Search Results

Search found 30301 results on 1213 pages for 'content db'.

Page 242/1213 | < Previous Page | 238 239 240 241 242 243 244 245 246 247 248 249  | Next Page >

  • How to use Binary Log file for Auditing and Replicating in MySQL?

    - by Pranav
    How to use Binary Log file for Auditing in MySQL? I want to track the change in a DB using Binary Log so that I can replicate these changes to other DB please do not give me hyperlinks for MySQL website. please direct me to find the solution I have looked for auditing options and created a script using Triggers for that, but due toi the Joomla DB structure it did'nt worked for me, hence I have to move on to Binary Log file concept now i am stucked in initiating the concept as I am not getting the concept of making the server master/slave, so can any body guide me how to actually initiate it via PHP?

    Read the article

  • DBD::mysql gives mysql_init not found

    - by highBandWidth
    I have to install a non-admin copy of mysql and perl module DBD::mysql in my home directory. I installed mysql in ~/software/db/mysql and this works since I can start and stop the server and go to the mysql prompt. Then, I downloaded the perl module and installed it using perl Makefile.PL PREFIX=~/myperl/ LIB=~/myperl/lib/lib64/perl5/ --mysql_config=/my_home/software/db/mysql/bin/mysql_config --libs=/myhome/software/db/mysql/lib/libmysqlclient.a make make install I did this to use the statically linked mysql client library. perl -MDBD::mysql -e 1 gives no errors. However, when I actually try to use the module, I get /usr/bin/perl: symbol lookup error: /myhome/myperl/lib/lib64/perl5/x86_64-linux-thread-multi/auto/DBD/mysql/mysql.so: undefined symbol: mysql_init

    Read the article

  • zero downtime during database scheme upgrade on SQL 2008

    - by eject
    I have web application on IIS7 with SQL server 2008 as RDBMS. Need get 0 downtime during future upgrades of ASP.NET code and DB schema as well. I need to get right scenario for this. I have 2 web servers and 2 sql servers and one http load balancer whcih allows to switch web backend server for web requests. Main goal is to make 1st web server and DB server up and running, update code and db schema on 2nd server and then switch all the requests to 2nd server and then main problem - how to copy data from 1st database 2nd (which was changed during upgrade).

    Read the article

  • Is allowing remote Sql Server Management Studio safe?

    - by dave thieben
    I administer a website that runs on IIS on one box, and SQL Server 2008 Workgroup on another box. typically I remote into the DB box and run SSMS to work on the db, but I would like to be able to access the db directly with SSMS on my local box. I've seen the other questions about allowing remote access to the database, but my question is, is this safe? I'm concerned that I'm opening a hole in the firewall and potential for hack attempts. Is this just a bad idea in general?

    Read the article

  • MS Access 2007 end user access

    - by LtDan
    I need some good advise. I have used Access for many years and I use Sharepoint but never the two combined. My newly created Access db needs to be shared with many users across the organization. The back end is SQL and the old way to distribute the database would be placing the db on a shared drive, connecting their PC ODBC connections to the SQL db and then they would open the database and have at it. This has become the OLD way. What is the best (and simpliest) way to allow the end users to utilize a frontend for data entry/edit reporting etc. Can I create a link through SharePoint and the user just open it from there. Your good advise is greatly approciated.

    Read the article

  • htaccess not found

    - by clarkk
    I have installed a Apache 2 (from webmin) server on Debian 6.. I have setup a virtual host db.domain.com on the server which works fine, but .htaccess doesn't work if you get access from the ip address and the directory is listed if no index.php is found? db.domain.com -> 403 forbidden xxx.xxx.xxx.xxx -> gets access to the server Why is .htaccess omitted when you get access from the servers ip address? httpd.conf <Directory *> Options -Indexes FollowSymLinks </Directory> <VirtualHost *:80> ServerName db.domain.com DocumentRoot /var/www </VirtualHost> htaccess order deny,allow deny from all

    Read the article

  • Backup all plesk MySQL Databases to individual files

    - by Michael
    Hy, Because I'm new to shell scripting I need a hand. I currently backup all mydatabases to a single file, thing that makes the restore preaty hard. The second problem that my MySQL password dosen't work because of a Plesk bug and i get the password from "/etc/psa/.psa.shadow". Here is the code that I use to backup all my databases to a single file. mysqldump -uadmin -p`cat /etc/psa/.psa.shadow` --all-databases | bzip2 -c > /root/21.10.2013.sql.bz2 I found some scripts on the web that backup each database to individual files but I don't know how to make them work for my situation. Here is a example script: for db in $(mysql -e 'show databases' -s --skip-column-names); do mysqldump $db | gzip > "/backups/mysqldump-$(hostname)-$db-$(date +%Y-%m-%d-%H.%M.%S).gz"; done Can someone help me make the script above work for my situation? Requirements: Backup each database to individual file using plesk password location.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • sql server: losing identity column on export/import

    - by Y.G.J
    Recently I started dealing with SQL Server, my previous experience was in MS-Access. When I'm doing an import/export of a db, from the server to my computer or even in the server, all column with primary key loose the key. Identity is set to false and even bit is not set to the default. How can I can I use an import/export job to make an exact copy of the db and its data? I don't want to have to perform a backup and restore every time I want the same db somewhere else, for another project, etc. I have read about "edit mapping" and the checkbox but that did not helped with the identity specification... and what about the primary key of the tables and the rest of the things?

    Read the article

  • minimum required bandwidth for remote database server

    - by user66734
    I want to build a small warehousing application for my company. We have a central warehouse which distributes to 8 sales points across the country. They insist on an in-house solution. I am thinking to setup a central mySQL db Linux server and have the branches connect to it to store sales. Queries to the db from the branches will be minimum, maybe 10 per hour. However I need all the branches to be able to store each sale data ( product ID, customer ID ) in the central db at peak time at most once every five minutes. My question is can I get away with simple 24mbps/768kbps DSL lines? If not what is the bandwith requirement? Can I rely on a load balancing router to combine additional lines if needed? Can you propose some server hardware specs?

    Read the article

  • RewriteMap syntax Regex

    - by ienabellamy
    in my .htaccess i've tons of directives, with same syntax: RewriteRule ^(.*)/PRODUCT_1.aspx http://www.site.com/product.php?id_product=2891 RewriteRule ^(.*)/PRODUCT_2.aspx http://www.site.com/product.php?id_product=2896 and everything works. Now, i created a RewriteMap in my because i need to increase velocity (20.000 redirect 301 in htaccess no good), so: RewriteEngine On RewriteMap redirects dbm=db:/var/www/html/presta152/prestashop/redirects.db RewriteCond ${redirects:$1} !="" RewriteRule ^(.*)$ ${redirects:$1} [redirect=permanent,last] and my redirects.db is created by redirects.txt, that contains: /PRODUCT_1.aspx http://www.site.com/product.php?id_product=2891 /PRODUCT_2.aspx http://www.site.com/product.php?id_product=2896 this works if i try to call for example: www.site.com/PRODUCT_1.aspx i'm redirected... but if i try to call www.site.com/everythingpossibileinside/PRODUCT_1.aspx the redirect doesn't work. So, in my .htaccess this rule: RewriteRule ^(.*)/PRODUCT_1.aspx http://www.site.com/product.php?id_product=2891 works, but in my RewriteMap no. I think i must change this directive: RewriteRule ^(.*)$ ${redirects:$1} [redirect=permanent,last] i tried, but unsuccessful. Thanks to all.

    Read the article

  • Two way replication

    - by Nidzaaaa
    I have a little problem... I have this case: -2 server instances -2 Databases -1 Table (5 columns) From server 1 I created publication to replicate all columns of table I have in 1. DB From server 2 I created subscription to pull all columns from table which is in server 1 DB But now, I need to publicate one columns of same table from server 2 to server 1 and also it has to be in same DB... I tried with using logic and creating publication for server 2 and subscription on server 1 but there is error appearing "You have selected the Publisher as a Subscriber and entered a subscription database that is the same as the publishing database. Select another subscription database." I hope someone understood my problem and have an answer for me, thanks in advance... p.s. Ask for more info if you need ...

    Read the article

  • Passing integer lists in a sql query, best practices

    - by Artiom Chilaru
    I'm currently looking at ways to pass lists of integers in a SQL query, and try to decide which of them is best in which situation, what are the benefots of each, and what are the pitfalls, what should be avoided :) Right now I know of 3 ways that we currently use in our application. 1) Table valued parameter: Create a new Table Valued Parameter in sql server: CREATE TYPE [dbo].[TVP_INT] AS TABLE( [ID] [int] NOT NULL ) Then run the query against it: using (var conn = new SqlConnection(DataContext.GetDefaultConnectionString)) { var comm = conn.CreateCommand(); comm.CommandType = CommandType.Text; comm.CommandText = @" UPDATE DA SET [tsLastImportAttempt] = CURRENT_TIMESTAMP FROM [Account] DA JOIN @values IDs ON DA.ID = IDs.ID"; comm.Parameters.Add(new SqlParameter("values", downloadResults.Select(d => d.ID).ToDataTable()) { TypeName = "TVP_INT" }); conn.Open(); comm.ExecuteScalar(); } The major disadvantages of this method is the fact that Linq doesn't support table valued params (if you create an SP with a TVP param, linq won't be able to run it) :( 2) Convert the list to Binary and use it in Linq! This is a bit better.. Create an SP, and you can run it within linq :) To do this, the SP will have an IMAGE parameter, and we'll be using a user defined function (udf) to convert this to a table.. We currently have implementations of this function written in C++ and in assembly, both have pretty much the same performance :) Basically, each integer is represented by 4 bytes, and passed to the SP. In .NET we have an extension method that convers an IEnumerable to a byte array The extension method: public static Byte[] ToBinary(this IEnumerable intList) { return ToBinaryEnum(intList).ToArray(); } private static IEnumerable<Byte> ToBinaryEnum(IEnumerable<Int32> intList) { IEnumerator<Int32> marker = intList.GetEnumerator(); while (marker.MoveNext()) { Byte[] result = BitConverter.GetBytes(marker.Current); Array.Reverse(result); foreach (byte b in result) yield return b; } } The SP: CREATE PROCEDURE [Accounts-UpdateImportAttempts] @values IMAGE AS BEGIN UPDATE DA SET [tsLastImportAttempt] = CURRENT_TIMESTAMP FROM [Account] DA JOIN dbo.udfIntegerArray(@values, 4) IDs ON DA.ID = IDs.Value4 END And we can use it by running the SP directly, or in any linq query we need using (var db = new DataContext()) { db.Accounts_UpdateImportAttempts(downloadResults.Select(d => d.ID).ToBinary()); // or var accounts = db.Accounts .Where(a => db.udfIntegerArray(downloadResults.Select(d => d.ID).ToBinary(), 4) .Select(i => i.Value4) .Contains(a.ID)); } This method has the benefit of using compiled queries in linq (which will have the same sql definition, and query plan, so will also be cached), and can be used in SPs as well. Both these methods are theoretically unlimited, so you can pass millions of ints at a time :) 3) The simple linq .Contains() It's a more simple approach, and is perfect in simple scenarios. But is of course limited by this. using (var db = new DataContext()) { var accounts = db.Accounts .Where(a => downloadResults.Select(d => d.ID).Contains(a.ID)); } The biggest drawback of this method is that each integer in the downloadResults variable will be passed as a separate int.. In this case, the query is limited by sql (max allowed parameters in a sql query, which is a couple of thousand, if I remember right). So I'd like to ask.. What do you think is the best of these, and what other methods and approaches have I missed?

