShirtGrey show" /> <img src="red_shirt.png" height="250" width="250" class="selectShirtRed hide" /> <img src="blue_shirt.png" height="250" width="250" class="selectShirtBlue hide" /> <img src="green_shirt.png" height="250" width="250" class="selectShirtGreen hide" /> </div> <div class="selectCollar"> <img src="grey_collar.png" height="250" width="250" class="selectCollarGrey show" /> <img src="red_collar.png" height="250" width="250" class="selectCollarRed hide" /> <img src="blue_collar.png" height="250" width="250" class="selectCollarBlue hide" /> <img src="green_collar.png" height="250" width="250" class="selectCollarGreen hide" /> </div> <div class="selectCuff"> <img src="grey_cuff.png" height="250" width="250" class="selectCuffGrey show" /> <img src="red_cuff.png" height="250" width="250" class="selectCuffRed hide" /> <img src="blue_cuff.png" height="250" width="250" class="selectCuffBlue hide" /> <img src="green_cuff.png" height="250" width="250" class="selectCuffGreen hide" /> </div> <div class="selectPocket"> <img src="grey_pocket.png" height="250" width="250" class="selectPocketGrey show" /> <img src="hred_pocket.png" height="250" width="250" class="selectPocketRed hide" /> <img src="blue_pocket.png" height="250" width="250" class="selectPocketBlue hide" /> <img src="green_pocket.png" height="250" width="250" class="selectPocketGreen hide" /> </div> </div> How can jQuery be used to change a class of an image to "show" and ensure that all other images in that same div are set to a class of "hide"? First time posting here. I'm very efficient with HTML and CSS and have a basic understanding of jQuery. I'm learning and this just seems a little bit beyond my abilities at the moment. I hope this all makes sense. Thanks for any help.

    Read the article

  • Error "Input length must be multiple of 8 when decrypting with padded cipher"

    - by Ross Peoples
    I am trying to move a project from C# to Java for a learning exercise. I am still very new to Java, but I have a TripleDES class in C# that encrypts strings and returns a string value of the encrypted byte array. Here is my C# code: using System; using System.IO; using System.Collections.Generic; using System.Security.Cryptography; using System.Text; namespace tDocc.Classes { /// <summary> /// Triple DES encryption class /// </summary> public static class TripleDES { private static byte[] key = { 110, 32, 73, 24, 125, 66, 75, 18, 79, 150, 211, 122, 213, 14, 156, 136, 171, 218, 119, 240, 81, 142, 23, 4 }; private static byte[] iv = { 25, 117, 68, 23, 99, 78, 231, 219 }; /// <summary> /// Encrypt a string to an encrypted byte array /// </summary> /// <param name="plainText">Text to encrypt</param> /// <returns>Encrypted byte array</returns> public static byte[] Encrypt(string plainText) { UTF8Encoding utf8encoder = new UTF8Encoding(); byte[] inputInBytes = utf8encoder.GetBytes(plainText); TripleDESCryptoServiceProvider tdesProvider = new TripleDESCryptoServiceProvider(); ICryptoTransform cryptoTransform = tdesProvider.CreateEncryptor(key, iv); MemoryStream encryptedStream = new MemoryStream(); CryptoStream cryptStream = new CryptoStream(encryptedStream, cryptoTransform, CryptoStreamMode.Write); cryptStream.Write(inputInBytes, 0, inputInBytes.Length); cryptStream.FlushFinalBlock(); encryptedStream.Position = 0; byte[] result = new byte[encryptedStream.Length]; encryptedStream.Read(result, 0, (int)encryptedStream.Length); cryptStream.Close(); return result; } /// <summary> /// Decrypt a byte array to a string /// </summary> /// <param name="inputInBytes">Encrypted byte array</param> /// <returns>Decrypted string</returns> public static string Decrypt(byte[] inputInBytes) { UTF8Encoding utf8encoder = new UTF8Encoding(); TripleDESCryptoServiceProvider tdesProvider = new TripleDESCryptoServiceProvider(); ICryptoTransform cryptoTransform = tdesProvider.CreateDecryptor(key, iv); MemoryStream decryptedStream = new MemoryStream(); CryptoStream cryptStream = new CryptoStream(decryptedStream, cryptoTransform, CryptoStreamMode.Write); cryptStream.Write(inputInBytes, 0, inputInBytes.Length); cryptStream.FlushFinalBlock(); decryptedStream.Position = 0; byte[] result = new byte[decryptedStream.Length]; decryptedStream.Read(result, 0, (int)decryptedStream.Length); cryptStream.Close(); UTF8Encoding myutf = new UTF8Encoding(); return myutf.GetString(result); } /// <summary> /// Decrypt an encrypted string /// </summary> /// <param name="text">Encrypted text</param> /// <returns>Decrypted string</returns> public static string DecryptText(string text) { if (text == "") { return text; } return Decrypt(Convert.FromBase64String(text)); } /// <summary> /// Encrypt a string /// </summary> /// <param name="text">Unencrypted text</param> /// <returns>Encrypted string</returns> public static string EncryptText(string text) { if (text == "") { return text; } return Convert.ToBase64String(Encrypt(text)); } } /// <summary> /// Random number generator /// </summary> public static class RandomGenerator { /// <summary> /// Generate random number /// </summary> /// <param name="length">Number of randomizations</param> /// <returns>Random number</returns> public static int GenerateNumber(int length) { byte[] randomSeq = new byte[length]; new RNGCryptoServiceProvider().GetBytes(randomSeq); int code = Environment.TickCount; foreach (byte b in randomSeq) { code += (int)b; } return code; } } /// <summary> /// Hash generator class /// </summary> public static class Hasher { /// <summary> /// Hash type /// </summary> public enum eHashType { /// <summary> /// MD5 hash. Quick but collisions are more likely. This should not be used for anything important /// </summary> MD5 = 0, /// <summary> /// SHA1 hash. Quick and secure. This is a popular method for hashing passwords /// </summary> SHA1 = 1, /// <summary> /// SHA256 hash. Slower than SHA1, but more secure. Used for encryption keys /// </summary> SHA256 = 2, /// <summary> /// SHA348 hash. Even slower than SHA256, but offers more security /// </summary> SHA348 = 3, /// <summary> /// SHA512 hash. Slowest but most secure. Probably overkill for most applications /// </summary> SHA512 = 4, /// <summary> /// Derrived from MD5, but only returns 12 digits /// </summary> Digit12 = 5 } /// <summary> /// Hashes text using a specific hashing method /// </summary> /// <param name="text">Input text</param> /// <param name="hash">Hash method</param> /// <returns>Hashed text</returns> public static string GetHash(string text, eHashType hash) { if (text == "") { return text; } if (hash == eHashType.MD5) { MD5CryptoServiceProvider hasher = new MD5CryptoServiceProvider(); return ByteToHex(hasher.ComputeHash(Encoding.ASCII.GetBytes(text))); } else if (hash == eHashType.SHA1) { SHA1Managed hasher = new SHA1Managed(); return ByteToHex(hasher.ComputeHash(Encoding.ASCII.GetBytes(text))); } else if (hash == eHashType.SHA256) { SHA256Managed hasher = new SHA256Managed(); return ByteToHex(hasher.ComputeHash(Encoding.ASCII.GetBytes(text))); } else if (hash == eHashType.SHA348) { SHA384Managed hasher = new SHA384Managed(); return ByteToHex(hasher.ComputeHash(Encoding.ASCII.GetBytes(text))); } else if (hash == eHashType.SHA512) { SHA512Managed hasher = new SHA512Managed(); return ByteToHex(hasher.ComputeHash(Encoding.ASCII.GetBytes(text))); } else if (hash == eHashType.Digit12) { MD5CryptoServiceProvider hasher = new MD5CryptoServiceProvider(); string newHash = ByteToHex(hasher.ComputeHash(Encoding.ASCII.GetBytes(text))); return newHash.Substring(0, 12); } return ""; } /// <summary> /// Generates a hash based on a file's contents. Used for detecting changes to a file and testing for duplicate files /// </summary> /// <param name="info">FileInfo object for the file to be hashed</param> /// <param name="hash">Hash method</param> /// <returns>Hash string representing the contents of the file</returns> public static string GetHash(FileInfo info, eHashType hash) { FileStream hashStream = new FileStream(info.FullName, FileMode.Open, FileAccess.Read); string hashString = ""; if (hash == eHashType.MD5) { MD5CryptoServiceProvider hasher = new MD5CryptoServiceProvider(); hashString = ByteToHex(hasher.ComputeHash(hashStream)); } else if (hash == eHashType.SHA1) { SHA1Managed hasher = new SHA1Managed(); hashString = ByteToHex(hasher.ComputeHash(hashStream)); } else if (hash == eHashType.SHA256) { SHA256Managed hasher = new SHA256Managed(); hashString = ByteToHex(hasher.ComputeHash(hashStream)); } else if (hash == eHashType.SHA348) { SHA384Managed hasher = new SHA384Managed(); hashString = ByteToHex(hasher.ComputeHash(hashStream)); } else if (hash == eHashType.SHA512) { SHA512Managed hasher = new SHA512Managed(); hashString = ByteToHex(hasher.ComputeHash(hashStream)); } hashStream.Close(); hashStream.Dispose(); hashStream = null; return hashString; } /// <summary> /// Converts a byte array to a hex string /// </summary> /// <param name="data">Byte array</param> /// <returns>Hex string</returns> public static string ByteToHex(byte[] data) { StringBuilder builder = new StringBuilder(); foreach (byte hashByte in data) { builder.Append(string.Format("{0:X1}", hashByte)); } return builder.ToString(); } /// <summary> /// Converts a hex string to a byte array /// </summary> /// <param name="hexString">Hex string</param> /// <returns>Byte array</returns> public static byte[] HexToByte(string hexString) { byte[] returnBytes = new byte[hexString.Length / 2]; for (int i = 0; i <= returnBytes.Length - 1; i++) { returnBytes[i] = byte.Parse(hexString.Substring(i * 2, 2), System.Globalization.NumberStyles.HexNumber); } return returnBytes; } } } And her is what I've got for Java code so far, but I'm getting the error "Input length must be multiple of 8 when decrypting with padded cipher" when I run the test on this: import java.security.InvalidAlgorithmParameterException; import java.security.InvalidKeyException; import javax.crypto.Cipher; import javax.crypto.NoSuchPaddingException; import javax.crypto.SecretKey; import javax.crypto.spec.IvParameterSpec; import javax.crypto.spec.SecretKeySpec; import com.tdocc.utils.Base64; public class TripleDES { private static byte[] keyBytes = { 110, 32, 73, 24, 125, 66, 75, 18, 79, (byte)150, (byte)211, 122, (byte)213, 14, (byte)156, (byte)136, (byte)171, (byte)218, 119, (byte)240, 81, (byte)142, 23, 4 }; private static byte[] ivBytes = { 25, 117, 68, 23, 99, 78, (byte)231, (byte)219 }; public static String encryptText(String plainText) { try { if (plainText.isEmpty()) return plainText; return Base64.decode(TripleDES.encrypt(plainText)).toString(); } catch (Exception e) { e.printStackTrace(); } return null; } public static byte[] encrypt(String plainText) throws InvalidKeyException, InvalidAlgorithmParameterException, NoSuchPaddingException { try { final SecretKey key = new SecretKeySpec(keyBytes, "DESede"); final IvParameterSpec iv = new IvParameterSpec(ivBytes); final Cipher cipher = Cipher.getInstance("DESede/CBC/PKCS5Padding"); cipher.init(Cipher.ENCRYPT_MODE, key, iv); final byte[] plainTextBytes = plainText.getBytes("utf-8"); final byte[] cipherText = cipher.doFinal(plainTextBytes); return cipherText; } catch (Exception e) { e.printStackTrace(); } return null; } public static String decryptText(String message) { try { if (message.isEmpty()) return message; else return TripleDES.decrypt(message.getBytes()); } catch (Exception e) { e.printStackTrace(); } return null; } public static String decrypt(byte[] message) { try { final SecretKey key = new SecretKeySpec(keyBytes, "DESede"); final IvParameterSpec iv = new IvParameterSpec(ivBytes); final Cipher cipher = Cipher.getInstance("DESede/CBC/PKCS5Padding"); cipher.init(Cipher.DECRYPT_MODE, key, iv); final byte[] plainText = cipher.doFinal(message); return plainText.toString(); } catch (Exception e) { e.printStackTrace(); } return null; } }

