Search Results

Search found 58636 results on 2346 pages for 'text services framework'.

Page 235/2346 | < Previous Page | 231 232 233 234 235 236 237 238 239 240 241 242  | Next Page >

  • Add Machine Key to machine.config in Load Balancing environment to multiple versions of .net framework

    - by davidb
    I have two web servers behind a F5 load balancer. Each web server has identical applications to the other. There was no issue until the config of the load balancer changed from source address persistence to least connections. Now in some applications I receieve this error Server Error in '/' Application. Validation of viewstate MAC failed. If this application is hosted by a Web Farm or cluster, ensure that configuration specifies the same validationKey and validation algorithm. AutoGenerate cannot be used in a cluster. Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.Web.HttpException: Validation of viewstate MAC failed. If this application is hosted by a Web Farm or cluster, ensure that configuration specifies the same validationKey and validation algorithm. AutoGenerate cannot be used in a cluster. Source Error: The source code that generated this unhandled exception can only be shown when compiled in debug mode. To enable this, please follow one of the below steps, then request the URL: Add a "Debug=true" directive at the top of the file that generated the error. Example: or: 2) Add the following section to the configuration file of your application: Note that this second technique will cause all files within a given application to be compiled in debug mode. The first technique will cause only that particular file to be compiled in debug mode. Important: Running applications in debug mode does incur a memory/performance overhead. You should make sure that an application has debugging disabled before deploying into production scenario. How do I add a machine key to the machine.config file? Do I do it at server level in IIS or at website/application level for each site? Does the validation and decryption keys have to be the same across both web servers or are they different? Should they be different for each machine.config version of .net? I cannot find any documentation of this scenario.

    Read the article

  • Puppet and launchd services?

    - by Joel Westberg
    We have a production environment configured with Puppet, and want to be able to set up a similar environment on our development machines: a mix of Red Hats, Ubuntus and OSX. As might be expected, OSX is the odd man out here, and sadly, I'm having a lot of trouble with getting this to work. My first attempt was using macports, using the following declaration: package { 'rabbitmq-server': ensure => installed, provider => macports, } but this, sadly, generates the following error: Error: /Stage[main]/Rabbitmq/Package[rabbitmq-server]: Could not evaluate: Execution of '/opt/local/bin/port -q installed rabbitmq-server' returned 1: usage: cut -b list [-n] [file ...] cut -c list [file ...] cut -f list [-s] [-d delim] [file ...] while executing "exec dscl -q . -read /Users/$env(SUDO_USER) NFSHomeDirectory | cut -d ' ' -f 2" (procedure "mportinit" line 95) invoked from within "mportinit ui_options global_options global_variations" Next up, I figured I'd give homebrew a try. There is no package provider available by default, but puppet-homebrew seemed promising. Here, I got much farther, and actually managed to get the install to work. package { 'rabbitmq': ensure => installed, provider => brew, } file { "plist": path => "/Library/LaunchDaemons/homebrew.mxcl.rabbitmq.plist", source => "/usr/local/opt/rabbitmq/homebrew.mxcl.rabbitmq.plist", ensure => present, owner => root, group => wheel, mode => 0644, } service { "homebrew.mxcl.rabbitmq": enable => true, ensure => running, provider => "launchd", require => [ File["/Library/LaunchDaemons/homebrew.mxcl.rabbitmq.plist"] ], } Here, I don't get any error. But RabbitMQ doesn't start either (as it does if I do a manual load with launchctl) [... snip ...] Debug: Executing '/bin/launchctl list' Debug: Executing '/usr/bin/plutil -convert xml1 -o /dev/stdout /Library/LaunchDaemons/homebrew.mxcl.rabbitmq.plist' Debug: Executing '/usr/bin/plutil -convert xml1 -o /dev/stdout /var/db/launchd.db/com.apple.launchd/overrides.plist' Debug: /Schedule[weekly]: Skipping device resources because running on a host Debug: /Schedule[puppet]: Skipping device resources because running on a host Debug: Finishing transaction 2248294820 Debug: Storing state Debug: Stored state in 0.01 seconds Finished catalog run in 25.90 seconds What am I doing wrong?