    Read the article

  • Does anyone know how to appropriately deal with user timezones in rails 2.3?

    - by Amazing Jay
    We're building a rails app that needs to display dates (and more importantly, calculate them) in multiple timezones. Can anyone point me towards how to work with user timezones in rails 2.3(.5 or .8) The most inclusive article I've seen detailing how user time zones are supposed to work is here: http://wiki.rubyonrails.org/howtos/time-zones... although it is unclear when this was written or for what version of rails. Specifically it states that: "Time.zone - The time zone that is actually used for display purposes. This may be set manually to override config.time_zone on a per-request basis." Keys terms being "display purposes" and "per-request basis". Locally on my machine, this is true. However on production, neither are true. Setting Time.zone persists past the end of the request (to all subsequent requests) and also affects the way AR saves to the DB (basically treating any date as if it were already in UTC even when its not), thus saving completely inappropriate values. We run Ruby Enterprise Edition on production with passenger. If this is my problem, do we need to switch to JRuby or something else? To illustrate the problem I put the following actions in my ApplicationController right now: def test p_time = Time.now.utc s_time = Time.utc(p_time.year, p_time.month, p_time.day, p_time.hour) logger.error "TIME.ZONE" + Time.zone.inspect logger.error ENV['TZ'].inspect logger.error p_time.inspect logger.error s_time.inspect jl = JunkLead.create! jl.date_at = s_time logger.error s_time.inspect logger.error jl.date_at.inspect jl.save! logger.error s_time.inspect logger.error jl.date_at.inspect render :nothing => true, :status => 200 end def test2 Time.zone = 'Mountain Time (US & Canada)' logger.error "TIME.ZONE" + Time.zone.inspect logger.error ENV['TZ'].inspect render :nothing => true, :status => 200 end def test3 Time.zone = 'UTC' logger.error "TIME.ZONE" + Time.zone.inspect logger.error ENV['TZ'].inspect render :nothing => true, :status => 200 end and they yield the following: Processing ApplicationController#test (for 98.202.196.203 at 2010-12-24 22:15:50) [GET] TIME.ZONE#<ActiveSupport::TimeZone:0x2c57a68 @tzinfo=#<TZInfo::DataTimezone: Etc/UTC>, @name="UTC", @utc_offset=0> nil Fri Dec 24 22:15:50 UTC 2010 Fri Dec 24 22:00:00 UTC 2010 Fri Dec 24 22:00:00 UTC 2010 Fri, 24 Dec 2010 22:00:00 UTC +00:00 Fri Dec 24 22:00:00 UTC 2010 Fri, 24 Dec 2010 22:00:00 UTC +00:00 Completed in 21ms (View: 0, DB: 4) | 200 OK [http://www.dealsthatmatter.com/test] Processing ApplicationController#test2 (for 98.202.196.203 at 2010-12-24 22:15:53) [GET] TIME.ZONE#<ActiveSupport::TimeZone:0x2c580a8 @tzinfo=#<TZInfo::DataTimezone: America/Denver>, @name="Mountain Time (US & Canada)", @utc_offset=-25200> nil Completed in 143ms (View: 1, DB: 3) | 200 OK [http://www.dealsthatmatter.com/test2] Processing ApplicationController#test (for 98.202.196.203 at 2010-12-24 22:15:59) [GET] TIME.ZONE#<ActiveSupport::TimeZone:0x2c580a8 @tzinfo=#<TZInfo::DataTimezone: America/Denver>, @name="Mountain Time (US & Canada)", @utc_offset=-25200> nil Fri Dec 24 22:15:59 UTC 2010 Fri Dec 24 22:00:00 UTC 2010 Fri Dec 24 22:00:00 UTC 2010 Fri, 24 Dec 2010 15:00:00 MST -07:00 Fri Dec 24 22:00:00 UTC 2010 Fri, 24 Dec 2010 15:00:00 MST -07:00 Completed in 20ms (View: 0, DB: 4) | 200 OK [http://www.dealsthatmatter.com/test] Processing ApplicationController#test3 (for 98.202.196.203 at 2010-12-24 22:16:03) [GET] TIME.ZONE#<ActiveSupport::TimeZone:0x2c57a68 @tzinfo=#<TZInfo::DataTimezone: Etc/UTC>, @name="UTC", @utc_offset=0> nil Completed in 17ms (View: 0, DB: 2) | 200 OK [http://www.dealsthatmatter.com/test3] Processing ApplicationController#test (for 98.202.196.203 at 2010-12-24 22:16:04) [GET] TIME.ZONE#<ActiveSupport::TimeZone:0x2c57a68 @tzinfo=#<TZInfo::DataTimezone: Etc/UTC>, @name="UTC", @utc_offset=0> nil Fri Dec 24 22:16:05 UTC 2010 Fri Dec 24 22:00:00 UTC 2010 Fri Dec 24 22:00:00 UTC 2010 Fri, 24 Dec 2010 22:00:00 UTC +00:00 Fri Dec 24 22:00:00 UTC 2010 Fri, 24 Dec 2010 22:00:00 UTC +00:00 Completed in 151ms (View: 0, DB: 4) | 200 OK [http://www.dealsthatmatter.com/test] It should be clear above that the 2nd call to /test shows Time.zone set to Mountain, even though it shouldn't. Additionally, checking the database reveals that the test action when run after test2 saved a JunkLead record with a date of 2010-12-22 15:00:00, which is clearly wrong.

    Read the article

  • Dropdownlist post in ASP.NET MVC3 and Entity Framework Model

    - by Josh Blade
    I have 3 tables: RateProfile RateProfileID ProfileName Rate RateID RateProfileID PanelID Other stuff to update Panel PanelID PanelName I have models for each of these. I have an edit page using the RateProfile model. I display the information for RateProfile and also all of the Rates associated with it. This works fine and I can update it fine. However, I also added a dropdown so that I can filter Rates by PanelID. I need it to post back on change so that it can display the filtered rates. I'm using @Html.DropDownList("PanelID", (SelectList)ViewData["PanelDropDown"], new { onchange = "$('#RateForm').submit()" }) for my dropdownlist. Whenever it posts back to my HttpPost Edit method though, it seems to be missing all information about the Rates navigation property. It's weird because I thought it would do exactly what the input/submit button that I have in the form does (which actually passes the entire model back to my HttpPost Edit action and does what I want it to do). The panelID is properly being passed to my HttpPost Edit method and on to the next view, but when I try to query the Model.Rates navigation property is null (only when the post comes from the dropdown. Everything works fine when the post comes from my submit input). Get Edit: public ActionResult Edit(int id, int panelID = 1) { RateProfile rateprofile = db.RateProfiles.Single(r => r.RateProfileID == id); var panels = db.Panels; ViewData["PanelDropDown"] = new SelectList(panels, "PanelID", "PanelName", panelID); ViewBag.PanelID = panelID; return View(rateprofile); } HttpPost Edit: [HttpPost] public ActionResult Edit(RateProfile rateprofile, int panelID) { var panels = db.Panels; ViewData["PanelDropDown"] = new SelectList(panels, "PanelID", "PanelName", panelID); ViewBag.PanelID = panelID; if (ModelState.IsValid) { db.Entry(rateprofile).State = EntityState.Modified; foreach (Rate dimerate in rateprofile.Rates) { db.Entry(dimerate).State = EntityState.Modified; } db.SaveChanges(); return View(rateprofile); } return View(rateprofile); } View: @model PDR.Models.RateProfile @using (Html.BeginForm(null,null,FormMethod.Post, new {id="RateForm"})) { <div> @Html.Label("Panel") @Html.DropDownList("PanelID", (SelectList)ViewData["PanelDropDown"], new { onchange = "$('#RateForm').submit()" }) </div> @{var rates= Model.Rates.Where(a => a.PanelID == ViewBag.PanelID).OrderBy(a => a.minCount).ToList();} @for (int i = 0; i < rates.Count; i++) { <tr> <td> @Html.HiddenFor(modelItem => rates[i].RateProfileID) @Html.HiddenFor(modelItem => rates[i].RateID) @Html.HiddenFor(modelItem => rates[i].PanelID) @Html.EditorFor(modelItem => rates[i].minCount) @Html.ValidationMessageFor(model => rates[i].minCount) </td> <td> @Html.EditorFor(modelItem => rates[i].maxCount) @Html.ValidationMessageFor(model => rates[i].maxCount) </td> <td> @Html.EditorFor(modelItem => rates[i].Amount) @Html.ValidationMessageFor(model => rates[i].Amount) </td> </tr> } <input type="submit" value="Save" /> } To summarize my problem, the below query in my view only works when the post comes from the submit button and not when it comes from my dropdownlist. @{var rates= Model.Rates.Where(a => a.PanelID == ViewBag.PanelID).OrderBy(a => a.minCount).ToList();}