    Read the article

  • Issue with Multiple ModalPopups, ValidationSummary and UpdatePanels

    - by Aaron Hoffman
    I am having an issue when a page contains multiple ModalPopups each containing a ValidationSummary Control. Here is the functionality I need: A user clicks a button and a Modal Popup appears with dynamic content based on the button that was clicked. (This functionality is working. Buttons are wrapped in UpdatePanels and the partial page postback calls .Show() on the ModalPopup) "Save" button in ModalPopup causes client side validation, then causes a full page postback so the entire ModalPopup disappears. (ModalPopup could disappear another way - the ModalPopup just needs to disappear after a successful save operation) If errors occur in the codebehind during Save operation, messages are added to the ValidationSummary (contained within the ModalPopup) and the ModalPopup is displayed again. When the ValidationSummary's are added to the PopupPanel's, the ModalPopups no longer display correctly after a full page postback caused by the "Save" button within the second PopupPanel. (the first panel continues to function correctly) Both PopupPanels are displayed, and neither is "Popped-Up", they are displayed in-line. Any ideas on how to solve this? Image of Error State (after "PostBack Popup2" button has been clicked) ASPX markup <asp:ScriptManager ID="ScriptManager1" runat="server"> </asp:ScriptManager> <%--********************************************************************* Popup1 *********************************************************************--%> <asp:UpdatePanel ID="Popup1ShowButtonUpdatePanel" runat="server"> <ContentTemplate> <%--This button will cause a partial page postback and pass a parameter to the Popup1ModalPopup in code behind and call its .Show() method to make it visible--%> <asp:Button ID="Popup1ShowButton" runat="server" Text="Show Popup1" OnClick="Popup1ShowButton_Click" CommandArgument="1" /> </ContentTemplate> </asp:UpdatePanel> <%--Hidden Control is used as ModalPopup's TargetControlID .Usually this is the ID of control that causes the Popup, but we want to control the modal popup from code behind --%> <asp:HiddenField ID="Popup1ModalPopupTargetControl" runat="server" /> <ajax:ModalPopupExtender ID="Popup1ModalPopup" runat="server" TargetControlID="Popup1ModalPopupTargetControl" PopupControlID="Popup1PopupControl" CancelControlID="Popup1CancelButton"> </ajax:ModalPopupExtender> <asp:Panel ID="Popup1PopupControl" runat="server" CssClass="ModalPopup" Style="width: 600px; background-color: #FFFFFF; border: solid 1px #000000;"> <%--This button causes validation and a full-page post back. Full page postback will causes the ModalPopup to be Hid. If there are errors in code behind, the code behind will add a message to the ValidationSummary, and make the ModalPopup visible again--%> <asp:Button ID="Popup1PostBackButton" runat="server" Text="PostBack Popup1" OnClick="Popup1PostBackButton_Click" />&nbsp; <asp:Button ID="Popup1CancelButton" runat="server" Text="Cancel Popup1" /> <asp:UpdatePanel ID="Popup1UpdatePanel" runat="server"> <ContentTemplate> <%--*************ISSUE HERE*************** The two ValidationSummary's are causing an issue. When the second ModalPopup's PostBack button is clicked, Both ModalPopup's become visible, but neither are "Popped-Up". If ValidationSummary's are removed, both ModalPopups Function Correctly--%> <asp:ValidationSummary ID="Popup1ValidationSummary" runat="server" /> <%--Will display dynamically passed paramter during partial page post-back--%> Popup1 Parameter:<asp:Literal ID="Popup1Parameter" runat="server"></asp:Literal><br /> </ContentTemplate> </asp:UpdatePanel> &nbsp;<br /> &nbsp;<br /> &nbsp;<br /> </asp:Panel> &nbsp;<br /> &nbsp;<br /> &nbsp;<br /> <%--********************************************************************* Popup2 *********************************************************************--%> <asp:UpdatePanel ID="Popup2ShowButtonUpdatePanel" runat="server"> <ContentTemplate> <%--This button will cause a partial page postback and pass a parameter to the Popup2ModalPopup in code behind and call its .Show() method to make it visible--%> <asp:Button ID="Popup2ShowButton" runat="server" Text="Show Popup2" OnClick="Popup2ShowButton_Click" CommandArgument="2" /> </ContentTemplate> </asp:UpdatePanel> <%--Hidden Control is used as ModalPopup's TargetControlID .Usually this is the ID of control that causes the Popup, but we want to control the modal popup from code behind --%> <asp:HiddenField ID="Popup2ModalPopupTargetControl" runat="server" /> <ajax:ModalPopupExtender ID="Popup2ModalPopup" runat="server" TargetControlID="Popup2ModalPopupTargetControl" PopupControlID="Popup2PopupControl" CancelControlID="Popup2CancelButton"> </ajax:ModalPopupExtender> <asp:Panel ID="Popup2PopupControl" runat="server" CssClass="ModalPopup" Style="width: 600px; background-color: #FFFFFF; border: solid 1px #000000;"> <%--This button causes validation and a full-page post back. Full page postback will causes the ModalPopup to be Hid. If there are errors in code behind, the code behind will add a message to the ValidationSummary, and make the ModalPopup visible again--%> <asp:Button ID="Popup2PostBackButton" runat="server" Text="PostBack Popup2" OnClick="Popup2PostBackButton_Click" />&nbsp; <asp:Button ID="Popup2CancelButton" runat="server" Text="Cancel Popup2" /> <asp:UpdatePanel ID="Popup2UpdatePanel" runat="server"> <ContentTemplate> <%--*************ISSUE HERE*************** The two ValidationSummary's are causing an issue. When the second ModalPopup's PostBack button is clicked, Both ModalPopup's become visible, but neither are "Popped-Up". If ValidationSummary's are removed, both ModalPopups Function Correctly--%> <asp:ValidationSummary ID="Popup2ValidationSummary" runat="server" /> <%--Will display dynamically passed paramter during partial page post-back--%> Popup2 Parameter:<asp:Literal ID="Popup2Parameter" runat="server"></asp:Literal><br /> </ContentTemplate> </asp:UpdatePanel> &nbsp;<br /> &nbsp;<br /> &nbsp;<br /> </asp:Panel> Code Behind protected void Popup1ShowButton_Click(object sender, EventArgs e) { Button btn = sender as Button; //Dynamically pass parameter to ModalPopup during partial page postback Popup1Parameter.Text = btn.CommandArgument; Popup1ModalPopup.Show(); } protected void Popup1PostBackButton_Click(object sender, EventArgs e) { //if there is an error, add a message to the validation summary and //show the ModalPopup again //TODO: add message to validation summary //show ModalPopup after page refresh (request/response) Popup1ModalPopup.Show(); } protected void Popup2ShowButton_Click(object sender, EventArgs e) { Button btn = sender as Button; //Dynamically pass parameter to ModalPopup during partial page postback Popup2Parameter.Text = btn.CommandArgument; Popup2ModalPopup.Show(); } protected void Popup2PostBackButton_Click(object sender, EventArgs e) { //***********After This is when the issue appears********************** //if there is an error, add a message to the validation summary and //show the ModalPopup again //TODO: add message to validation summary //show ModalPopup after page refresh (request/response) Popup2ModalPopup.Show(); }