    Read the article

  • Text template or tool for documentation of computer configurations

    - by mjustin
    I regularly write and update technical documentation which will be used to set up a new virtual machine, or to have a lookup for system dependencies in networks with around 20-50 (server-side) computers. At the moment I use OpenOffice Writer with text tables, and create one document per intranet domain. To improve this documentation, I would like to collect some examples to identify areas where my documents can be improved, regarding general structure and content, to make it easy to read and use not only for me but also for technical staff, helpdesk etc. Are there simple text templates (for example for OpenOffice Writer) or tools (maybe database-driven) for structured documentation of a computer configuration? Such a template / tool should provide required and optional configuration sections, like 'operating system', 'installed services', 'mapped network drives', 'scheduled tasks', 'remote servers', 'logon user account', 'firewall settings', 'hard disk size' ... It is not so much low-level hardware docs but more infrastructure / integration information in these documents (no BIOS settings, MAC addresses).

    Read the article

  • Play framework 2.2 using Upstart 1.5 (Ubuntu 12.04)

    - by Leon Radley
    I'm trying to get Play 2.2 working with upstart. I've been running Play 2.x with upstart since it's release and it's never been a problem. But since the release of 2.2 and the change to http://www.scala-sbt.org/sbt-native-packager/ play doesn't want to start any more. Here's the config I'm using description "PlayFramework 2.2" version "2.2" env APP=myapp env USER=myuser env GROUP=www-data env HOME=/home/myuser/app env PORT=9000 env ADDRESS=127.0.0.1 env CONFIG=production.conf env JAVAOPTS="-J-Xms128M -J-Xmx512m -J-server" start on runlevel [2345] stop on runlevel [06] respawn respawn limit 10 5 expect daemon # If you want the upstart script to build play with sbt pre-start script chdir $HOME sbt clean compile stage -mem $SBTMEM end script exec start-stop-daemon --pidfile ${HOME}/RUNNING_PID --chuid $USER:$GROUP --exec ${HOME}/bin/${APP} --background --start -- -Dconfig.resource=$CONFIG -Dhttp.address=$ADDRESS -Dhttp.port=$PORT $JAVAOPTS I've changed the JAVAOPTS to include the -J- and I've also changed the path to use the new startscript located in the /bin/ dir. I've read that upstart 1.4 has setuid and setguid. I've tried removing the start-stop-daemon but I haven't got that working either. Any suggestions would be appreciated.

    Read the article

  • Text on Cisco ASA console is garbled/missing letters

    - by Some Linux Nerd
    I've actually looked up a number of solutions for this problem and none of them work. There's this Cisco ASA 5505 that I'd like to use, that outputs mildly garbled text with missing characters. I did some googling and found that the most likely problem is a bad baud rate, so I tried all the baud rates, 7N1, 8N2... basically every possibility minicom had. Then I figured (since I can type ok, just not read) that if I factory reset it that it would fix whatever is set wrong with the terminal. That didn't work either. This usb-db9 adapter and console cable work fine on the catalyst switch in our office. My serial settings are 9600 8N1 with no flow control. Anyone know how to fix this? I have an example of the text on pastebin: http://pastebin.com/MAJF0mVU - it's just lots of "Dfaut cnfiuraionfil cotais 1enty." instead of "Default configuration blah blah"

    Read the article

  • Load Balancing Linux Web Services and Change Config Without Restart

    - by Eric J.
    What options are available to load balance web service traffic on Linux with the ability to add or remove servers from the server pool without restarting the load balancer? This post: http://serverfault.com/questions/71437/mod-proxy-change-without-restart looks like a very promising way to switch between two servers, but I don't know enough about mod_proxy and mod_rewrite to understand how/if I can use an external file to specify the BalancerMember entries for a section. Are there other open source load balancers that support reconfiguration without restart?

    Read the article

  • Apache proxy to two local services

    - by thaweatherman
    I currently have one service running locally on a machine and apache is handling doing a proxy pass to it on the root. However I now also have another service I want to use a proxy pass with when a certain directory is accessed. So servername.com/ goes to one and servername.com/specialdir goes to the other. I currently have a virtualhost handling the former. How would I go about adding in the latter?

    Read the article

  • Converting PDF portfolios to plain text (pdftotext?)

    - by Andrea
    I am trying to convert a large number of PDFs (~15000) to plain text using pdftotext. This is working pretty well except for a few of the PDFs (~600) which, I guess, are "PDF portfolios." When I run these PDFs through pdftotext, it just outputs: For the best experience, open this PDF portfolio in Acrobat 9 or Adobe Reader 9, or later. Get Adobe Reader Now! If I do open these PDFs in Adobe Reader, they look like two or more PDFs inside a single file. Has anyone encountered this issue before? Is there any tool I can use to convert these PDFs automatically? (Either directly to text or at least to regular PDFs that pdftotext can then understand.)