    Read the article

  • Entity Framework version 1- Brief Synopsis and Tips &ndash; Part 1

    - by Rohit Gupta
    To Do Eager loading use Projections (for e.g. from c in context.Contacts select c, c.Addresses)  or use Include Query Builder Methods (Include(“Addresses”)) If there is multi-level hierarchical Data then to eager load all the relationships use Include Query Builder methods like customers.Include("Order.OrderDetail") to include Order and OrderDetail collections or use customers.Include("Order.OrderDetail.Location") to include all Order, OrderDetail and location collections with a single include statement =========================================================================== If the query uses Joins then Include() Query Builder method will be ignored, use Nested Queries instead If the query does projections then Include() Query Builder method will be ignored Use Address.ContactReference.Load() OR Contact.Addresses.Load() if you need to Deferred Load Specific Entity – This will result in extra round trips to the database ObjectQuery<> cannot return anonymous types... it will return a ObjectQuery<DBDataRecord> Only Include method can be added to Linq Query Methods Any Linq Query method can be added to Query Builder methods. If you need to append a Query Builder Method (other than Include) after a LINQ method  then cast the IQueryable<Contact> to ObjectQuery<Contact> and then append the Query Builder method to it =========================================================================== Query Builder methods are Select, Where, Include Methods which use Entity SQL as parameters e.g. "it.StartDate, it.EndDate" When Query Builder methods do projection then they return ObjectQuery<DBDataRecord>, thus to iterate over this collection use contact.Item[“Name”].ToString() When Linq To Entities methods do projection, they return collection of anonymous types --- thus the collection is strongly typed and supports Intellisense EF Object Context can track changes only on Entities, not on Anonymous types. If you use a Defining Query for a EntitySet then the EntitySet becomes readonly since a Defining Query is the same as a View (which is treated as a ReadOnly by default). However if you want to use this EntitySet for insert/update/deletes then we need to map stored procs (as created in the DB) to the insert/update/delete functions of the Entity in the Designer You can use either Execute method or ToList() method to bind data to datasources/bindingsources If you use the Execute Method then remember that you can traverse through the ObjectResult<> collection (returned by Execute) only ONCE. In WPF use ObservableCollection to bind to data sources , for keeping track of changes and letting EF send updates to the DB automatically. Use Extension Methods to add logic to Entities. For e.g. create extension methods for the EntityObject class. Create a method in ObjectContext Partial class and pass the entity as a parameter, then call this method as desired from within each entity. ================================================================ DefiningQueries and Stored Procedures: For Custom Entities, one can use DefiningQuery or Stored Procedures. Thus the Custom Entity Collection will be populated using the DefiningQuery (of the EntitySet) or the Sproc. If you use Sproc to populate the EntityCollection then the query execution is immediate and this execution happens on the Server side and any filters applied will be applied in the Client App. If we use a DefiningQuery then these queries are composable, meaning the filters (if applied to the entityset) will all be sent together as a single query to the DB, returning only filtered results. If the sproc returns results that cannot be mapped to existing entity, then we first create the Entity/EntitySet in the CSDL using Designer, then create a dummy Entity/EntitySet using XML in the SSDL. When creating a EntitySet in the SSDL for this dummy entity, use a TSQL that does not return any results, but does return the relevant columns e.g. select ContactID, FirstName, LastName from dbo.Contact where 1=2 Also insure that the Entity created in the SSDL uses the SQL DataTypes and not .NET DataTypes. If you are unable to open the EDMX file in the designer then note the Errors ... they will give precise info on what is wrong. The Thrid option is to simply create a Native Query in the SSDL using <Function Name="PaymentsforContact" IsComposable="false">   <CommandText>SELECT ActivityId, Activity AS ActivityName, ImagePath, Category FROM dbo.Activities </CommandText></FuncTion> Then map this Function to a existing Entity. This is a quick way to get a custom Entity which is regular Entity with renamed columns or additional columns (which are computed columns). The disadvantage to using this is that It will return all the rows from the Defining query and any filter (if defined) will be applied only at the Client side (after getting all the rows from DB). If you you DefiningQuery instead then we can use that as a Composable Query. The Fourth option (for mapping a READ stored proc results to a non-existent Entity) is to create a View in the Database which returns all the fields that the sproc also returns, then update the Model so that the model contains this View as a Entity. Then map the Read Sproc to this View Entity. The other option would be to simply create the View and remove the sproc altogether. ================================================================ To Execute a SProc that does not return a entity, use a EntityCommand to execute that proc. You cannot call a sproc FunctionImport that does not return Entities From Code, the only way is to use SSDL function calls using EntityCommand.  This changes with EntityFramework Version 4 where you can return Scalar Types, Complex Types, Entities or NonQuery ================================================================ UDF when created as a Function in SSDL, we need to set the Name & IsComposable properties for the Function element. IsComposable is always false for Sprocs, for UDF's set this to true. You cannot call UDF "Function" from within code since you cannot import a UDF Function into the CSDL Model (with Version 1 of EF). only stored procedures can be imported and then mapped to a entity ================================================================ Entity Framework requires properties that are involved in association mappings to be mapped in all of the function mappings for the entity (Insert, Update and Delete). Because Payment has an association to Reservation... hence we need to pass both the paymentId and reservationId to the Delete sproc even though just the paymentId is the PK on the Payment Table. ================================================================ When mapping insert, update and delete procs to a Entity, insure that all the three or none are mapped. Further if you have a base class and derived class in the CSDL, then you must map (ins, upd, del) sprocs to all parent and child entities in the inheritance relationship. Note that this limitation that base and derived entity methods must all must be mapped does not apply when you are mapping Read Stored Procedures.... ================================================================ You can write stored procedures SQL directly into the SSDL by creating a Function element in the SSDL and then once created, you can map this Function to a CSDL Entity directly in the designer during Function Import ================================================================ You can do Entity Splitting such that One Entity maps to multiple tables in the DB. For e.g. the Customer Entity currently derives from Contact Entity...in addition it also references the ContactPersonalInfo Entity. One can copy all properties from the ContactPersonalInfo Entity into the Customer Entity and then Delete the CustomerPersonalInfo entity, finall one needs to map the copied properties to the ContactPersonalInfo Table in Table Mapping (by adding another table (ContactPersonalInfo) to the Table Mapping... this is called Entity Splitting. Thus now when you insert a Customer record, it will automatically create SQL to insert records into the Contact, Customers and ContactPersonalInfo tables even though you have a Single Entity called Customer in the CSDL =================================================================== There is Table by Type Inheritance where another EDM Entity can derive from another EDM entity and absorb the inherted entities properties, for example in the Break Away Geek Adventures EDM, the Customer entity derives (inherits) from the Contact Entity and absorbs all the properties of Contact entity. Thus when you create a Customer Entity in Code and then call context.SaveChanges the Object Context will first create the TSQL to insert into the Contact Table followed by a TSQL to insert into the Customer table =================================================================== Then there is the Table per Hierarchy Inheritance..... where different types are created based on a condition (similar applying a condition to filter a Entity to contain filtered records)... the diference being that the filter condition populates a new Entity Type (derived from the base Entity). In the BreakAway sample the example is Lodging Entity which is a Abstract Entity and Then Resort and NonResort Entities which derive from Lodging Entity and records are filtered based on the value of the Resort Boolean field =================================================================== Then there is Table per Concrete Type Hierarchy where we create a concrete Entity for each table in the database. In the BreakAway sample there is a entity for the Reservation table and another Entity for the OldReservation table even though both the table contain the same number of fields. The OldReservation Entity can then inherit from the Reservation Entity and configure the OldReservation Entity to remove all Scalar Properties from the Entity (since it inherits the properties from Reservation and filters based on ReservationDate field) =================================================================== Complex Types (Complex Properties) Entities in EF can also contain Complex Properties (in addition to Scalar Properties) and these Complex Properties reference a ComplexType (not a EntityType) DropdownList, ListBox, RadioButtonList, CheckboxList, Bulletedlist are examples of List server controls (not data bound controls) these controls cannot use Complex properties during databinding, they need Scalar Properties. So if a Entity contains Complex properties and you need to bind those to list server controls then use projections to return Scalar properties and bind them to the control (the disadvantage is that projected collections are not tracked by the Object Context and hence cannot persist changes to the projected collections bound to controls) ObjectDataSource and EntityDataSource do account for Complex properties and one can bind entities with Complex Properties to Data Source controls and they will be tracked for changes... with no additional plumbing needed to persist changes to these collections bound to controls So DataBound controls like GridView, FormView need to use EntityDataSource or ObjectDataSource as a datasource for entities that contain Complex properties so that changes to the datasource done using the GridView can be persisted to the DB (enabling the controls for updates)....if you cannot use the EntityDataSource you need to flatten the ComplexType Properties using projections With EF Version 4 ComplexTypes are supported by the Designer and can add/remove/compose Complex Types directly using the Designer =================================================================== Conditional Mapping ... is like Table per Hierarchy Inheritance where Entities inherit from a base class and then used conditions to populate the EntitySet (called conditional Mapping). Conditional Mapping has limitations since you can only use =, is null and IS NOT NULL Conditions to do conditional mapping. If you need more operators for filtering/mapping conditionally then use QueryView(or possibly Defining Query) to create a readonly entity. QueryView are readonly by default... the EntitySet created by the QueryView is enabled for change tracking by the ObjectContext, however the ObjectContext cannot create insert/update/delete TSQL statements for these Entities when SaveChanges is called since it is QueryView. One way to get around this limitation is to map stored procedures for the insert/update/delete operations in the Designer. =================================================================== Difference between QueryView and Defining Query : QueryView is defined in the (MSL) Mapping File/section of the EDM XML, whereas the DefiningQuery is defined in the store schema (SSDL). QueryView is written using Entity SQL and is this database agnostic and can be used against any database/Data Layer. DefiningQuery is written using Database Lanaguage i.e. TSQL or PSQL thus you have more control =================================================================== Performance: Lazy loading is deferred loading done automatically. lazy loading is supported with EF version4 and is on by default. If you need to turn it off then use context.ContextOptions.lazyLoadingEnabled = false To improve Performance consider PreCompiling the ObjectQuery using the CompiledQuery.Compile method

    Read the article

  • Need help with PHP web app bootstrapping error potentially related to Zend [migrated]