    Read the article

  • Hosting Multiple hosts under IIS for WCF

    - by Josh
    Hello everyone, I need to use multiple hosts under IIS for WCF. We're using wshttpbinding and we've found NO success so far even after checking out a couple of similar questions on stackoveflow. Here is my web.config <?xml version="1.0"?> <!-- Note: As an alternative to hand editing this file you can use the web admin tool to configure settings for your application. Use the Website->Asp.Net Configuration option in Visual Studio. A full list of settings and comments can be found in machine.config.comments usually located in \Windows\Microsoft.Net\Framework\v2.x\Config --> <configuration> <configSections> <sectionGroup name="system.web.extensions" type="System.Web.Configuration.SystemWebExtensionsSectionGroup, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"> <sectionGroup name="scripting" type="System.Web.Configuration.ScriptingSectionGroup, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"> <section name="scriptResourceHandler" type="System.Web.Configuration.ScriptingScriptResourceHandlerSection, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35" requirePermission="false" allowDefinition="MachineToApplication"/> <sectionGroup name="webServices" type="System.Web.Configuration.ScriptingWebServicesSectionGroup, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"> <section name="jsonSerialization" type="System.Web.Configuration.ScriptingJsonSerializationSection, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35" requirePermission="false" allowDefinition="Everywhere"/> <section name="profileService" type="System.Web.Configuration.ScriptingProfileServiceSection, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35" requirePermission="false" allowDefinition="MachineToApplication"/> <section name="authenticationService" type="System.Web.Configuration.ScriptingAuthenticationServiceSection, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35" requirePermission="false" allowDefinition="MachineToApplication"/> <section name="roleService" type="System.Web.Configuration.ScriptingRoleServiceSection, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35" requirePermission="false" allowDefinition="MachineToApplication"/> </sectionGroup> </sectionGroup> </sectionGroup> </configSections> <appSettings/> <connectionStrings> <add name="ConString" connectionString="Data Source=.\SQLEXPRESS;Initial Catalog=WebSMS20July;Integrated Security=True"/> </connectionStrings> <system.web> <customErrors mode="Off"/> <!--<httpRuntime maxRequestLength="999999999" useFullyQualifiedRedirectUrl="true" executionTimeout="459999999" appRequestQueueLimit="99999999" delayNotificationTimeout="999999999" maxWaitChangeNotification="999999999" shutdownTimeout="9999999999"/>--> <!-- Set compilation debug="true" to insert debugging symbols into the compiled page. Because this affects performance, set this value to true only during development. --> <compilation debug="true"> <assemblies> <add assembly="System.Core, Version=3.5.0.0, Culture=neutral, PublicKeyToken=B77A5C561934E089"/> <add assembly="System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"/> </assemblies> </compilation> <!-- The <authentication> section enables configuration of the security authentication mode used by ASP.NET to identify an incoming user. --> <authentication mode="Windows"/> <!-- The <customErrors> section enables configuration of what to do if/when an unhandled error occurs during the execution of a request. Specifically, it enables developers to configure html error pages to be displayed in place of a error stack trace. <customErrors mode="RemoteOnly" defaultRedirect="GenericErrorPage.htm"> <error statusCode="403" redirect="NoAccess.htm" /> <error statusCode="404" redirect="FileNotFound.htm" /> </customErrors>--> <pages> <controls> <add tagPrefix="asp" namespace="System.Web.UI" assembly="System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"/> </controls> </pages> <httpHandlers> <remove verb="*" path="*.asmx"/> <add verb="*" path="*.asmx" validate="false" type="System.Web.Script.Services.ScriptHandlerFactory, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"/> <add verb="*" path="*_AppService.axd" validate="false" type="System.Web.Script.Services.ScriptHandlerFactory, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"/> <add verb="GET,HEAD" path="ScriptResource.axd" type="System.Web.Handlers.ScriptResourceHandler, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35" validate="false"/> </httpHandlers> <httpModules> <add name="ScriptModule" type="System.Web.Handlers.ScriptModule, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"/> </httpModules> </system.web> <system.codedom> <compilers> <compiler language="c#;cs;csharp" extension=".cs" warningLevel="4" type="Microsoft.CSharp.CSharpCodeProvider, System, Version=2.0.0.0, Culture=neutral, PublicKeyToken=b77a5c561934e089"> <providerOption name="CompilerVersion" value="v3.5"/> <providerOption name="WarnAsError" value="false"/> </compiler> </compilers> </system.codedom> <!-- The system.webServer section is required for running ASP.NET AJAX under Internet Information Services 7.0. It is not necessary for previous version of IIS. --> <system.webServer> <validation validateIntegratedModeConfiguration="false"/> <modules> <add name="ScriptModule" preCondition="integratedMode" type="System.Web.Handlers.ScriptModule, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"/> </modules> <handlers> <remove name="WebServiceHandlerFactory-Integrated"/> <add name="ScriptHandlerFactory" verb="*" path="*.asmx" preCondition="integratedMode" type="System.Web.Script.Services.ScriptHandlerFactory, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"/> <add name="ScriptHandlerFactoryAppServices" verb="*" path="*_AppService.axd" preCondition="integratedMode" type="System.Web.Script.Services.ScriptHandlerFactory, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"/> <add name="ScriptResource" preCondition="integratedMode" verb="GET,HEAD" path="ScriptResource.axd" type="System.Web.Handlers.ScriptResourceHandler, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"/> </handlers> </system.webServer> <system.serviceModel> <serviceHostingEnvironment aspNetCompatibilityEnabled="true"> <baseAddressPrefixFilters> <add prefix="http://localhost:12350"/> </baseAddressPrefixFilters> </serviceHostingEnvironment> <bindings> <wsHttpBinding> <binding name="wsHttpBinding" maxBufferPoolSize="2147483647" maxReceivedMessageSize="2147483647"> <readerQuotas maxDepth="2147483647" maxStringContentLength="2147483647" maxArrayLength="2147483647" maxBytesPerRead="2147483647" maxNameTableCharCount="2147483647" /> <security mode="None"> <transport clientCredentialType="None" /> <message clientCredentialType="None" negotiateServiceCredential="false" establishSecurityContext="false" /> </security> </binding> <binding name="NewBinding0" /> </wsHttpBinding> </bindings> <services> <service behaviorConfiguration="WcfService1.Service1Behavior" name="WcfService1.Service1"> <endpoint address="" binding="wsHttpBinding" bindingConfiguration="wsHttpBinding" bindingName="wsHttpBinding" contract="WcfService1.IService1"> <identity> <dns value="localhost" /> </identity> </endpoint> <endpoint address="mex" binding="mexHttpBinding" contract="IMetadataExchange" /> <endpoint binding="wsHttpBinding" bindingConfiguration="wsHttpBinding" bindingName="wsHttpBinding2" contract="WcfService1.IService1" listenUri="http://localhost:8090" /> <host> <baseAddresses> <add baseAddress="http://mydomain/mywcfservice/Service1.svc" /> <add baseAddress="http://localhost/mywcfservice/Service1.svc" /> </baseAddresses> </host> </service> </services> <behaviors> <serviceBehaviors> <behavior name="WcfService1.Service1Behavior"> <!-- To avoid disclosing metadata information, set the value below to false and remove the metadata endpoint above before deployment --> <serviceMetadata httpGetEnabled="true"/> <!-- To receive exception details in faults for debugging purposes, set the value below to true. Set to false before deployment to avoid disclosing exception information --> <serviceDebug includeExceptionDetailInFaults="false"/> </behavior> </serviceBehaviors> </behaviors> </system.serviceModel> </configuration> Here's my service factory class using System; using System.Collections.Generic; using System.Linq; using System.Web; using System.ServiceModel; using System.ServiceModel.Activation; namespace WcfService1 { public class CustomHostFactory : ServiceHostFactory { protected override ServiceHost CreateServiceHost(Type serviceType, Uri[] baseAddresses) { //CustomHost customServiceHost = // new CustomHost(serviceType, baseAddresses[1]); //return customServiceHost; ServiceHost host; host = new ServiceHost(serviceType, baseAddresses[0]); return host; } class CustomHost : ServiceHost { public CustomHost(Type serviceType, params Uri[] baseAddresses) : base(serviceType, baseAddresses) { } protected override void ApplyConfiguration() { base.ApplyConfiguration(); } } } } Contents of my Service1.svc file <%@ ServiceHost Language="C#" Debug="true" Service="WcfService1.Service1" CodeBehind="Service1.svc.cs" Factory="WcfService1.CustomHostFactory" %> What could possibly be wrong? Would appreciate any help. Thanks.