    Read the article

  • Starting services in batch file on windows 7

    - by Dima
    I have a fairly simple batch file which does just one thing - "net start myservice". This batch file gets shortcut-ed in a program group by installer so that users can simply click on the icon and get things started (or stopped). All works well in XP for the users with admin rights. But things get hairy on Win7 as the batch need to be run "as administrator" explicitly and often users don't know this. So my question is how to make this friendly? Telling users to right click and run as admin on Win7 and simply click on XP is kind of weird twist. I need a smart automatic simple thingy. I could probably use "runas/user:administrator" in the batch itself, but this "administrator" account might not be available on some machines. I'm looking for a universal solution for installing things like this on any Windows box. Ideas? How would you do this?

    Read the article

  • Cannot connect to MySQL on RDS (Amazon Web Services) from my laptop

    - by Bruno Reis
    I'm having some trouble connecting to a MySQL 5.1 server on an RDS instance on AWS from my laptop. The detailed description of the problem is here: https://forums.aws.amazon.com/thread.jspa?messageID=323397 In short: I have 2 MySQL servers, both with the same db configuration and firewall (security group) configuration. One of them works fine: I can connect to it from my EC2 instances (ie, from inside the AWS cloud) and from my laptop. The other one doesn't: I can connect from my EC2 instances but not from my laptop. The symptom: a connection attempt from my laptop just hangs, and then times out, as if there was a firewall blocking me (ie, silently dropping my SYN packets). I must say that everything has been working fine for a very long time, and this problem began suddenly, 3 days ago, without any modifications to DB parameters or the security groups. My current analysis of the situation: The firewall (ie, security group) cannot be the problem: both MySQL servers share the same firewall configuration -- I can connect to one of them but not to the other. Later on, I even added a rule to allow inbound connections from 0.0.0.0/0 (ie, I turned off the firewall), and nothing. Oh, I also created a new, fresh security group and changed this instance's SG to the new one (to which I first added my ip address, and then 0.0.0.0/0) but still nothing. The credentials cannot be the problem: I use the same from my laptop and from my EC2 instances -- and the user (which is what Amazon calls master user), in the database, has a host of '%'. MySQL is not blocking my IP due to, say, too many failed connection attemps: I've FLUSH HOSTS on the database, and also I tried to connect using many different source IP addresses, even from all around the world through a VPN proxy service. What could I be missing? I'm asking here because it's been about 36 hours since I've posted on AWS forums but got no answer at all over there... someone here might have a solution! Any input is really appreciated, I'm out of ideas. Thanks!

    Read the article

  • SQL Server 2008 R2 Writing To Text File

    - by zzzzzzzzzzzzzzzzzzzzzzzzzzzzzz
    I used to write to text files from SQL Server using the code listed below: DECLARE @FS INT --File System Object DECLARE @OLEResult INT --Result message/code DECLARE @FileID INT --Pointer to file --Create file system object (OLE Object) EXECUTE @OLEResult = sp_OACreate 'Scripting.FileSystemObject', @FS OUT IF @OLEResult <> 0 PRINT 'Scripting.FileSystemObject.Failed' -----OPEN FILE----- EXECUTE @OLEResult = sp_OAMethod @FS, 'OpenTextFile', @FileID OUT, @FileName, 8, 1 IF @OLEResult <> 0 PRINT 'OpenTextFile.Failed' It appears this is no longer supported in sql server 2008 r2. How should I export to text files in sql server 2008 r2? Link claiming this is no longer supported: http://social.msdn.microsoft.com/Forums/en/transactsql/thread/f8512bec-915c-44a2-ba9d-e679f98ba313

    Read the article

  • Using iTunes within Terminal Services 2008 R2 - Pitfalls etc

    - by Kristiaan
    I was hoping to get some further information on any possible Do's and Don't when it comes to installing, using and maintaining iTunes within a Termina Server environment. We have come across a situation in our company whereby some of our users who are using thin clients now need the ability to sync, update and manage their devices, previously they used either standard desktop systems or laptops so there was no issue with running iTunes. I have not found much information on the web about using iTunes within a Terminal Server Farm, Id like to find out if iTunes works within the environment, any known or common issues that occur due to running it like this.