    - by Matt Shepherd
    I am trying to get a program called OpenFISMA running on an Ubuntu AMI in AWS. The app is not really coded on the Ubuntu platform, but I am in my comfort zone there, and have tried both CentOS and OpenSUSE (both are sort of "native" for the app) for getting it working with the same or worse results. So, why not just get it working on Ubuntu? Anyway, the app is found here: www.openfisma.org and an install guide is found here: https://openfisma.atlassian.net/wiki/display/030100/Installation+Guide The install guide kind of sucks. It doesn't list dependencies in any coherent way or provide much of any detail (does not even mention Zend once on the entire page) so I've done a lot of work to divine the information I do have. This page provided some dependency inf (though again, Zend is not mentioned once): https://openfisma.atlassian.net/wiki/display/PUBLIC/RPM+Management#RPMManagement-BasicOverviewofRPMPackages Anyway, I got all the way through the install (so far as I could reconstruct it). I am going to the login page for the first time, and there should be some sort of bootstrapping occurring when I load the page. (I am not a programmer so I have no idea what it is doing there.) Anyway, I get a message on the web page that says: "An exception occurred while bootstrapping the application." So, then I go look in /var/www/data/logs/php.log and find this message: [22-Oct-2013 17:29:18 UTC] PHP Fatal error: Uncaught exception 'Zend_Exception' with message 'No entry is registered for key 'Zend_Log'' in /var/www/library/Zend/Registry.php:147 Stack trace: #0 /var/www/public/index.php(188): Zend_Registry::get('Zend_Log') #1 {main} thrown in /var/www/library/Zend/Registry.php on line 147 This occurs every time I load the page. I gather there is an issue related to registering the Zend_Log variable in the Zend registry, but other than that I really have no idea what to do about it. Am I missing a package that it needs, or is this app not coded to register the variables properly? I have no clue. Any help is greatly appreciated. The application file referenced in the log message (index.php) is included below. <?php /** * Copyright (c) 2008 Endeavor Systems, Inc. * * This file is part of OpenFISMA. * * OpenFISMA is free software: you can redistribute it and/or modify it under the terms of the GNU General Public * License as published by the Free Software Foundation, either version 3 of the License, or (at your option) any later * version. * * OpenFISMA is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied * warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more * details. * * You should have received a copy of the GNU General Public License along with OpenFISMA. If not, see * {@link http://www.gnu.org/licenses/}. */ try { defined('APPLICATION_PATH') || define( 'APPLICATION_PATH', realpath(dirname(__FILE__) . '/../application') ); // Define application environment defined('APPLICATION_ENV') || define( 'APPLICATION_ENV', (getenv('APPLICATION_ENV') ? getenv('APPLICATION_ENV') : 'production') ); set_include_path( APPLICATION_PATH . '/../library/Symfony/Components' . PATH_SEPARATOR . APPLICATION_PATH . '/../library' . PATH_SEPARATOR . get_include_path() ); require_once 'Fisma.php'; require_once 'Zend/Application.php'; $application = new Zend_Application( APPLICATION_ENV, APPLICATION_PATH . '/config/application.ini' ); Fisma::setAppConfig($application->getOptions()); Fisma::initialize(Fisma::RUN_MODE_WEB_APP); $application->bootstrap()->run(); } catch (Zend_Config_Exception $zce) { // A zend config exception indicates that the application may not be installed properly echo '<h1>The application is not installed correctly</h1>'; $zceMsg = $zce->getMessage(); if (stristr($zceMsg, 'parse_ini_file') !== false) { if (stristr($zceMsg, 'application.ini') !== false) { if (stristr($zceMsg, 'No such file or directory') !== false) { echo 'The ' . APPLICATION_PATH . '/config/application.ini file is missing.'; } elseif (stristr($zceMsg, 'Permission denied') !== false) { echo 'The ' . APPLICATION_PATH . '/config/application.ini file does not have the ' . 'appropriate permissions set for the application to read it.'; } else { echo 'An ini-parsing error has occured in ' . APPLICATION_PATH . '/config/application.ini ' . '<br/>Please check this file and make sure everything is setup correctly.'; } } else if (stristr($zceMsg, 'database.ini') !== false) { if (stristr($zceMsg, 'No such file or directory') !== false) { echo 'The ' . APPLICATION_PATH . '/config/database.ini file is missing.<br/>'; echo 'If you find a database.ini.template file in the config directory, edit this file ' . 'appropriately and rename it to database.ini'; } elseif (stristr($zceMsg, 'Permission denied') !== false) { echo 'The ' . APPLICATION_PATH . '/config/database.ini file does not have the appropriate ' . 'permissions set for the application to read it.'; } else { echo 'An ini-parsing error has occured in ' . APPLICATION_PATH . '/config/database.ini ' . '<br/>Please check this file and make sure everything is setup correctly.'; } } else { echo 'An ini-parsing error has occured. <br/>Please check all configuration files and make sure ' . 'everything is setup correctly'; } } elseif (stristr($zceMsg, 'syntax error') !== false) { if (stristr($zceMsg, 'application.ini') !== false) { echo 'There is a syntax error in ' . APPLICATION_PATH . '/config/application.ini ' . '<br/>Please check this file and make sure everything is setup correctly.'; } elseif (stristr($zceMsg, 'database.ini') !== false) { echo 'There is a syntax error in ' . APPLICATION_PATH . '/config/database.ini ' . '<br/>Please check this file and make sure everything is setup correctly.'; } else { echo 'A syntax error has been reached. <br/>Please check all configuration files and make sure ' . 'everything is setup correctly.'; } } else { // Then the exception message says nothing about parse_ini_file nor 'syntax error' echo 'Please check all configuration files, and ensure all settings are valid.'; } echo '<br/>For more information and help on installing OpenFISMA, please refer to the ' . '<a target="_blank" href="http://manual.openfisma.org/display/ADMIN/Installation">' . 'Installation Guide</a>'; } catch (Doctrine_Manager_Exception $dme) { echo '<h1>An exception occurred while bootstrapping the application.</h1>'; // Does database.ini have valid settings? Or is it the same content as database.ini.template? $databaseIniFail = false; $iniData = file(APPLICATION_PATH . '/config/database.ini'); $iniData = str_replace(chr(10), '', $iniData); if (in_array('db.adapter = ##DB_ADAPTER##', $iniData)) { $databaseIniFail = true; } if (in_array('db.host = ##DB_HOST##', $iniData)) { $databaseIniFail = true; } if (in_array('db.port = ##DB_PORT##', $iniData)) { $databaseIniFail = true; } if (in_array('db.username = ##DB_USER##', $iniData)) { $databaseIniFail = true; } if (in_array('db.password = ##DB_PASS##', $iniData)) { $databaseIniFail = true; } if (in_array('db.schema = ##DB_NAME##', $iniData)) { $databaseIniFail = true; } if ($databaseIniFail) { echo 'You have not applied the settings in ' . APPLICATION_PATH . '/config/database.ini appropriately. ' . 'Please review the contents of this file and try again.'; } else { if (Fisma::debug()) { echo '<p>' . get_class($dme) . '</p><p>' . $dme->getMessage() . '</p><p>' . "<p><pre>Stack Trace:\n" . $dme->getTraceAsString() . '</pre></p>'; } else { $logString = get_class($dme) . "\n" . $dme->getMessage() . "\nStack Trace:\n" . $dme->getTraceAsString() . "\n"; Zend_Registry::get('Zend_Log')->err($logString); } } } catch (Exception $exception) { // If a bootstrap exception occurs, that indicates a serious problem, such as a syntax error. // We won't be able to do anything except display an error. echo '<h1>An exception occurred while bootstrapping the application.</h1>'; if (Fisma::debug()) { echo '<p>' . get_class($exception) . '</p><p>' . $exception->getMessage() . '</p><p>' . "<p><pre>Stack Trace:\n" . $exception->getTraceAsString() . '</pre></p>'; } else { $logString = get_class($exception) . "\n" . $exception->getMessage() . "\nStack Trace:\n" . $exception->getTraceAsString() . "\n"; Zend_Registry::get('Zend_Log')->err($logString); } }

    Read the article

  • My ASP.NET news sources

    - by Jon Galloway
    I just posted about the ASP.NET Daily Community Spotlight. I was going to list a bunch of my news sources at the end, but figured this deserves a separate post. I've been following a lot of development blogs for a long time - for a while I subscribed to over 1500 feeds and read them all. That doesn't scale very well, though, and it's really time consuming. Since the community spotlight requires an interesting ASP.NET post every day of the year, I've come up with a few sources of ASP.NET news. Top Link Blogs Chris Alcock's The Morning Brew is a must-read blog which highlights each day's best blog posts across the .NET community. He covers the entire Microsoft development, but generally any of the top ASP.NET posts I see either have already been listed on The Morning Brew or will be there soon. Elijah Manor posts a lot of great content, which is available in his Twitter feed at @elijahmanor, on his Delicious feed, and on a dedicated website - Web Dev Tweets. While not 100% ASP.NET focused, I've been appreciating Joe Stagner's Weekly Links series, partly since he includes a lot of links that don't show up on my other lists. Twitter Over the past few years, I've been getting more and more of my information from my Twitter network (as opposed to RSS or other means). Twitter is as good as your network, so if getting good information off Twitter sounds crazy, you're probably not following the right people. I already mentioned Elijah Manor (@elijahmanor). I follow over a thousand people on Twitter, so I'm not going to try to pick and choose a list, but one good way to get started building out a Twitter network is to follow active Twitter users on the ASP.NET team at Microsoft: @scottgu (well, not on the ASP.NET team, but their great grand boss, and always a great source of ASP.NET info) @shanselman @haacked @bradwilson @davidfowl @InfinitiesLoop @davidebbo @marcind @DamianEdwards @stevensanderson @bleroy @humancompiler @osbornm @anurse I'm sure I'm missing a few, and I'll update the list. Building a Twitter network that follows topics you're interested in allows you to use other tools like Cadmus to automatically summarize top content by leveraging the collective input of many users. Twitter Search with Topsy You can search Twitter for hashtags (like #aspnet, #aspnetmvc, and #webmatrix) to get a raw view of what people are talking about on Twitter. Twitter's search is pretty poor; I prefer Topsy. Here's an example search for the #aspnetmvc hashtag: http://topsy.com/s?q=%23aspnetmvc You can also do combined queries for several tags: http://topsy.com/s?q=%23aspnetmvc+OR+%23aspnet+OR+%23webmatrix Paper.li Paper.li is a handy service that builds a custom daily newspaper based on your social network. They've turned a lot of people off by automatically tweeting "The SuperDevFoo Daily is out!!!" messages (which can be turned off), but if you're ignoring them because of those message, you're missing out on a handy, free service. My paper.li page includes content across a lot of interests, including ASP.NET: http://paper.li/jongalloway When I want to drill into a specific tag, though, I'll just look at the Paper.li post for that hashtag. For example, here's the #aspnetmvc paper.li page: http://paper.li/tag/aspnetmvc Delicious I mentioned previously that I use Delicious for managing site links. I also use their network and search features. The tag based search is pretty good: Even better, though, is that I can see who's bookmarked these links, and add them to my Delicious network. After having built out a network, I can optimize by doing less searching and more leaching leveraging of collective intelligence. Community Sites I scan DotNetKicks, the weblogs.asp.net combined feed, and the ASP.NET Community page, CodeBetter, Los Techies,  CodeProject,  and DotNetSlackers from time to time. They're hit and miss, but they do offer more of an opportunity for finding original content which others may have missed. Terms of Enrampagement When someone's on a tear, I just manually check their sites more often. I could use RSS for that, but it changes pretty often. I just keep a mental note of people who are cranking out a lot of good content and check their sites more often. What works for you?