    Read the article

  • Questions related to writing your own file downloader using multiple threads java

    - by Shekhar
    Hello In my current company, i am doing a PoC on how we can write a file downloader utility. We have to use socket programming(TCP/IP) for downloading the files. One of the requirements of the client is that a file(which will be large in size) should be transfered in chunks for example if we have a file of 5Mb size then we can have 5 threads which transfer 1 Mb each. I have written a small application which downloads a file. You can download the eclipe project from http://www.fileflyer.com/view/QM1JSC0 A brief explanation of my classes FileSender.java This class provides the bytes of file. It has a method called sendBytesOfFile(long start,long end, long sequenceNo) which gives the number of bytes. import java.io.File; import java.io.IOException; import java.util.zip.CRC32; import org.apache.commons.io.FileUtils; public class FileSender { private static final String FILE_NAME = "C:\\shared\\test.pdf"; public ByteArrayWrapper sendBytesOfFile(long start,long end, long sequenceNo){ try { File file = new File(FILE_NAME); byte[] fileBytes = FileUtils.readFileToByteArray(file); System.out.println("Size of file is " +fileBytes.length); System.out.println(); System.out.println("Start "+start +" end "+end); byte[] bytes = getByteArray(fileBytes, start, end); ByteArrayWrapper wrapper = new ByteArrayWrapper(bytes, sequenceNo); return wrapper; } catch (IOException e) { throw new RuntimeException(e); } } private byte[] getByteArray(byte[] bytes, long start, long end){ long arrayLength = end-start; System.out.println("Start : "+start +" end : "+end + " Arraylength : "+arrayLength +" length of source array : "+bytes.length); byte[] arr = new byte[(int)arrayLength]; for(int i = (int)start, j =0; i < end;i++,j++){ arr[j] = bytes[i]; } return arr; } public static long fileSize(){ File file = new File(FILE_NAME); return file.length(); } } Second Class is FileReceiver.java - This class receives the file. Small Explanation what this file does This class finds the size of the file to be fetched from Sender Depending upon the size of the file it finds the start and end position till the bytes needs to be read. It starts n number of threads giving each thread start,end, sequence number and a list which all the threads share. Each thread reads the number of bytes and creates a ByteArrayWrapper. ByteArrayWrapper objects are added to the list Then i have while loop which basically make sure that all threads have done their work finally it sorts the list based on the sequence number. then the bytes are joined, and a complete byte array is formed which is converted to a file. Code of File Receiver package com.filedownloader; import java.io.File; import java.io.IOException; import java.util.ArrayList; import java.util.Collections; import java.util.Comparator; import java.util.List; import java.util.zip.CRC32; import org.apache.commons.io.FileUtils; public class FileReceiver { public static void main(String[] args) { FileReceiver receiver = new FileReceiver(); receiver.receiveFile(); } public void receiveFile(){ long startTime = System.currentTimeMillis(); long numberOfThreads = 10; long filesize = FileSender.fileSize(); System.out.println("File size received "+filesize); long start = filesize/numberOfThreads; List<ByteArrayWrapper> list = new ArrayList<ByteArrayWrapper>(); for(long threadCount =0; threadCount<numberOfThreads ;threadCount++){ FileDownloaderTask task = new FileDownloaderTask(threadCount*start,(threadCount+1)*start,threadCount,list); new Thread(task).start(); } while(list.size() != numberOfThreads){ // this is done so that all the threads should complete their work before processing further. //System.out.println("Waiting for threads to complete. List size "+list.size()); } if(list.size() == numberOfThreads){ System.out.println("All bytes received "+list); Collections.sort(list, new Comparator<ByteArrayWrapper>() { @Override public int compare(ByteArrayWrapper o1, ByteArrayWrapper o2) { long sequence1 = o1.getSequence(); long sequence2 = o2.getSequence(); if(sequence1 < sequence2){ return -1; }else if(sequence1 > sequence2){ return 1; } else{ return 0; } } }); byte[] totalBytes = list.get(0).getBytes(); byte[] firstArr = null; byte[] secondArr = null; for(int i = 1;i<list.size();i++){ firstArr = totalBytes; secondArr = list.get(i).getBytes(); totalBytes = concat(firstArr, secondArr); } System.out.println(totalBytes.length); convertToFile(totalBytes,"c:\\tmp\\test.pdf"); long endTime = System.currentTimeMillis(); System.out.println("Total time taken with "+numberOfThreads +" threads is "+(endTime-startTime)+" ms" ); } } private byte[] concat(byte[] A, byte[] B) { byte[] C= new byte[A.length+B.length]; System.arraycopy(A, 0, C, 0, A.length); System.arraycopy(B, 0, C, A.length, B.length); return C; } private void convertToFile(byte[] totalBytes,String name) { try { FileUtils.writeByteArrayToFile(new File(name), totalBytes); } catch (IOException e) { throw new RuntimeException(e); } } } Code of ByteArrayWrapper package com.filedownloader; import java.io.Serializable; public class ByteArrayWrapper implements Serializable{ private static final long serialVersionUID = 3499562855188457886L; private byte[] bytes; private long sequence; public ByteArrayWrapper(byte[] bytes, long sequenceNo) { this.bytes = bytes; this.sequence = sequenceNo; } public byte[] getBytes() { return bytes; } public long getSequence() { return sequence; } } Code of FileDownloaderTask import java.util.List; public class FileDownloaderTask implements Runnable { private List<ByteArrayWrapper> list; private long start; private long end; private long sequenceNo; public FileDownloaderTask(long start,long end,long sequenceNo,List<ByteArrayWrapper> list) { this.list = list; this.start = start; this.end = end; this.sequenceNo = sequenceNo; } @Override public void run() { ByteArrayWrapper wrapper = new FileSender().sendBytesOfFile(start, end, sequenceNo); list.add(wrapper); } } Questions related to this code 1) Does file downloading becomes fast when multiple threads is used? In this code i am not able to see the benefit. 2) How should i decide how many threads should i create ? 3) Are their any opensource libraries which does that 4) The file which file receiver receives is valid and not corrupted but checksum (i used FileUtils of common-io) does not match. Whats the problem? 5) This code gives out of memory when used with large file(above 100 Mb) i.e. because byte array which is created. How can i avoid? I know this is a very bad code but i have to write this in one day -:). Please suggest any other good way to do this? Thanks Shekhar

    Read the article

  • Type Casting variables in PHP: Is there a practical example?