    Read the article

  • Tversity DNLA services with Xbox 360

    - by NoCarrier
    I'm hosting a Tversity instance on my Windows 2008 server and sharing some media. My PS3 detects this as a DNLA device and can play back the media just fine. Tversity shows up on my Xbox 360, but when i click on it, it just loads and loads and after a minute it times out and tells me it can't connect. Has anyone successfully gotten this working?

    Read the article

  • Win Server 2003 - Task Scheduler - Tasks with GUI and Services

    - by august_month
    I need to run excel macro daily. I scheduled it with Windows Scheduler and it worked fine until I had to change my password. I wonder if it's possible to have a task scheduled without a password? As alternative we have third party scheduling software, but this software cannot launch excel. The tech support said that since excel has gui and scheduling software runs as service with "Allow to interact to Desktop" disabled, it cannot launch excel. Also tech support mentioned that "Allow to interact to Desktop" is not supported as of Vista. I totally trust tech support guy, I just need a work around that would make my network administrator and me happy. Regards.

    Read the article

  • how to acces host services in virtual box with out additional networking

    - by jspeshu
    i have ubuntu 10.04 and virtual box running win xp now i want to test my page layout in ie so i want to access apache from with in my virtual box how can i set up this with out additional networking on the host (i.e. i want to have some kind'a peer to peer connection between the host and the guest) EDIT: auto eth0 iface eth0 inet static address 192.168.0.100 netmask 255.255.255.0 network 192.168.0.0 broadcast 192.168.0.255 gateway 192.168.0.1 and for the win xp i gave a static ip address 192.168.0.200 netmask 255.255.255.0 gateway 192.168.0.1

    Read the article

  • How to blacklist Terminal Services startup environment setting?

    - by JBurace
    I have a user in Active Directory who uses this setting in the Environment tab: Start the following program at logon: "C:\Program Files\PName\Folder\gui.exe" This runs okay on various computers (that are on the domain) including his own. But the user needs to RDP into a Windows Server which does not have this program (which is normal). When the user RDPs into the server and logs in with the AD account, an error occurs about C:\Program Files\PName\Folder\gui.exe missing and the user then gets stuck at a grey screen. The user needs to RDP into this server; how can one blacklist that Environment setting from activation on a specific machine on the domain?

    Read the article

  • Replace special text with sed?

    - by user143822
    I'm using CMD on Windows Xp to replace special text with Sed. I'm using this command for replace special characters like $ or * : sed -i "s/\*/123/g;" 1.txt But how command must i use to replace this strings with ciao! in my text files? Is possible? \\ \\\ "" sed.exe -i "s/{\*)(//123/ sed -i "s/\\/123/g;" 1.txt the previous command does not work because i have \, " and other special strings that sed use to make regex.

    Read the article

  • online reminder services

    - by Remus Rigo
    hi all I used a few years ago an online birthday reminder site and now i just can't find it. Does anyone know a good site that provides reminders (that sends alert mails)... (if this is the wrong place to post this question please suggest another site) thanks

    Read the article

  • web services access not being reached thru the web browser [closed]

    - by Tony
    I am trying to reference my .asmx webservices in .NET but my server is not exposed to the internet. When I put on the following address I get the message mentioned below. What's the reason for not being able to see the directory? Am I missing something in my IIS configuraction? Am I missing anything in my permissions? Just as reference I have other folders with webservices and I have the same issue. When I login to the server I am doing it with my windows user and password (I am using windows authentication). It's necessary to mention that when I put the URL I am getting a popup screen to put in my userid and password but it seems that's not able to validate since keeps asking me a couple of times. Let me know if you need more information to address this issue . http://appsvr02/Inetpub/wwwroot/DevWebApi/ Internet Explorer cannot display the webpage What you can try: It appears you are connected to the Internet, but you might want to try to reconnect to the Internet. Retype the address. Go back to the previous page. Most likely causes: •You are not connected to the Internet. •The website is encountering problems. •There might be a typing error in the address. More information This problem can be caused by a variety of issues, including: •Internet connectivity has been lost. •The website is temporarily unavailable. •The Domain Name Server (DNS) is not reachable. •The Domain Name Server (DNS) does not have a listing for the website's domain. •If this is an HTTPS (secure) address, click tools, click Internet Options, click Advanced, and check to be sure the SSL and TLS protocols are enabled under the security section. For offline users You can still view subscribed feeds and some recently viewed webpages. To view subscribed feeds 1.Click the Favorites Center button , click Feeds, and then click the feed you want to view. To view recently visited webpages (might not work on all pages) 1.Click Tools , and then click Work Offline. 2.Click the Favorites Center button , click History, and then click the page you want to view.