    Read the article

  • Silverlight Recruiting Application Part 5 - Jobs Module / View

    Now we starting getting into a more code-heavy portion of this series, thankfully though this means the groundwork is all set for the most part and after adding the modules we will have a complete application that can be provided with full source. The Jobs module will have two concerns- adding and maintaining jobs that can then be broadcast out to the website. How they are displayed on the site will be handled by our admin system (which will just poll from this common database), so we aren't too concerned with that, but rather with getting the information into the system and allowing the backend administration/HR users to keep things up to date. Since there is a fair bit of information that we want to display, we're going to move editing to a separate view so we can get all that information in an easy-to-use spot. With all the files created for this module, the project looks something like this: And now... on to the code. XAML for the Job Posting View All we really need for the Job Posting View is a RadGridView and a few buttons. This will let us both show off records and perform operations on the records without much hassle. That XAML is going to look something like this: 01.<Grid x:Name="LayoutRoot" 02.Background="White"> 03.<Grid.RowDefinitions> 04.<RowDefinition Height="30" /> 05.<RowDefinition /> 06.</Grid.RowDefinitions> 07.<StackPanel Orientation="Horizontal"> 08.<Button x:Name="xAddRecordButton" 09.Content="Add Job" 10.Width="120" 11.cal:Click.Command="{Binding AddRecord}" 12.telerik:StyleManager.Theme="Windows7" /> 13.<Button x:Name="xEditRecordButton" 14.Content="Edit Job" 15.Width="120" 16.cal:Click.Command="{Binding EditRecord}" 17.telerik:StyleManager.Theme="Windows7" /> 18.</StackPanel> 19.<telerikGrid:RadGridView x:Name="xJobsGrid" 20.Grid.Row="1" 21.IsReadOnly="True" 22.AutoGenerateColumns="False" 23.ColumnWidth="*" 24.RowDetailsVisibilityMode="VisibleWhenSelected" 25.ItemsSource="{Binding MyJobs}" 26.SelectedItem="{Binding SelectedJob, Mode=TwoWay}" 27.command:SelectedItemChangedEventClass.Command="{Binding SelectedItemChanged}"> 28.<telerikGrid:RadGridView.Columns> 29.<telerikGrid:GridViewDataColumn Header="Job Title" 30.DataMemberBinding="{Binding JobTitle}" 31.UniqueName="JobTitle" /> 32.<telerikGrid:GridViewDataColumn Header="Location" 33.DataMemberBinding="{Binding Location}" 34.UniqueName="Location" /> 35.<telerikGrid:GridViewDataColumn Header="Resume Required" 36.DataMemberBinding="{Binding NeedsResume}" 37.UniqueName="NeedsResume" /> 38.<telerikGrid:GridViewDataColumn Header="CV Required" 39.DataMemberBinding="{Binding NeedsCV}" 40.UniqueName="NeedsCV" /> 41.<telerikGrid:GridViewDataColumn Header="Overview Required" 42.DataMemberBinding="{Binding NeedsOverview}" 43.UniqueName="NeedsOverview" /> 44.<telerikGrid:GridViewDataColumn Header="Active" 45.DataMemberBinding="{Binding IsActive}" 46.UniqueName="IsActive" /> 47.</telerikGrid:RadGridView.Columns> 48.</telerikGrid:RadGridView> 49.</Grid> I'll explain what's happening here by line numbers: Lines 11 and 16: Using the same type of click commands as we saw in the Menu module, we tie the button clicks to delegate commands in the viewmodel. Line 25: The source for the jobs will be a collection in the viewmodel. Line 26: We also bind the selected item to a public property from the viewmodel for use in code. Line 27: We've turned the event into a command so we can handle it via code in the viewmodel. So those first three probably make sense to you as far as Silverlight/WPF binding magic is concerned, but for line 27... This actually comes from something I read onDamien Schenkelman's blog back in the day for creating an attached behavior from any event. So, any time you see me using command:Whatever.Command, the backing for it is actually something like this: SelectedItemChangedEventBehavior.cs: 01.public class SelectedItemChangedEventBehavior : CommandBehaviorBase<Telerik.Windows.Controls.DataControl> 02.{ 03.public SelectedItemChangedEventBehavior(DataControl element) 04.: base(element) 05.{ 06.element.SelectionChanged += new EventHandler<SelectionChangeEventArgs>(element_SelectionChanged); 07.} 08.void element_SelectionChanged(object sender, SelectionChangeEventArgs e) 09.{ 10.// We'll only ever allow single selection, so will only need item index 0 11.base.CommandParameter = e.AddedItems[0]; 12.base.ExecuteCommand(); 13.} 14.} SelectedItemChangedEventClass.cs: 01.public class SelectedItemChangedEventClass 02.{ 03.#region The Command Stuff 04.public static ICommand GetCommand(DependencyObject obj) 05.{ 06.return (ICommand)obj.GetValue(CommandProperty); 07.} 08.public static void SetCommand(DependencyObject obj, ICommand value) 09.{ 10.obj.SetValue(CommandProperty, value); 11.} 12.public static readonly DependencyProperty CommandProperty = 13.DependencyProperty.RegisterAttached("Command", typeof(ICommand), 14.typeof(SelectedItemChangedEventClass), new PropertyMetadata(OnSetCommandCallback)); 15.public static void OnSetCommandCallback(DependencyObject dependencyObject, DependencyPropertyChangedEventArgs e) 16.{ 17.DataControl element = dependencyObject as DataControl; 18.if (element != null) 19.{ 20.SelectedItemChangedEventBehavior behavior = GetOrCreateBehavior(element); 21.behavior.Command = e.NewValue as ICommand; 22.} 23.} 24.#endregion 25.public static SelectedItemChangedEventBehavior GetOrCreateBehavior(DataControl element) 26.{ 27.SelectedItemChangedEventBehavior behavior = element.GetValue(SelectedItemChangedEventBehaviorProperty) as SelectedItemChangedEventBehavior; 28.if (behavior == null) 29.{ 30.behavior = new SelectedItemChangedEventBehavior(element); 31.element.SetValue(SelectedItemChangedEventBehaviorProperty, behavior); 32.} 33.return behavior; 34.} 35.public static SelectedItemChangedEventBehavior GetSelectedItemChangedEventBehavior(DependencyObject obj) 36.{ 37.return (SelectedItemChangedEventBehavior)obj.GetValue(SelectedItemChangedEventBehaviorProperty); 38.} 39.public static void SetSelectedItemChangedEventBehavior(DependencyObject obj, SelectedItemChangedEventBehavior value) 40.{ 41.obj.SetValue(SelectedItemChangedEventBehaviorProperty, value); 42.} 43.public static readonly DependencyProperty SelectedItemChangedEventBehaviorProperty = 44.DependencyProperty.RegisterAttached("SelectedItemChangedEventBehavior", 45.typeof(SelectedItemChangedEventBehavior), typeof(SelectedItemChangedEventClass), null); 46.} These end up looking very similar from command to command, but in a nutshell you create a command based on any event, determine what the parameter for it will be, then execute. It attaches via XAML and ties to a DelegateCommand in the viewmodel, so you get the full event experience (since some controls get a bit event-rich for added functionality). Simple enough, right? Viewmodel for the Job Posting View The Viewmodel is going to need to handle all events going back and forth, maintaining interactions with the data we are using, and both publishing and subscribing to events. Rather than breaking this into tons of little pieces, I'll give you a nice view of the entire viewmodel and then hit up the important points line-by-line: 001.public class JobPostingViewModel : ViewModelBase 002.{ 003.private readonly IEventAggregator eventAggregator; 004.private readonly IRegionManager regionManager; 005.public DelegateCommand<object> AddRecord { get; set; } 006.public DelegateCommand<object> EditRecord { get; set; } 007.public DelegateCommand<object> SelectedItemChanged { get; set; } 008.public RecruitingContext context; 009.private QueryableCollectionView _myJobs; 010.public QueryableCollectionView MyJobs 011.{ 012.get { return _myJobs; } 013.} 014.private QueryableCollectionView _selectionJobActionHistory; 015.public QueryableCollectionView SelectedJobActionHistory 016.{ 017.get { return _selectionJobActionHistory; } 018.} 019.private JobPosting _selectedJob; 020.public JobPosting SelectedJob 021.{ 022.get { return _selectedJob; } 023.set 024.{ 025.if (value != _selectedJob) 026.{ 027._selectedJob = value; 028.NotifyChanged("SelectedJob"); 029.} 030.} 031.} 032.public SubscriptionToken editToken = new SubscriptionToken(); 033.public SubscriptionToken addToken = new SubscriptionToken(); 034.public JobPostingViewModel(IEventAggregator eventAgg, IRegionManager regionmanager) 035.{ 036.// set Unity items 037.this.eventAggregator = eventAgg; 038.this.regionManager = regionmanager; 039.// load our context 040.context = new RecruitingContext(); 041.this._myJobs = new QueryableCollectionView(context.JobPostings); 042.context.Load(context.GetJobPostingsQuery()); 043.// set command events 044.this.AddRecord = new DelegateCommand<object>(this.AddNewRecord); 045.this.EditRecord = new DelegateCommand<object>(this.EditExistingRecord); 046.this.SelectedItemChanged = new DelegateCommand<object>(this.SelectedRecordChanged); 047.SetSubscriptions(); 048.} 049.#region DelegateCommands from View 050.public void AddNewRecord(object obj) 051.{ 052.this.eventAggregator.GetEvent<AddJobEvent>().Publish(true); 053.} 054.public void EditExistingRecord(object obj) 055.{ 056.if (_selectedJob == null) 057.{ 058.this.eventAggregator.GetEvent<NotifyUserEvent>().Publish("No job selected."); 059.} 060.else 061.{ 062.this._myJobs.EditItem(this._selectedJob); 063.this.eventAggregator.GetEvent<EditJobEvent>().Publish(this._selectedJob); 064.} 065.} 066.public void SelectedRecordChanged(object obj) 067.{ 068.if (obj.GetType() == typeof(ActionHistory)) 069.{ 070.// event bubbles up so we don't catch items from the ActionHistory grid 071.} 072.else 073.{ 074.JobPosting job = obj as JobPosting; 075.GrabHistory(job.PostingID); 076.} 077.} 078.#endregion 079.#region Subscription Declaration and Events 080.public void SetSubscriptions() 081.{ 082.EditJobCompleteEvent editComplete = eventAggregator.GetEvent<EditJobCompleteEvent>(); 083.if (editToken != null) 084.editComplete.Unsubscribe(editToken); 085.editToken = editComplete.Subscribe(this.EditCompleteEventHandler); 086.AddJobCompleteEvent addComplete = eventAggregator.GetEvent<AddJobCompleteEvent>(); 087.if (addToken != null) 088.addComplete.Unsubscribe(addToken); 089.addToken = addComplete.Subscribe(this.AddCompleteEventHandler); 090.} 091.public void EditCompleteEventHandler(bool complete) 092.{ 093.if (complete) 094.{ 095.JobPosting thisJob = _myJobs.CurrentEditItem as JobPosting; 096.this._myJobs.CommitEdit(); 097.this.context.SubmitChanges((s) => 098.{ 099.ActionHistory myAction = new ActionHistory(); 100.myAction.PostingID = thisJob.PostingID; 101.myAction.Description = String.Format("Job '{0}' has been edited by {1}", thisJob.JobTitle, "default user"); 102.myAction.TimeStamp = DateTime.Now; 103.eventAggregator.GetEvent<AddActionEvent>().Publish(myAction); 104.} 105., null); 106.} 107.else 108.{ 109.this._myJobs.CancelEdit(); 110.} 111.this.MakeMeActive(this.regionManager, "MainRegion", "JobPostingsView"); 112.} 113.public void AddCompleteEventHandler(JobPosting job) 114.{ 115.if (job == null) 116.{ 117.// do nothing, new job add cancelled 118.} 119.else 120.{ 121.this.context.JobPostings.Add(job); 122.this.context.SubmitChanges((s) => 123.{ 124.ActionHistory myAction = new ActionHistory(); 125.myAction.PostingID = job.PostingID; 126.myAction.Description = String.Format("Job '{0}' has been added by {1}", job.JobTitle, "default user"); 127.myAction.TimeStamp = DateTime.Now; 128.eventAggregator.GetEvent<AddActionEvent>().Publish(myAction); 129.} 130., null); 131.} 132.this.MakeMeActive(this.regionManager, "MainRegion", "JobPostingsView"); 133.} 134.#endregion 135.public void GrabHistory(int postID) 136.{ 137.context.ActionHistories.Clear(); 138._selectionJobActionHistory = new QueryableCollectionView(context.ActionHistories); 139.context.Load(context.GetHistoryForJobQuery(postID)); 140.} Taking it from the top, we're injecting an Event Aggregator and Region Manager for use down the road and also have the public DelegateCommands (just like in the Menu module). We also grab a reference to our context, which we'll obviously need for data, then set up a few fields with public properties tied to them. We're also setting subscription tokens, which we have not yet seen but I will get into below. The AddNewRecord (50) and EditExistingRecord (54) methods should speak for themselves for functionality, the one thing of note is we're sending events off to the Event Aggregator which some module, somewhere will take care of. Since these aren't entirely relying on one another, the Jobs View doesn't care if anyone is listening, but it will publish AddJobEvent (52), NotifyUserEvent (58) and EditJobEvent (63)regardless. Don't mind the GrabHistory() method so much, that is just grabbing history items (visibly being created in the SubmitChanges callbacks), and adding them to the database. Every action will trigger a history event, so we'll know who modified what and when, just in case. ;) So where are we at? Well, if we click to Add a job, we publish an event, if we edit a job, we publish an event with the selected record (attained through the magic of binding). Where is this all going though? To the Viewmodel, of course! XAML for the AddEditJobView This is pretty straightforward except for one thing, noted below: 001.<Grid x:Name="LayoutRoot" 002.Background="White"> 003.<Grid x:Name="xEditGrid" 004.Margin="10" 005.validationHelper:ValidationScope.Errors="{Binding Errors}"> 006.<Grid.Background> 007.<LinearGradientBrush EndPoint="0.5,1" 008.StartPoint="0.5,0"> 009.<GradientStop Color="#FFC7C7C7" 010.Offset="0" /> 011.<GradientStop Color="#FFF6F3F3" 012.Offset="1" /> 013.</LinearGradientBrush> 014.</Grid.Background> 015.<Grid.RowDefinitions> 016.<RowDefinition Height="40" /> 017.<RowDefinition Height="40" /> 018.<RowDefinition Height="40" /> 019.<RowDefinition Height="100" /> 020.<RowDefinition Height="100" /> 021.<RowDefinition Height="100" /> 022.<RowDefinition Height="40" /> 023.<RowDefinition Height="40" /> 024.<RowDefinition Height="40" /> 025.</Grid.RowDefinitions> 026.<Grid.ColumnDefinitions> 027.<ColumnDefinition Width="150" /> 028.<ColumnDefinition Width="150" /> 029.<ColumnDefinition Width="300" /> 030.<ColumnDefinition Width="100" /> 031.</Grid.ColumnDefinitions> 032.<!-- Title --> 033.<TextBlock Margin="8" 034.Text="{Binding AddEditString}" 035.TextWrapping="Wrap" 036.Grid.Column="1" 037.Grid.ColumnSpan="2" 038.FontSize="16" /> 039.<!-- Data entry area--> 040. 041.<TextBlock Margin="8,0,0,0" 042.Style="{StaticResource LabelTxb}" 043.Grid.Row="1" 044.Text="Job Title" 045.VerticalAlignment="Center" /> 046.<TextBox x:Name="xJobTitleTB" 047.Margin="0,8" 048.Grid.Column="1" 049.Grid.Row="1" 050.Text="{Binding activeJob.JobTitle, Mode=TwoWay, NotifyOnValidationError=True, ValidatesOnExceptions=True}" 051.Grid.ColumnSpan="2" /> 052.<TextBlock Margin="8,0,0,0" 053.Grid.Row="2" 054.Text="Location" 055.d:LayoutOverrides="Height" 056.VerticalAlignment="Center" /> 057.<TextBox x:Name="xLocationTB" 058.Margin="0,8" 059.Grid.Column="1" 060.Grid.Row="2" 061.Text="{Binding activeJob.Location, Mode=TwoWay, NotifyOnValidationError=True, ValidatesOnExceptions=True}" 062.Grid.ColumnSpan="2" /> 063. 064.<TextBlock Margin="8,11,8,0" 065.Grid.Row="3" 066.Text="Description" 067.TextWrapping="Wrap" 068.VerticalAlignment="Top" /> 069. 070.<TextBox x:Name="xDescriptionTB" 071.Height="84" 072.TextWrapping="Wrap" 073.ScrollViewer.VerticalScrollBarVisibility="Auto" 074.Grid.Column="1" 075.Grid.Row="3" 076.Text="{Binding activeJob.Description, Mode=TwoWay, NotifyOnValidationError=True, ValidatesOnExceptions=True}" 077.Grid.ColumnSpan="2" /> 078.<TextBlock Margin="8,11,8,0" 079.Grid.Row="4" 080.Text="Requirements" 081.TextWrapping="Wrap" 082.VerticalAlignment="Top" /> 083. 084.<TextBox x:Name="xRequirementsTB" 085.Height="84" 086.TextWrapping="Wrap" 087.ScrollViewer.VerticalScrollBarVisibility="Auto" 088.Grid.Column="1" 089.Grid.Row="4" 090.Text="{Binding activeJob.Requirements, Mode=TwoWay, NotifyOnValidationError=True, ValidatesOnExceptions=True}" 091.Grid.ColumnSpan="2" /> 092.