    - by Stephen
    PHP, as most of us know, has weak typing. For those who don't, PHP.net says: PHP does not require (or support) explicit type definition in variable declaration; a variable's type is determined by the context in which the variable is used. Love it or hate it, PHP re-casts variables on-the-fly. So, the following code is valid: $var = "10"; $value = 10 + $var; var_dump($value); // int(20) PHP also alows you to explicitly cast a variable, like so: $var = "10"; $value = 10 + $var; $value = (string)$value; var_dump($value); // string(2) "20" That's all cool... but, for the life of me, I cannot conceive of a practical reason for doing this. I don't have a problem with strong typing in languages that support it, like Java. That's fine, and I completely understand it. Also, I'm aware of—and fully understand the usefulness of—type hinting in function parameters. The problem I have with type casting is explained by the above quote. If PHP can swap types at-will, it can do so even after you force cast a type; and it can do so on-the-fly when you need a certain type in an operation. That makes the following valid: $var = "10"; $value = (int)$var; $value = $value . ' TaDa!'; var_dump($value); // string(8) "10 TaDa!" So what's the point? Can anyone show me a practical application or example of type casting—one that would fail if type casting were not involved? I ask this here instead of SO because I figure practicality is too subjective. Edit in response to Chris' comment Take this theoretical example of a world where user-defined type casting makes sense in PHP: You force cast variable $foo as int -- (int)$foo. You attempt to store a string value in the variable $foo. PHP throws an exception!! <--- That would make sense. Suddenly the reason for user defined type casting exists! The fact that PHP will switch things around as needed makes the point of user defined type casting vague. For example, the following two code samples are equivalent: // example 1 $foo = 0; $foo = (string)$foo; $foo = '# of Reasons for the programmer to type cast $foo as a string: ' . $foo; // example 2 $foo = 0; $foo = (int)$foo; $foo = '# of Reasons for the programmer to type cast $foo as a string: ' . $foo;