    Read the article

  • KB972455 Windows Server Update Services 3.0 SP2

    - by Sniek NL
    Dear people, My Small Business Server 2003 failed to install this update SP2 for WSUS3.0. The update is not available for rollback. WSUS 3.0 is not to be found in my software configscreen or startup menu. Some files have been deleted from the hard drive and last but not least. The service will not run and .NET runtime errors keep flooding my logs. Question. How to remove an update or program which is not listed in add/remove software anymore. Since the update it fails to run WSUS. Event-id: 0 Category: none Source: .NET Runtime ERROR: This error keeps flooding my logs. I am hesitant to roll back to a system restore point since exchange is running on the same disks.... :)

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Create text file named after a cell containing other cell data

    - by user143041
    I tried using the code below for the Excel program on my `Mac Mini using the OS X Version 10.7.2 and it keeps saying Error due to file name / path: (The Excel file I am creating is going to be a template with my formulas and macros installed which will be used over and over). Sub CreateFile() Do While Not IsEmpty(ActiveCell.Offset(0, 1)) MyFile = ActiveCell.Value & ".txt" fnum = FreeFile() Open MyFile For Output As fnum Print #fnum, ActiveCell.Offset(0, 1) & " " & ActiveCell.Offset(0, 2) Close #fnum ActiveCell.Offset(1, 0).Select Loop End Sub What Im trying to do: 1st Objective I would like to have the following data to be used to create a text file. A:A is what I need the name of the file to be. B:2 is the content I need in the text file. So, A2 - "repair-video-game-Glassboro-NJ-08028.txt" is the file name and B2 to be the content in the file. Next, A3 is the file name and B3 is the content for the file, etc. ONCE the content reads what is in cell A16 and B16 (length will vary), the file creation should stop, if not then I can delete the additional files created. This sheet will never change. Is there a way to establish the excel macro to always go to this sheet instead of have to select it with the mouse to identify the starting point? 2nd Objective I would like to have the following data to be used to create a text file. A:1 is what I need the name of the file to be. B:B is the content I want in the file. So, A2 - is the file name "geo-sitemap.xml" and B:B to be the content in the file (ignore the .xml file extension in the photo). ONCE the content cell reads what is in cell "B16" (length will vary), the file creation should stop, if not then I can adjust the cells that have need content (formulated content you see in the image is preset for 500 rows). This sheet will never change. Is there a way to establish the excel macro to always go to this sheet instead of have to select it with the mouse to identify the starting point? I can Provide the content in the cells that are filled in by excel formulas that are not not to be included in the .txt files. It is ok if it is not possible. I can delete the extra cells that are not populated (based on the data sheet). Please let me know if you need any more additional information or clarity and I will be happy to provide it.

    Read the article

  • Remote connection issue with Sql Server 2005 with SMS and Services but not IIS

    - by Mallioch
    Here is the situation: I have a Server 2008 box that is trying to connect to a Sql Server 2005 instance. Connections from websites running in the context of IIS work fine to the Sql Server machine using Sql Server authentication. Rockin'. However, using the same connection string, I cannot get a windows service on the same box to communicate with the Sql Server. Nor can I get management studio to connect from the same box. IIS great, other options no so much. For grins I have tried monkeying with the user accounts in the IIS app pools to match that of the service to get the sites to break and that hasn't worked, so it doesn't appear to be a user account issue. Since this is happening with two different programs and not with IIS, I'm assuming there is something shut down on the Sql Server that needs to allow non-IIS connecting things to communicate, but I have no idea what that would be. Any help would be appreciated.

    Read the article

  • How to put text in same row but different column if a certain text is present in the same row?

    - by melai
    How can I put text in the same row but different column if a certain text is present in the same row? Issue Area Correction Done Process changed bin Process skip lap converted to global Security done global migration Process changed bin How can I code this in a macro? For example: If the correction done is in the cell, the Issue should be Process automatically. If the word global is present the Issue should be Security. I have 500 rows and I want to have the code until row 500.

    Read the article

< Previous Page | 231 232 233 234 235 236 237 238 239 240 241 242  | Next Page >