<TextBlock Margin="8,11,8,0" 093.Grid.Row="5" 094.Text="Qualifications" 095.TextWrapping="Wrap" 096.VerticalAlignment="Top" /> 097. 098.<TextBox x:Name="xQualificationsTB" 099.Height="84" 100.TextWrapping="Wrap" 101.ScrollViewer.VerticalScrollBarVisibility="Auto" 102.Grid.Column="1" 103.Grid.Row="5" 104.Text="{Binding activeJob.Qualifications, Mode=TwoWay, NotifyOnValidationError=True, ValidatesOnExceptions=True}" 105.Grid.ColumnSpan="2" /> 106.<!-- Requirements Checkboxes--> 107. 108.<CheckBox x:Name="xResumeRequiredCB" Margin="8,8,8,15" 109.Content="Resume Required" 110.Grid.Row="6" 111.Grid.ColumnSpan="2" 112.IsChecked="{Binding activeJob.NeedsResume, Mode=TwoWay, NotifyOnValidationError=True, ValidatesOnExceptions=True}"/> 113. 114.<CheckBox x:Name="xCoverletterRequiredCB" Margin="8,8,8,15" 115.Content="Cover Letter Required" 116.Grid.Column="2" 117.Grid.Row="6" 118.IsChecked="{Binding activeJob.NeedsCV, Mode=TwoWay, NotifyOnValidationError=True, ValidatesOnExceptions=True}"/> 119. 120.<CheckBox x:Name="xOverviewRequiredCB" Margin="8,8,8,15" 121.Content="Overview Required" 122.Grid.Row="7" 123.Grid.ColumnSpan="2" 124.IsChecked="{Binding activeJob.NeedsOverview, Mode=TwoWay, NotifyOnValidationError=True, ValidatesOnExceptions=True}"/> 125. 126.<CheckBox x:Name="xJobActiveCB" Margin="8,8,8,15" 127.Content="Job is Active" 128.Grid.Column="2" 129.Grid.Row="7" 130.IsChecked="{Binding activeJob.IsActive, Mode=TwoWay, NotifyOnValidationError=True, ValidatesOnExceptions=True}"/> 131. 132.<!-- Buttons --> 133. 134.<Button x:Name="xAddEditButton" Margin="8,8,0,10" 135.Content="{Binding AddEditButtonString}" 136.cal:Click.Command="{Binding AddEditCommand}" 137.Grid.Column="2" 138.Grid.Row="8" 139.HorizontalAlignment="Left" 140.Width="125" 141.telerik:StyleManager.Theme="Windows7" /> 142. 143.<Button x:Name="xCancelButton" HorizontalAlignment="Right" 144.Content="Cancel" 145.cal:Click.Command="{Binding CancelCommand}" 146.Margin="0,8,8,10" 147.Width="125" 148.Grid.Column="2" 149.Grid.Row="8" 150.telerik:StyleManager.Theme="Windows7" /> 151.</Grid> 152.</Grid> The 'validationHelper:ValidationScope' line may seem odd. This is a handy little trick for catching current and would-be validation errors when working in this whole setup. This all comes from an approach found on theJoy Of Code blog, although it looks like the story for this will be changing slightly with new advances in SL4/WCF RIA Services, so this section can definitely get an overhaul a little down the road. The code is the fun part of all this, so let us see what's happening under the hood. Viewmodel for the AddEditJobView We are going to see some of the same things happening here, so I'll skip over the repeat info and get right to the good stuff: 001.public class AddEditJobViewModel : ViewModelBase 002.{ 003.private readonly IEventAggregator eventAggregator; 004.private readonly IRegionManager regionManager; 005. 006.public RecruitingContext context; 007. 008.private JobPosting _activeJob; 009.public JobPosting activeJob 010.{ 011.get { return _activeJob; } 012.set 013.{ 014.if (_activeJob != value) 015.{ 016._activeJob = value; 017.NotifyChanged("activeJob"); 018.} 019.} 020.} 021. 022.public bool isNewJob; 023. 024.private string _addEditString; 025.public string AddEditString 026.{ 027.get { return _addEditString; } 028.set 029.{ 030.if (_addEditString != value) 031.{ 032._addEditString = value; 033.NotifyChanged("AddEditString"); 034.} 035.} 036.} 037. 038.private string _addEditButtonString; 039.public string AddEditButtonString 040.{ 041.get { return _addEditButtonString; } 042.set 043.{ 044.if (_addEditButtonString != value) 045.{ 046._addEditButtonString = value; 047.NotifyChanged("AddEditButtonString"); 048.} 049.} 050.} 051. 052.public SubscriptionToken addJobToken = new SubscriptionToken(); 053.public SubscriptionToken editJobToken = new SubscriptionToken(); 054. 055.public DelegateCommand<object> AddEditCommand { get; set; } 056.public DelegateCommand<object> CancelCommand { get; set; } 057. 058.private ObservableCollection<ValidationError> _errors = new ObservableCollection<ValidationError>(); 059.public ObservableCollection<ValidationError> Errors 060.{ 061.get { return _errors; } 062.} 063. 064.private ObservableCollection<ValidationResult> _valResults = new ObservableCollection<ValidationResult>(); 065.public ObservableCollection<ValidationResult> ValResults 066.{ 067.get { return this._valResults; } 068.} 069. 070.public AddEditJobViewModel(IEventAggregator eventAgg, IRegionManager regionmanager) 071.{ 072.// set Unity items 073.this.eventAggregator = eventAgg; 074.this.regionManager = regionmanager; 075. 076.context = new RecruitingContext(); 077. 078.AddEditCommand = new DelegateCommand<object>(this.AddEditJobCommand); 079.CancelCommand = new DelegateCommand<object>(this.CancelAddEditCommand); 080. 081.SetSubscriptions(); 082.} 083. 084.#region Subscription Declaration and Events 085. 086.public void SetSubscriptions() 087.{ 088.AddJobEvent addJob = this.eventAggregator.GetEvent<AddJobEvent>(); 089. 090.if (addJobToken != null) 091.addJob.Unsubscribe(addJobToken); 092. 093.addJobToken = addJob.Subscribe(this.AddJobEventHandler); 094. 095.EditJobEvent editJob = this.eventAggregator.GetEvent<EditJobEvent>(); 096. 097.if (editJobToken != null) 098.editJob.Unsubscribe(editJobToken); 099. 100.editJobToken = editJob.Subscribe(this.EditJobEventHandler); 101.} 102. 103.public void AddJobEventHandler(bool isNew) 104.{ 105.this.activeJob = null; 106.this.activeJob = new JobPosting(); 107.this.activeJob.IsActive = true; // We assume that we want a new job to go up immediately 108.this.isNewJob = true; 109.this.AddEditString = "Add New Job Posting"; 110.this.AddEditButtonString = "Add Job"; 111. 112.MakeMeActive(this.regionManager, "MainRegion", "AddEditJobView"); 113.} 114. 115.public void EditJobEventHandler(JobPosting editJob) 116.{ 117.this.activeJob = null; 118.this.activeJob = editJob; 119.this.isNewJob = false; 120.this.AddEditString = "Edit Job Posting"; 121.this.AddEditButtonString = "Edit Job"; 122. 123.MakeMeActive(this.regionManager, "MainRegion", "AddEditJobView"); 124.} 125. 126.#endregion 127. 128.#region DelegateCommands from View 129. 130.public void AddEditJobCommand(object obj) 131.{ 132.if (this.Errors.Count > 0) 133.{ 134.List<string> errorMessages = new List<string>(); 135. 136.foreach (var valR in this.Errors) 137.{ 138.errorMessages.Add(valR.Exception.Message); 139.} 140. 141.this.eventAggregator.GetEvent<DisplayValidationErrorsEvent>().Publish(errorMessages); 142. 143.} 144.else if (!Validator.TryValidateObject(this.activeJob, new ValidationContext(this.activeJob, null, null), _valResults, true)) 145.{ 146.List<string> errorMessages = new List<string>(); 147. 148.foreach (var valR in this._valResults) 149.{ 150.errorMessages.Add(valR.ErrorMessage); 151.} 152. 153.this._valResults.Clear(); 154. 155.this.eventAggregator.GetEvent<DisplayValidationErrorsEvent>().Publish(errorMessages); 156.} 157.else 158.{ 159.if (this.isNewJob) 160.{ 161.this.eventAggregator.GetEvent<AddJobCompleteEvent>().Publish(this.activeJob); 162.} 163.else 164.{ 165.this.eventAggregator.GetEvent<EditJobCompleteEvent>().Publish(true); 166.} 167.} 168.} 169. 170.public void CancelAddEditCommand(object obj) 171.{ 172.if (this.isNewJob) 173.{ 174.this.eventAggregator.GetEvent<AddJobCompleteEvent>().Publish(null); 175.} 176.else 177.{ 178.this.eventAggregator.GetEvent<EditJobCompleteEvent>().Publish(false); 179.} 180.} 181. 182.#endregion 183.} 184.} We start seeing something new on line 103- the AddJobEventHandler will create a new job and set that to the activeJob item on the ViewModel. When this is all set, the view calls that familiar MakeMeActive method to activate itself. I made a bit of a management call on making views self-activate like this, but I figured it works for one reason. As I create this application, views may not exist that I have in mind, so after a view receives its 'ping' from being subscribed to an event, it prepares whatever it needs to do and then goes active. This way if I don't have 'edit' hooked up, I can click as the day is long on the main view and won't get lost in an empty region. Total personal preference here. :) Everything else should again be pretty straightforward, although I do a bit of validation checking in the AddEditJobCommand, which can either fire off an event back to the main view/viewmodel if everything is a success or sent a list of errors to our notification module, which pops open a RadWindow with the alerts if any exist. As a bonus side note, here's what my WCF RIA Services metadata looks like for handling all of the validation: private JobPostingMetadata() { } [StringLength(2500, ErrorMessage = "Description should be more than one and less than 2500 characters.", MinimumLength = 1)] [Required(ErrorMessage = "Description is required.")] public string Description; [Required(ErrorMessage="Active Status is Required")] public bool IsActive; [StringLength(100, ErrorMessage = "Posting title must be more than 3 but less than 100 characters.", MinimumLength = 3)] [Required(ErrorMessage = "Job Title is required.")] public bool JobTitle; [Required] public string Location; public bool NeedsCV; public bool NeedsOverview; public bool NeedsResume; public int PostingID; [Required(ErrorMessage="Qualifications are required.")] [StringLength(2500, ErrorMessage="Qualifications should be more than one and less than 2500 characters.", MinimumLength=1)] public string Qualifications; [StringLength(2500, ErrorMessage = "Requirements should be more than one and less than 2500 characters.", MinimumLength = 1)] [Required(ErrorMessage="Requirements are required.")] public string Requirements;   The RecruitCB Alternative See all that Xaml I pasted above? Those are now two pieces sitting in the JobsView.xaml file now. The only real difference is that the xEditGrid now sits in the same place as xJobsGrid, with visibility swapping out between the two for a quick switch. I also took out all the cal: and command: command references and replaced Button events with clicks and the Grid selection command replaced with a SelectedItemChanged event. Also, at the bottom of the xEditGrid after the last button, I add a ValidationSummary (with Visibility=Collapsed) to catch any errors that are popping up. Simple as can be, and leads to this being the single code-behind file: 001.public partial class JobsView : UserControl 002.{ 003.public RecruitingContext context; 004.public JobPosting activeJob; 005.public bool isNew; 006.private ObservableCollection<ValidationResult> _valResults = new ObservableCollection<ValidationResult>(); 007.public ObservableCollection<ValidationResult> ValResults 008.{ 009.get { return this._valResults; } 010.} 011.public JobsView() 012.{ 013.InitializeComponent(); 014.this.Loaded += new RoutedEventHandler(JobsView_Loaded); 015.} 016.void JobsView_Loaded(object sender, RoutedEventArgs e) 017.{ 018.context = new RecruitingContext(); 019.xJobsGrid.ItemsSource = context.JobPostings; 020.context.Load(context.GetJobPostingsQuery()); 021.} 022.private void xAddRecordButton_Click(object sender, RoutedEventArgs e) 023.{ 024.activeJob = new JobPosting(); 025.isNew = true; 026.xAddEditTitle.Text = "Add a Job Posting"; 027.xAddEditButton.Content = "Add"; 028.xEditGrid.DataContext = activeJob; 029.HideJobsGrid(); 030.} 031.private void xEditRecordButton_Click(object sender, RoutedEventArgs e) 032.{ 033.activeJob = xJobsGrid.SelectedItem as JobPosting; 034.isNew = false; 035.xAddEditTitle.Text = "Edit a Job Posting"; 036.xAddEditButton.Content = "Edit"; 037.xEditGrid.DataContext = activeJob; 038.HideJobsGrid(); 039.} 040.private void xAddEditButton_Click(object sender, RoutedEventArgs e) 041.{ 042.if (!Validator.TryValidateObject(this.activeJob, new ValidationContext(this.activeJob, null, null), _valResults, true)) 043.{ 044.List<string> errorMessages = new List<string>(); 045.foreach (var valR in this._valResults) 046.{ 047.errorMessages.Add(valR.ErrorMessage); 048.} 049.this._valResults.Clear(); 050.ShowErrors(errorMessages); 051.} 052.else if (xSummary.Errors.Count > 0) 053.{ 054.List<string> errorMessages = new List<string>(); 055.foreach (var err in xSummary.Errors) 056.{ 057.errorMessages.Add(err.Message); 058.} 059.ShowErrors(errorMessages); 060.} 061.else 062.{ 063.if (this.isNew) 064.{ 065.context.JobPostings.Add(activeJob); 066.context.SubmitChanges((s) => 067.{ 068.ActionHistory thisAction = new ActionHistory(); 069.thisAction.PostingID = activeJob.PostingID; 070.thisAction.Description = String.Format("Job '{0}' has been edited by {1}", activeJob.JobTitle, "default user"); 071.thisAction.TimeStamp = DateTime.Now; 072.context.ActionHistories.Add(thisAction); 073.context.SubmitChanges(); 074.}, null); 075.} 076.else 077.{ 078.context.SubmitChanges((s) => 079.{ 080.ActionHistory thisAction = new ActionHistory(); 081.thisAction.PostingID = activeJob.PostingID; 082.thisAction.Description = String.Format("Job '{0}' has been added by {1}", activeJob.JobTitle, "default user"); 083.thisAction.TimeStamp = DateTime.Now; 084.context.ActionHistories.Add(thisAction); 085.context.SubmitChanges(); 086.}, null); 087.} 088.ShowJobsGrid(); 089.} 090.} 091.private void xCancelButton_Click(object sender, RoutedEventArgs e) 092.{ 093.ShowJobsGrid(); 094.} 095.private void ShowJobsGrid() 096.{ 097.xAddEditRecordButtonPanel.Visibility = Visibility.Visible; 098.xEditGrid.Visibility = Visibility.Collapsed; 099.xJobsGrid.Visibility = Visibility.Visible; 100.} 101.private void HideJobsGrid() 102.{ 103.xAddEditRecordButtonPanel.Visibility = Visibility.Collapsed; 104.xJobsGrid.Visibility = Visibility.Collapsed; 105.xEditGrid.Visibility = Visibility.Visible; 106.} 107.private void ShowErrors(List<string> errorList) 108.{ 109.string nm = "Errors received: \n"; 110.foreach (string anerror in errorList) 111.nm += anerror + "\n"; 112.RadWindow.Alert(nm); 113.} 114.} The first 39 lines should be pretty familiar, not doing anything too unorthodox to get this up and running. Once we hit the xAddEditButton_Click on line 40, we're still doing pretty much the same things except instead of checking the ValidationHelper errors, we both run a check on the current activeJob object as well as check the ValidationSummary errors list. Once that is set, we again use the callback of context.SubmitChanges (lines 68 and 78) to create an ActionHistory which we will use to track these items down the line. That's all? Essentially... yes. If you look back through this post, most of the code and adventures we have taken were just to get things working in the MVVM/Prism setup. Since I have the whole 'module' self-contained in a single JobView+code-behind setup, I don't have to worry about things like sending events off into space for someone to pick up, communicating through an Infrastructure project, or even re-inventing events to be used with attached behaviors. Everything just kinda works, and again with much less code. Here's a picture of the MVVM and Code-behind versions on the Jobs and AddEdit views, but since the functionality is the same in both apps you still cannot tell them apart (for two-strike): Looking ahead, the Applicants module is effectively the same thing as the Jobs module, so most of the code is being cut-and-pasted back and forth with minor tweaks here and there. So that one is being taken care of by me behind the scenes. Next time, we get into a new world of fun- the interview scheduling module, which will pull from available jobs and applicants for each interview being scheduled, tying everything together with RadScheduler to the rescue. Did you know that DotNetSlackers also publishes .net articles written by top known .net Authors? We already have over 80 articles in several categories including Silverlight. Take a look: here.