    Read the article

  • Search multiple datepicker on same grid

    - by DHF
    I'm using multiple datepicker on same grid and I face the problem to get a proper result. I used 3 datepicker in 1 grid. Only the first datepicker (Order Date)is able to output proper result while the other 2 datepicker (Start Date & End Date) are not able to generate proper result. There is no problem with the query, so could you find out what's going on here? Thanks in advance! php wrapper <?php ob_start(); require_once 'config.php'; // include the jqGrid Class require_once "php/jqGrid.php"; // include the PDO driver class require_once "php/jqGridPdo.php"; // include the datepicker require_once "php/jqCalendar.php"; // Connection to the server $conn = new PDO(DB_DSN,DB_USER,DB_PASSWORD); // Tell the db that we use utf-8 $conn->query("SET NAMES utf8"); // Create the jqGrid instance $grid = new jqGridRender($conn); // Write the SQL Query $grid->SelectCommand = "SELECT c.CompanyID, c.CompanyCode, c.CompanyName, c.Area, o.OrderCode, o.Date, m.maID ,m.System, m.Status, m.StartDate, m.EndDate, m.Type FROM company c, orders o, maintenance_agreement m WHERE c.CompanyID = o.CompanyID AND o.OrderID = m.OrderID "; // Set the table to where you update the data $grid->table = 'maintenance_agreement'; // set the ouput format to json $grid->dataType = 'json'; // Let the grid create the model $grid->setPrimaryKeyId('maID'); // Let the grid create the model $grid->setColModel(); // Set the url from where we obtain the data $grid->setUrl('grouping_ma_details.php'); // Set grid caption using the option caption $grid->setGridOptions(array( "sortable"=>true, "rownumbers"=>true, "caption"=>"Group by Maintenance Agreement", "rowNum"=>20, "height"=>'auto', "width"=>1300, "sortname"=>"maID", "hoverrows"=>true, "rowList"=>array(10,20,50), "footerrow"=>false, "userDataOnFooter"=>false, "grouping"=>true, "groupingView"=>array( "groupField" => array('CompanyName'), "groupColumnShow" => array(true), //show or hide area column "groupText" =>array('<b> Company Name: {0}</b>',), "groupDataSorted" => true, "groupSummary" => array(true) ) )); if(isset($_SESSION['login_admin'])) { $grid->addCol(array( "name"=>"Action", "formatter"=>"actions", "editable"=>false, "sortable"=>false, "resizable"=>false, "fixed"=>true, "width"=>60, "formatoptions"=>array("keys"=>true), "search"=>false ), "first"); } // Change some property of the field(s) $grid->setColProperty("CompanyID", array("label"=>"ID","hidden"=>true,"width"=>30,"editable"=>false,"editoptions"=>array("readonly"=>"readonly"))); $grid->setColProperty("CompanyName", array("label"=>"Company Name","hidden"=>true,"editable"=>false,"width"=>150,"align"=>"center","fixed"=>true)); $grid->setColProperty("CompanyCode", array("label"=>"Company Code","hidden"=>true,"width"=>50,"align"=>"center")); $grid->setColProperty("OrderCode", array("label"=>"Order Code","width"=>110,"editable"=>false,"align"=>"center","fixed"=>true)); $grid->setColProperty("maID", array("hidden"=>true)); $grid->setColProperty("System", array("width"=>150,"fixed"=>true,"align"=>"center")); $grid->setColProperty("Type", array("width"=>280,"fixed"=>true)); $grid->setColProperty("Status", array("width"=>70,"align"=>"center","edittype"=>"select","editoptions"=>array("value"=>"Yes:Yes;No:No"),"fixed"=>true)); $grid->setSelect('System', "SELECT DISTINCT System, System AS System FROM master_ma_system ORDER BY System", false, true, true, array(""=>"All")); $grid->setSelect('Type', "SELECT DISTINCT Type, Type AS Type FROM master_ma_type ORDER BY Type", false, true, true, array(""=>"All")); $grid->setColProperty("StartDate", array("label"=>"Start Date","width"=>120,"align"=>"center","fixed"=>true, "formatter"=>"date", "formatoptions"=>array("srcformat"=>"Y-m-d H:i:s","newformat"=>"d M Y") )); // this is only in this case since the orderdate is set as date time $grid->setUserTime("d M Y"); $grid->setUserDate("d M Y"); $grid->setDatepicker("StartDate",array("buttonOnly"=>false)); $grid->datearray = array('StartDate'); $grid->setColProperty("EndDate", array("label"=>"End Date","width"=>120,"align"=>"center","fixed"=>true, "formatter"=>"date", "formatoptions"=>array("srcformat"=>"Y-m-d H:i:s","newformat"=>"d M Y") )); // this is only in this case since the orderdate is set as date time $grid->setUserTime("d M Y"); $grid->setUserDate("d M Y"); $grid->setDatepicker("EndDate",array("buttonOnly"=>false)); $grid->datearray = array('EndDate'); $grid->setColProperty("Date", array("label"=>"Order Date","width"=>100,"editable"=>false,"align"=>"center","fixed"=>true, "formatter"=>"date", "formatoptions"=>array("srcformat"=>"Y-m-d H:i:s","newformat"=>"d M Y") )); // this is only in this case since the orderdate is set as date time $grid->setUserTime("d M Y"); $grid->setUserDate("d M Y"); $grid->setDatepicker("Date",array("buttonOnly"=>false)); $grid->datearray = array('Date'); // This command is executed after edit $maID = jqGridUtils::GetParam('maID'); $Status = jqGridUtils::GetParam('Status'); $StartDate = jqGridUtils::GetParam('StartDate'); $EndDate = jqGridUtils::GetParam('EndDate'); $Type = jqGridUtils::GetParam('Type'); // This command is executed immediatley after edit occur. $grid->setAfterCrudAction('edit', "UPDATE maintenance_agreement SET m.Status=?, m.StartDate=?, m.EndDate=?, m.Type=? WHERE m.maID=?", array($Status,$StartDate,$EndDate,$Type,$maID)); $selectorder = <<<ORDER function(rowid, selected) { if(rowid != null) { jQuery("#detail").jqGrid('setGridParam',{postData:{CompanyID:rowid}}); jQuery("#detail").trigger("reloadGrid"); // Enable CRUD buttons in navigator when a row is selected jQuery("#add_detail").removeClass("ui-state-disabled"); jQuery("#edit_detail").removeClass("ui-state-disabled"); jQuery("#del_detail").removeClass("ui-state-disabled"); } } ORDER; // We should clear the grid data on second grid on sorting, paging, etc. $cleargrid = <<<CLEAR function(rowid, selected) { // clear the grid data and footer data jQuery("#detail").jqGrid('clearGridData',true); // Disable CRUD buttons in navigator when a row is not selected jQuery("#add_detail").addClass("ui-state-disabled"); jQuery("#edit_detail").addClass("ui-state-disabled"); jQuery("#del_detail").addClass("ui-state-disabled"); } CLEAR; $grid->setGridEvent('onSelectRow', $selectorder); $grid->setGridEvent('onSortCol', $cleargrid); $grid->setGridEvent('onPaging', $cleargrid); $grid->setColProperty("Area", array("width"=>100,"hidden"=>false,"editable"=>false,"fixed"=>true)); $grid->setColProperty("HeadCount", array("label"=>"Head Count","align"=>"center", "width"=>100,"hidden"=>false,"fixed"=>true)); $grid->setSelect('Area', "SELECT DISTINCT AreaName, AreaName AS Area FROM master_area ORDER BY AreaName", false, true, true, array(""=>"All")); $grid->setSelect('CompanyName', "SELECT DISTINCT CompanyName, CompanyName AS CompanyName FROM company ORDER BY CompanyName", false, true, true, array(""=>"All")); $custom = <<<CUSTOM jQuery("#getselected").click(function(){ var selr = jQuery('#grid').jqGrid('getGridParam','selrow'); if(selr) { window.open('http://www.smartouch-cdms.com/order.php?CompanyID='+selr); } else alert("No selected row"); return false; }); CUSTOM; $grid->setJSCode($custom); // Enable toolbar searching $grid->toolbarfilter = true; $grid->setFilterOptions(array("stringResult"=>true,"searchOnEnter"=>false,"defaultSearch"=>"cn")); // Enable navigator $grid->navigator = true; // disable the delete operation programatically for that table $grid->del = false; // we need to write some custom code when we are in delete mode. // get the grid operation parameter to see if we are in delete mode // jqGrid sends the "oper" parameter to identify the needed action $deloper = $_POST['oper']; // det the company id $cid = $_POST['CompanyID']; // if the operation is del and the companyid is set if($deloper == 'del' && isset($cid) ) { // the two tables are linked via CompanyID, so let try to delete the records in both tables try { jqGridDB::beginTransaction($conn); $comp = jqGridDB::prepare($conn, "DELETE FROM company WHERE CompanyID= ?", array($cid)); $cont = jqGridDB::prepare($conn,"DELETE FROM contact WHERE CompanyID = ?", array($cid)); jqGridDB::execute($comp); jqGridDB::execute($cont); jqGridDB::commit($conn); } catch(Exception $e) { jqGridDB::rollBack($conn); echo $e->getMessage(); } } // Enable only deleting if(isset($_SESSION['login_admin'])) { $grid->setNavOptions('navigator', array("pdf"=>true, "excel"=>true,"add"=>false,"edit"=>true,"del"=>false,"view"=>true, "search"=>true)); } else $grid->setNavOptions('navigator', array("pdf"=>true, "excel"=>true,"add"=>false,"edit"=>false,"del"=>false,"view"=>true, "search"=>true)); // In order to enable the more complex search we should set multipleGroup option // Also we need show query roo $grid->setNavOptions('search', array( "multipleGroup"=>false, "showQuery"=>true )); // Set different filename $grid->exportfile = 'Company.xls'; // Close the dialog after editing $grid->setNavOptions('edit',array("closeAfterEdit"=>true,"editCaption"=>"Update Company","bSubmit"=>"Update","dataheight"=>"auto")); $grid->setNavOptions('add',array("closeAfterAdd"=>true,"addCaption"=>"Add New Company","bSubmit"=>"Update","dataheight"=>"auto")); $grid->setNavOptions('view',array("Caption"=>"View Company","dataheight"=>"auto","width"=>"1100")); ob_end_clean(); //solve TCPDF error // Enjoy $grid->renderGrid('#grid','#pager',true, null, null, true,true); $conn = null; ?> javascript code jQuery(document).ready(function ($) { jQuery('#grid').jqGrid({ "width": 1300, "hoverrows": true, "viewrecords": true, "jsonReader": { "repeatitems": false, "subgrid": { "repeatitems": false } }, "xmlReader": { "repeatitems": false, "subgrid": { "repeatitems": false } }, "gridview": true, "url": "session_ma_details.php", "editurl": "session_ma_details.php", "cellurl": "session_ma_details.php", "sortable": true, "rownumbers": true, "caption": "Group by Maintenance Agreement", "rowNum": 20, "height": "auto", "sortname": "maID", "rowList": [10, 20, 50], "footerrow": false, "userDataOnFooter": false, "grouping": true, "groupingView": { "groupField": ["CompanyName"], "groupColumnShow": [false], "groupText": ["<b> Company Name: {0}</b>"], "groupDataSorted": true, "groupSummary": [true] }, "onSelectRow": function (rowid, selected) { if (rowid != null) { jQuery("#detail").jqGrid('setGridParam', { postData: { CompanyID: rowid } }); jQuery("#detail").trigger("reloadGrid"); // Enable CRUD buttons in navigator when a row is selected jQuery("#add_detail").removeClass("ui-state-disabled"); jQuery("#edit_detail").removeClass("ui-state-disabled"); jQuery("#del_detail").removeClass("ui-state-disabled"); } }, "onSortCol": function (rowid, selected) { // clear the grid data and footer data jQuery("#detail").jqGrid('clearGridData', true); // Disable CRUD buttons in navigator when a row is not selected jQuery("#add_detail").addClass("ui-state-disabled"); jQuery("#edit_detail").addClass("ui-state-disabled"); jQuery("#del_detail").addClass("ui-state-disabled"); }, "onPaging": function (rowid, selected) { // clear the grid data and footer data jQuery("#detail").jqGrid('clearGridData', true); // Disable CRUD buttons in navigator when a row is not selected jQuery("#add_detail").addClass("ui-state-disabled"); jQuery("#edit_detail").addClass("ui-state-disabled"); jQuery("#del_detail").addClass("ui-state-disabled"); }, "datatype": "json", "colModel": [ { "name": "Action", "formatter": "actions", "editable": false, "sortable": false, "resizable": false, "fixed": true, "width": 60, "formatoptions": { "keys": true }, "search": false }, { "name": "CompanyID", "index": "CompanyID", "sorttype": "int", "label": "ID", "hidden": true, "width": 30, "editable": false, "editoptions": { "readonly": "readonly" } }, { "name": "CompanyCode", "index": "CompanyCode", "sorttype": "string", "label": "Company Code", "hidden": true, "width": 50, "align": "center", "editable": true }, { "name": "CompanyName", "index": "CompanyName", "sorttype": "string", "label": "Company Name", "hidden": true, "editable": false, "width": 150, "align": "center", "fixed": true, "edittype": "select", "editoptions": { "value": "Aquatex Industries:Aquatex Industries;Benithem Sdn Bhd:Benithem Sdn Bhd;Daily Bakery Sdn Bhd:Daily Bakery Sdn Bhd;Eurocor Asia Sdn Bhd:Eurocor Asia Sdn Bhd;Evergrown Technology:Evergrown Technology;Goldpar Precision:Goldpar Precision;MicroSun Technologies Asia:MicroSun Technologies Asia;NCI Industries Sdn Bhd:NCI Industries Sdn Bhd;PHHP Marketing:PHHP Marketing;Smart Touch Technology:Smart Touch Technology;THOSCO Treatech:THOSCO Treatech;YHL Trading (Johor) Sdn Bhd:YHL Trading (Johor) Sdn Bhd;Zenxin Agri-Organic Food:Zenxin Agri-Organic Food", "separator": ":", "delimiter": ";" }, "stype": "select", "searchoptions": { "value": ":All;Aquatex Industries:Aquatex Industries;Benithem Sdn Bhd:Benithem Sdn Bhd;Daily Bakery Sdn Bhd:Daily Bakery Sdn Bhd;Eurocor Asia Sdn Bhd:Eurocor Asia Sdn Bhd;Evergrown Technology:Evergrown Technology;Goldpar Precision:Goldpar Precision;MicroSun Technologies Asia:MicroSun Technologies Asia;NCI Industries Sdn Bhd:NCI Industries Sdn Bhd;PHHP Marketing:PHHP Marketing;Smart Touch Technology:Smart Touch Technology;THOSCO Treatech:THOSCO Treatech;YHL Trading (Johor) Sdn Bhd:YHL Trading (Johor) Sdn Bhd;Zenxin Agri-Organic Food:Zenxin Agri-Organic Food", "separator": ":", "delimiter": ";" } }, { "name": "Area", "index": "Area", "sorttype": "string", "width": 100, "hidden": true, "editable": false, "fixed": true, "edittype": "select", "editoptions": { "value": "Cemerlang:Cemerlang;Danga Bay:Danga Bay;Kulai:Kulai;Larkin:Larkin;Masai:Masai;Nusa Cemerlang:Nusa Cemerlang;Nusajaya:Nusajaya;Pasir Gudang:Pasir Gudang;Pekan Nenas:Pekan Nenas;Permas Jaya:Permas Jaya;Pontian:Pontian;Pulai:Pulai;Senai:Senai;Skudai:Skudai;Taman Gaya:Taman Gaya;Taman Johor Jaya:Taman Johor Jaya;Taman Molek:Taman Molek;Taman Pelangi:Taman Pelangi;Taman Sentosa:Taman Sentosa;Tebrau 4:Tebrau 4;Ulu Tiram:Ulu Tiram", "separator": ":", "delimiter": ";" }, "stype": "select", "searchoptions": { "value": ":All;Cemerlang:Cemerlang;Danga Bay:Danga Bay;Kulai:Kulai;Larkin:Larkin;Masai:Masai;Nusa Cemerlang:Nusa Cemerlang;Nusajaya:Nusajaya;Pasir Gudang:Pasir Gudang;Pekan Nenas:Pekan Nenas;Permas Jaya:Permas Jaya;Pontian:Pontian;Pulai:Pulai;Senai:Senai;Skudai:Skudai;Taman Gaya:Taman Gaya;Taman Johor Jaya:Taman Johor Jaya;Taman Molek:Taman Molek;Taman Pelangi:Taman Pelangi;Taman Sentosa:Taman Sentosa;Tebrau 4:Tebrau 4;Ulu Tiram:Ulu Tiram", "separator": ":", "delimiter": ";" } }, { "name": "OrderCode", "index": "OrderCode", "sorttype": "string", "label": "Order No.", "width": 110, "editable": false, "align": "center", "fixed": true }, { "name": "Date", "index": "Date", "sorttype": "date", "label": "Order Date", "width": 100, "editable": false, "align": "center", "fixed": true, "formatter": "date", "formatoptions": { "srcformat": "Y-m-d H:i:s", "newformat": "d M Y" }, "editoptions": { "dataInit": function(el) { setTimeout(function() { if (jQuery.ui) { if (jQuery.ui.datepicker) { jQuery(el).datepicker({ "disabled": false, "dateFormat": "dd M yy" }); jQuery('.ui-datepicker').css({ 'font-size': '75%' }); } } }, 100); } }, "searchoptions": { "dataInit": function(el) { setTimeout(function() { if (jQuery.ui) { if (jQuery.ui.datepicker) { jQuery(el).datepicker({ "disabled": false, "dateFormat": "dd M yy" }); jQuery('.ui-datepicker').css({ 'font-size': '75%' }); } } }, 100); } } }, { "name": "maID", "index": "maID", "sorttype": "int", "key": true, "hidden": true, "editable": true }, { "name": "System", "index": "System", "sorttype": "string", "width": 150, "fixed": true, "align": "center", "edittype": "select", "editoptions": { "value": "Payroll:Payroll;TMS:TMS;TMS & Payroll:TMS & Payroll", "separator": ":", "delimiter": ";" }, "stype": "select", "searchoptions": { "value": ":All;Payroll:Payroll;TMS:TMS;TMS & Payroll:TMS & Payroll", "separator": ":", "delimiter": ";" }, "editable": true }, { "name": "Status", "index": "Status", "sorttype": "string", "width": 70, "align": "center", "edittype": "select", "editoptions": { "value": "Yes:Yes;No:No" }, "fixed": true, "editable": true }, { "name": "StartDate", "index": "StartDate", "sorttype": "date", "label": "Start Date", "width": 120, "align": "center", "fixed": true, "formatter": "date", "formatoptions": { "srcformat": "Y-m-d H:i:s", "newformat": "d M Y" }, "editoptions": { "dataInit": function(el) { setTimeout(function() { if (jQuery.ui) { if (jQuery.ui.datepicker) { jQuery(el).datepicker({ "disabled": false, "dateFormat": "dd M yy" }); jQuery('.ui-datepicker').css({ 'font-size': '75%' }); } } }, 100); } }, "searchoptions": { "dataInit": function(el) { setTimeout(function() { if (jQuery.ui) { if (jQuery.ui.datepicker) { jQuery(el).datepicker({ "disabled": false, "dateFormat": "dd M yy" }); jQuery('.ui-datepicker').css({ 'font-size': '75%' }); } } }, 100); } }, "editable": true }, { "name": "EndDate", "index": "EndDate", "sorttype": "date", "label": "End Date", "width": 120, "align": "center", "fixed": true, "formatter": "date", "formatoptions": { "srcformat": "Y-m-d H:i:s", "newformat": "d M Y" }, "editoptions": { "dataInit": function(el) { setTimeout(function() { if (jQuery.ui) { if (jQuery.ui.datepicker) { jQuery(el).datepicker({ "disabled": false, "dateFormat": "dd M yy" }); jQuery('.ui-datepicker').css({ 'font-size': '75%' }); } } }, 100); } }, "searchoptions": { "dataInit": function(el) { setTimeout(function() { if (jQuery.ui) { if (jQuery.ui.datepicker) { jQuery(el).datepicker({ "disabled": false, "dateFormat": "dd M yy" }); jQuery('.ui-datepicker').css({ 'font-size': '75%' }); } } }, 100); } }, "editable": true }, { "name": "Type", "index": "Type", "sorttype": "string", "width": 530, "fixed": true, "edittype": "select", "editoptions": { "value": "Comprehensive MA:Comprehensive MA;FOC service, 20% spare part discount:FOC service, 20% spare part discount;Standard Package, FOC 1 time service, 20% spare part discount:Standard Package, FOC 1 time service, 20% spare part discount;Standard Package, FOC 2 time service, 20% spare part discount:Standard Package, FOC 2 time service, 20% spare part discount;Standard Package, FOC 3 time service, 20% spare part discount:Standard Package, FOC 3 time service, 20% spare part discount;Standard Package, FOC 4 time service, 20% spare part discount:Standard Package, FOC 4 time service, 20% spare part discount;Standard Package, FOC 6 time service, 20% spare part discount:Standard Package, FOC 6 time service, 20% spare part discount;Standard Package, no free:Standard Package, no free", "separator": ":", "delimiter": ";" }, "stype": "select", "searchoptions": { "value": ":All;Comprehensive MA:Comprehensive MA;FOC service, 20% spare part discount:FOC service, 20% spare part discount;Standard Package, FOC 1 time service, 20% spare part discount:Standard Package, FOC 1 time service, 20% spare part discount;Standard Package, FOC 2 time service, 20% spare part discount:Standard Package, FOC 2 time service, 20% spare part discount;Standard Package, FOC 3 time service, 20% spare part discount:Standard Package, FOC 3 time service, 20% spare part discount;Standard Package, FOC 4 time service, 20% spare part discount:Standard Package, FOC 4 time service, 20% spare part discount;Standard Package, FOC 6 time service, 20% spare part discount:Standard Package, FOC 6 time service, 20% spare part discount;Standard Package, no free:Standard Package, no free", "separator": ":", "delimiter": ";" }, "editable": true } ], "postData": { "oper": "grid" }, "prmNames": { "page": "page", "rows": "rows", "sort": "sidx", "order": "sord", "search": "_search", "nd": "nd", "id": "maID", "filter": "filters", "searchField": "searchField", "searchOper": "searchOper", "searchString": "searchString", "oper": "oper", "query": "grid", "addoper": "add", "editoper": "edit", "deloper": "del", "excel": "excel", "subgrid": "subgrid", "totalrows": "totalrows", "autocomplete": "autocmpl" }, "loadError": function(xhr, status, err) { try { jQuery.jgrid.info_dialog(jQuery.jgrid.errors.errcap, '<div class="ui-state-error">' + xhr.responseText + '</div>', jQuery.jgrid.edit.bClose, { buttonalign: 'right' } ); } catch(e) { alert(xhr.responseText); } }, "pager": "#pager" }); jQuery('#grid').jqGrid('navGrid', '#pager', { "edit": true, "add": false, "del": false, "search": true, "refresh": true, "view": true, "excel": true, "pdf": true, "csv": false, "columns": false }, { "drag": true, "resize": true, "closeOnEscape": true, "dataheight": "auto", "errorTextFormat": function (r) { return r.responseText; }, "closeAfterEdit": true, "editCaption": "Update Company", "bSubmit": "Update" }, { "drag": true, "resize": true, "closeOnEscape": true, "dataheight": "auto", "errorTextFormat": function (r) { return r.responseText; }, "closeAfterAdd": true, "addCaption": "Add New Company", "bSubmit": "Update" }, { "errorTextFormat": function (r) { return r.responseText; } }, { "drag": true, "closeAfterSearch": true, "multipleSearch": true }, { "drag": true, "resize": true, "closeOnEscape": true, "dataheight": "auto", "Caption": "View Company", "width": "1100" } ); jQuery('#grid').jqGrid('navButtonAdd', '#pager', { id: 'pager_excel', caption: '', title: 'Export To Excel', onClickButton: function (e) { try { jQuery("#grid").jqGrid('excelExport', { tag: 'excel', url: 'session_ma_details.php' }); } catch (e) { window.location = 'session_ma_details.php?oper=excel'; } }, buttonicon: 'ui-icon-newwin' }); jQuery('#grid').jqGrid('navButtonAdd', '#pager', { id: 'pager_pdf', caption: '', title: 'Export To Pdf', onClickButton: function (e) { try { jQuery("#grid").jqGrid('excelExport', { tag: 'pdf', url: 'session_ma_details.php' }); } catch (e) { window.location = 'session_ma_details.php?oper=pdf'; } }, buttonicon: 'ui-icon-print' }); jQuery('#grid').jqGrid('filterToolbar', { "stringResult": true, "searchOnEnter": false, "defaultSearch": "cn" }); jQuery("#getselected").click(function () { var selr = jQuery('#grid').jqGrid('getGridParam', 'selrow'); if (selr) { window.open('http://www.smartouch-cdms.com/order.php?CompanyID=' + selr); } else alert("No selected row"); return false; }); });