    Read the article

  • Changing the action of a hyperlink in a Silverlight RichTextArea

    - by Marc Schluper
    The title of this post could also have been "Move over Hyperlink, here comes Actionlink" or "Creating interactive text in Silverlight." But alas, there can be only one. Hyperlinks are very useful. However, they are also limited because their action is fixed: browse to a URL. This may have been adequate at the start of the Internet, but nowadays, in web applications, the one thing we do not want to happen is a complete change of context. In applications we typically like a hyperlink selection to initiate an action that updates a part of the screen. For instance, if my application has a map displayed with some text next to it, the map would react to a selection of a hyperlink in the text, e.g. by zooming in on a location and displaying additional locational information in a popup. In this way, the text becomes interactive text. It is quite common that one company creates and maintains websites for many client companies. To keep maintenance cost low, it is important that the content of these websites can be updated by the client companies themselves, without the need to involve a software engineer. To accommodate this scenario, we want the author of the interactive text to configure all hyperlinks (without writing any code). In a Silverlight RichTextArea, the default action of a Hyperlink is the same as a traditional hyperlink, but it can be changed: if the Command property has a value then upon a click event this command is called with the value of the CommandParameter as parameter. How can we let the author of the text specify a command for each hyperlink in the text, and how can we let an application react properly to a hyperlink selection event? We are talking about any command here. Obviously, the application would recognize only a specific set of commands, with well defined parameters, but the approach we take here is generic in the sense that it pertains to the RichTextArea and any command. So what do we require? We wish that: As a text author, I can configure the action of a hyperlink in a (rich) text without writing code; As a text author, I can persist the action of a hyperlink with the text; As a reader of persisted text, I can click a hyperlink and the configured action will happen; As an application developer, I can configure a control to use my application specific commands. In an excellent introduction to the RichTextArea, John Papa shows (among other things) how to persist a text created using this control. To meet our requirements, we can create a subclass of RichTextArea that uses John's code and allows plugging in two command specific components: one to prompt for a command definition, and one to execute the command. Since both of these plugins are application specific, our RichTextArea subclass should not assume anything about them except their interface. public interface IDefineCommand { void Prompt(string content, // the link content Action<string, object> callback); // the method called to convey the link definition } public interface IPerformCommand : ICommand {} The IDefineCommand plugin receives the content of the link (the text visible to the reader) and displays some kind of control that allows the author to define the link. When that's done, this (possibly changed) content string is conveyed back to the RichTextArea, together with an object that defines the command to execute when the link is clicked by the reader of the published text. The IPerformCommand plugin simply implements System.Windows.Input.ICommand. Let's use MEF to load the proper plugins. In the example solution there is a project that contains rudimentary implementations of these. The IDefineCommand plugin simply prompts for a command string (cf. a command line or query string), and the IPerformCommand plugin displays a MessageBox showing this command string. An actual application using this extended RichTextArea would have its own set of commands, each having their own parameters, and hence would provide more user friendly application specific plugins. Nonetheless, in any case a command can be persisted as a string and hence the two interfaces defined above suffice. For a Visual Studio 2010 solution, see my article on The Code Project.

    Read the article

  • Dynamically creating meta tags in asp.net mvc

    - by Jalpesh P. Vadgama
    As we all know that Meta tag has very important roles in Search engine optimization and if we want to have out site listed with good ranking on search engines then we have to put meta tags. Before some time I have blogged about dynamically creating meta tags in asp.net 2.0/3.5 sites, in this blog post I am going to explain how we can create a meta tag dynamically very easily. To have meta tag dynamically we have to create a meta tag on server-side. So I have created a method like following. public string HomeMetaTags() { System.Text.StringBuilder strMetaTag = new System.Text.StringBuilder(); strMetaTag.AppendFormat(@"<meta content='{0}' name='Keywords'/>","Home Action Keyword"); strMetaTag.AppendFormat(@"<meta content='{0}' name='Descption'/>", "Home Description Keyword"); return strMetaTag.ToString(); } Here you can see that I have written a method which will return a string with meta tags. Here you can write any logic you can fetch it from the database or you can even fetch it from xml based on key passed. For the demo purpose I have written that hardcoded. So it will create a meta tag string and will return it. Now I am going to store that meta tag in ViewBag just like we have a title tag. In this post I am going to use standard template so we have our title tag there in viewbag message. Same way I am going save meta tag like following in ViewBag. public ActionResult Index() { ViewBag.Message = "Welcome to ASP.NET MVC!"; ViewBag.MetaTag = HomeMetaTags(); return View(); } Here in the above code you can see that I have stored MetaTag ViewBag. Now as I am using standard ASP.NET MVC3 template so we have our we have out head element in Shared folder _layout.cshtml file. So to render meta tag I have modified the Head tag part of _layout.cshtml like following. <head> <title>@ViewBag.Title</title> <link href="@Url.Content("~/Content/Site.css")" rel="stylesheet" type="text/css" /> <script src="@Url.Content("~/Scripts/jquery-1.5.1.min.js")" type="text/javascript"></script> @Html.Raw(ViewBag.MetaTag) </head> Here in the above code you can see I have use @Html.Raw method to embed meta tag in _layout.cshtml page. This HTML.Raw method will embed output to head tag section without encoding html. As we have already taken care of html tag in string function we don’t need the html encoding. Now it’s time to run application in browser. Now once you run your application in browser and click on view source you will find meta tag for home page as following. That’s its It’s very easy to create dynamically meta tag. Hope you liked it.. Stay tuned for more.. Till then happy programming.

    Read the article

  • Entity Framework &amp; Transactions

    - by Sudheer Kumar
    There are many instances we might have to use transactions to maintain data consistency. With Entity Framework, it is a little different conceptually. Case 1 – Transaction b/w multiple SaveChanges(): here if you just use a transaction scope, then Entity Framework (EF) will use distributed transactions instead of local transactions. The reason is that, EF closes and opens the connection when ever required only, which means, it used 2 different connections for different SaveChanges() calls. To resolve this, use the following method. Here we are opening a connection explicitly so as not to span across multipel connections.   using (TransactionScope ts = new TransactionScope()) {     context.Connection.Open();     //Operation1 : context.SaveChanges();     //Operation2 :  context.SaveChanges()     //At the end close the connection     ts.Complete(); } catch (Exception ex) {       //Handle Exception } finally {       if (context.Connection.State == ConnectionState.Open)       {            context.Connection.Close();       } }   Case 2 – Transaction between DB & Non-DB operations: For example, assume that you have a table that keeps track of Emails to be sent. Here you want to update certain details like DataSent once if the mail was successfully sent by the e-mail client. Email eml = GetEmailToSend(); eml.DateSent = DateTime.Now; using (TransactionScope ts = new TransactionScope()) {    //Update DB    context.saveChanges();   //if update is successful, send the email using smtp client   smtpClient.Send();   //if send was successful, then commit   ts.Complete(); }   Here since you are dealing with a single context.SaveChanges(), you just need to use the TransactionScope, just before saving the context only.   Hope this was helpful!

    Read the article

  • Web workflow solution - how should I approach the design?

    - by Tom Pickles
    We've been tasked with creating a web based workflow tool to track change management. It has a single workflow with multiple synchronous tasks for the most part, but branch out at a point to tasks running in parallel which meet up later on. There will be all sorts of people using the application, and all of them will need to see their outstanding tasks for each change, but only theirs, not others. There will also be a high level group of people who oversee all changes, so need to see everything. They will need to see tasks which have not been done in the specified time, who's responsible etc. The data will be persisted to a SQL database. It'll all be put together using .Net. I've been trying to learn and implement OOP into my designs of late, but I'm wondering if this is moot in this instance as it may be better to have the business logic for this in stored procedures in the DB. I could use POCO's, a front end layer and a data access layer for the web application and just use it as a mechanism for CRUD actions on the DB, then use SP's fired in the DB to apply the business rules. On the other hand, I could use an object oriented design within the web app, but as the data in the app is state-less, is this a bad idea? I could try and model out the whole application into a class structure, implementing interfaces, base classes and all that good stuff. So I would create a change class, which contained a list of task classes/types, which defined each task, and implement an ITask interface etc. Put end-user types into the tasks to identify who should be doing what task. Then apply all the business logic in the respective class methods etc. What approach do you guys think I should be using for this solution?

    Read the article

  • Change Data Capture

    - by Ricardo Peres
    There's an hidden gem in SQL Server 2008: Change Data Capture (CDC). Using CDC we get full audit capabilities with absolutely no implementation code: we can see all changes made to a specific table, including the old and new values! You can only use CDC in SQL Server 2008 Standard or Enterprise, Express edition is not supported. Here are the steps you need to take, just remember SQL Agent must be running: use SomeDatabase; -- first create a table CREATE TABLE Author ( ID INT NOT NULL PRIMARY KEY IDENTITY(1, 1), Name NVARCHAR(20) NOT NULL, EMail NVARCHAR(50) NOT NULL, Birthday DATE NOT NULL ) -- enable CDC at the DB level EXEC sys.sp_cdc_enable_db -- check CDC is enabled for the current DB SELECT name, is_cdc_enabled FROM sys.databases WHERE name = 'SomeDatabase' -- enable CDC for table Author, all columns exec sys.sp_cdc_enable_table @source_schema = 'dbo', @source_name = 'Author', @role_name = null -- insert values into table Author insert into Author (Name, EMail, Birthday, Username) values ('Bla', 'bla@bla', 1990-10-10, 'bla') -- check CDC data for table Author -- __$operation: 1 = DELETE, 2 = INSERT, 3 = BEFORE UPDATE 4 = AFTER UPDATE -- __$start_lsn: operation timestamp select * from cdc.dbo_author_CT -- update table Author update Author set EMail = '[email protected]' where Name = 'Bla' -- check CDC data for table Author select * from cdc.dbo_author_CT -- delete from table Author delete from Author -- check CDC data for table Author select * from cdc.dbo_author_CT -- disable CDC for table Author -- this removes all CDC data, so be carefull exec sys.sp_cdc_disable_table @source_schema = 'dbo', @source_name = 'Author', @capture_instance = 'dbo_Author' -- disable CDC for the entire DB -- this removes all CDC data, so be carefull exec sys.sp_cdc_disable_db SyntaxHighlighter.config.clipboardSwf = 'http://alexgorbatchev.com/pub/sh/2.0.320/scripts/clipboard.swf'; SyntaxHighlighter.all();

    Read the article

  • Do MORE with WebCenter

    - by Michael Snow
    We’ve been extremely busy here on the Oracle WebCenter team. We hope that you’ve all be keeping up with the interesting news each week. Last week was jammed full of GartnerPCC and Gartner360 buzz. If you missed any of the highlights – be sure to check out both Kellsey’s post from last week: Gartner PCC: A Shovel & Some Ah-Ha's and Christie’s overview of Loren Weinberg’s PCC presentation: "Here Today, Gone Tomorrow: Engage Your Customers or Lose Them"  . This week, we’ll be focusing on “Doing More with WebCenter” leading up to a great webcast scheduled for Thursday, March 22 (invite and registration link below). This is the 2nd in a series of 3 webcasts dedicated to expanding the understanding of the full capabilities of WebCenter. Yes – that might mean that you are not getting the full benefits of the software you already own or the expansion potential via upgrade to the full WebCenter Suite Plus. Tune in on Thursday 10 a.m. PT / 1 p.m. ET.  ++++++++++++++ Want to be a Speaker at Oracle OpenWorld 2012? Oracle Open World planning has already kicked off. We know that it is only March and next October is far in the distance. But planning has already started for Oracle OpenWorld 2012. So if you want to be a speaker and propose your own session for this year's event in San Francisco on September 30th - October 4th, starting thinking now!  The annual OpenWorld Call for Papers is now open until April 9th! All of the details to submit a paper are available here. Of course, the WebCenter team here is interested in sessions including case studies, thought-leadership, customer stories around any of the Oracle WebCenter solutions, but the Call for Papers is open to all Oracle topics. When submitting your topic, be sure to describe what you plan to discuss and the value of the presentation to other attendees. Sell your session, because there will be a lot of competition to be selected.  Bonus News: Speakers for selected sessions receive a complimentary full conference pass! Get your papers in and we'll see you in San Francisco! ~~~~~~~~~~~~~~~~~~~~~~ Webcast Series: Do More with Oracle WebCenter - Expand Beyond Content Management Enable Employees, Partners, and Customers to Do More with Your Content Dear [FIRSTNAME] [LASTNAME],-- Did you know that, in addition to content management, Oracle WebCenter now also includes comprehensive portal, composite application, collaboration, and Web experience management capabilities? Join us for this Webcast and learn how you can provide a new level of user engagement. Learn how Oracle WebCenter: Drives task-specific application data and content to a single screen for executing specific business processes Enables mixed internal and external environments where content can be securely shared and filtered with employees, partners, and customers, based upon role-based security Offers Web experience management, driving contextually relevant, social, and interactive online experiences across multiple channels Provides social features that enable sharing, activity feeds, collaboration, expertise location, and best-practices communities Learn how to do more with Oracle WebCenter. Register now for the Webcast. Register Now Join us for the second Webcast in the series "Do More With Oracle WebCenter". March 22, 2012 10 a.m. PT / 1 p.m. ET Presented by: Michelle Huff Senior Director, WebCenter Product Management, Oracle Greg Utecht Project Manager,IT Operations,TIES Copyright © 2012, Oracle and/or its affiliates. All rights reserved. Contact Us | Legal Notices | Privacy Oracle Corporation - Worldwide Headquarters, 500 Oracle Parkway, OPL - E-mail Services, Redwood Shores, CA 94065, United States

    Read the article

< Previous Page | 238 239 240 241 242 243 244 245 246 247 248 249  | Next Page >