    Read the article

  • Type Casting variables in PHP: Is there a practical example?

    - by Stephen
    PHP, as most of us know, has weak typing. For those who don't, PHP.net says: PHP does not require (or support) explicit type definition in variable declaration; a variable's type is determined by the context in which the variable is used. Love it or hate it, PHP re-casts variables on-the-fly. So, the following code is valid: $var = "10"; $value = 10 + $var; var_dump($value); // int(20) PHP also alows you to explicitly cast a variable, like so: $var = "10"; $value = 10 + $var; $value = (string)$value; var_dump($value); // string(2) "20" That's all cool... but, for the life of me, I cannot conceive of a practical reason for doing this. I don't have a problem with strong typing in languages that support it, like Java. That's fine, and I completely understand it. Also, I'm aware of—and fully understand the usefulness of—type hinting in function parameters. The problem I have with type casting is explained by the above quote. If PHP can swap types at-will, it can do so even after you force cast a type; and it can do so on-the-fly when you need a certain type in an operation. That makes the following valid: $var = "10"; $value = (int)$var; $value = $value . ' TaDa!'; var_dump($value); // string(8) "10 TaDa!" So what's the point? Can anyone show me a practical application or example of type casting—one that would fail if type casting were not involved? I ask this here instead of SO because I figure practicality is too subjective. Edit in response to Chris' comment Take this theoretical example of a world where user-defined type casting makes sense in PHP: You force cast variable $foo as int -- (int)$foo. You attempt to store a string value in the variable $foo. PHP throws an exception!! <--- That would make sense. Suddenly the reason for user defined type casting exists! The fact that PHP will switch things around as needed makes the point of user defined type casting vague. For example, the following two code samples are equivalent: // example 1 $foo = 0; $foo = (string)$foo; $foo = '# of Reasons for the programmer to type cast $foo as a string: ' . $foo; // example 2 $foo = 0; $foo = (int)$foo; $foo = '# of Reasons for the programmer to type cast $foo as a string: ' . $foo; UPDATE Guess who found himself using typecasting in a practical environment? Yours Truly. The requirement was to display money values on a website for a restaurant menu. The design of the site required that trailing zeros be trimmed, so that the display looked something like the following: Menu Item 1 .............. $ 4 Menu Item 2 .............. $ 7.5 Menu Item 3 .............. $ 3 The best way I found to do that wast to cast the variable as a float: $price = '7.50'; // a string from the database layer. echo 'Menu Item 2 .............. $ ' . (float)$price; PHP trims the float's trailing zeros, and then recasts the float as a string for concatenation.

    Read the article

  • What is the list of special variables available when writing a shell command for a context menu

    - by giovanni.pellicciotta
    When extending the Windows' shell context menu (e.g. for adding an 'Open command here' prompt on directories), a 'command' key needs to be created in the registry. The value of this 'command' key apparently can be any valid command line. I want to know which 'special variables' are available for use inside this command line. For example, I use following command for opening and cmd window from within a directory's context menu (*): cmd.exe /e:on /f:on /s /k pushd "%V" I cannot find any reference to what %V actually means or what the full list of such variables is. (*) Following registry keys are created for this: [HKEY_LOCAL_MACHINE\SOFTWARE\Classes\Directory\shell\cmdshell] @=Open Command Prompt Here" HKEY_LOCAL_MACHINE\SOFTWARE\Classes\Directory\shell\cmdshell\command] @="cmd.exe /e:on /f:on /s /k pushd \"%V\""

    Read the article

  • Do any CDN services offer multiple urls (or aliases) for your files?

    - by Jakobud
    Lets say a company has multiple commercial web properties that happen to use a lot of the same images on each site. For SEO reasons, the sites must not appear to be related to eachother in any way. This means that the sites can't all link to the same image, even though they all use the same one. Therefore, an image is uploaded to each site and served from each site separately. In order to improve maintainability and latency, lets say the company wanted to use a CDN service. What I'm wondering is, if you upload a file, like an image or something, to a CDN, is there basically one single URL that you access that image at? Or do some (or all) CDN services offer alias URLs so that you can access the same resource from multiple URLs? Example of undesirable situation: Both sites link to the same file URL Site ABC links to <img src="http://123.cdnservice.com/some-path/myimage.jpg"/> Site XYZ links to <img src="http://123.cdnservice.com/some-path/myimage.jpg"/> Example of DESIRABLE situation: Both sites link to the same file via different URLs Site ABC links to <img src="http://123.cdnservice.com/some-path/myimage.jpg"/> Site XYZ links to <img src="http://123.cdnservice.com/some-alias-path/myimage.jpg"/> So in the end, there is only one single file, myimage.jpg on the CDN server, but it is accessible from multiple URLs. Is this possible with CDN services? I know this would make browsers cache the same image twice, but at least it would be better for maintainability. Only one file would ever have to be uploaded.

    Read the article

  • What Are All the Variables Necessary to Create Blackbox Logs for Nginx?

    - by Alan Gutierrez
    There's an article out there, Profiling LAMP Applications with Apache's Blackbox Logs, that describes how to create a log that records a lot of detailed information missing in the common and combined log formats. This information is supposed to help you resolve performance issues. As the author notes "While the common log-file format (and the combined format) are great for hit tracking, they aren't suitable for getting hardcore performance data." The article describes a "blackbox" log format, like a blackbox flight recorder on an aircraft, that gathers information used to profile server performance, missing from the hit tracking log formats: Keep alive status, remote port, child processes, bytes sent, etc. LogFormat "%a/%S %X %t \"%r\" %s/%>s %{pid}P/%{tid}P %T/%D %I/%O/%B" blackbox I'm trying to recreate as much of the format for Nginx, and would like help filling in the blanks. Here's what Nginx blackbox format would look like, the unmapped Apache directives have question marks after their names. access_log blackbox '$remote_addr/$remote_port X? [$time_local] "$request"' 's?/$status $pid/0 T?/D? I?/O?/B?' Here's a table of the variables I've been able to map from the Nginx documentation. %a = $remote_addr - The IP address of the remote client. %S = $remote_port - The port of the remote client. %X = ? - Keep alive status. %t = $time_local - The start time of the request. %r = $request - The first line of request containing method verb, path and protocol. %s = ? - Status before any redirections. %>s = $status - Status after any redirections. %{pid}P = $pid - The process id. %{tid}P = N/A - The thread id, which is non-applicable to Nignx. %T = ? - The time in seconds to handle the request. %D = ? - The time in milliseconds to handle the request. %I = ? - The count of bytes received including headers. %O = ? - The count of bytes sent including headers. %B = ? - The count of bytes sent excluding headers, but with a 0 for none instead of '-'. Looking for help filling in the missing variables, or confirmation that the missing variables are in fact, unavailable in Nginx.

    Read the article

  • Storing user info in Session using an Object vs. normal variables

    - by justinl
    I'm in the process of implementing a user authentication system for my website. I'm using an open source library that maintains user information by creating a User object and storing that object inside my php SESSION variable. Is this the best way to store and access that information? I find it a bit of a hassle to access the user variables because I have to create an object to access them first: $userObj = $_SESSION['userObject']; $userObj->userId; instead of just accessing the user id like this how I would usually store the user ID: $_SESSION['userId']; Is there an advantage to storing a bunch of user data as an object instead of just storing them as individual SESSION variables? ps - The library also seems to store a handful of variables inside the user object (id, username, date joined, email, last user db query) but I really don't care to have all that information stored in my session. I only really want to keep the user id and username.

    Read the article

  • How can I access variables outside of current scope in javascript?

    - by sekmet64
    I'm writing some application in javascript and cannot figure it out how to access the variables declared in my function, inside this jquery parse. Inside I can access global variables, but I don't really want to create global vars for these values. Basically I want to extract file names from an xml document in the simulationFiles variable. I check if the node attribute is equal with the simName and extract the two strings inside the xml elements, that part I think it's working. How can I extract those xml elements and append them to local variables? function CsvReader(simName) { this.initFileName = "somepath"; this.eventsFileName = "somepath"; $(simulationFiles).find('simulation').each(function() { if ($(this).attr("name") == simName) { initFileName += $(this).find("init").text(); eventsFileName += $(this).find("events").text(); } }); }

    Read the article

  • Should I use curly brackets or concatenate variables within strings?

    - by mririgo
    Straight forward question: Is there an advantage or disadvantage to concatenating variables within strings or using curly braces instead? Concatenated: $greeting = "Welcome, ".$name."!"; Curly braces: $greeting = "Welcome, {$name}!"; Personally, I've always concatenated my strings because I use UEStudio and it highlights PHP variables a different color when concatenated. However, when the variable is not broken out, it does not. It just makes it easier for my eyes to find PHP variables in long strings, etc. EDIT: People are confusing this about being about SQL. This is not what this question is about. I've updated my examples to avoid confusion.

    Read the article

< Previous Page | 227 228 229 230 231 232 233 234 235 236 237 238  | Next Page >