Search Results

Search found 23766 results on 951 pages for 'inline view'.

Page 242/951 | < Previous Page | 238 239 240 241 242 243 244 245 246 247 248 249  | Next Page >

  • Spring MVC with annotations: how to beget that method always is called

    - by TheStijn
    hi, I'm currently migrating a project that is using Spring MVC without annotations to Spring MVC with annotations. This is causing less problems than expected but I did come across one issue. In my project I have set up an access mechanisme. Whether or not a User has access to a certain view depends on more than just the role of the User (e.g. it also depends on the status of the entity, the mode (view/edit), ...). To address this I had created an abstract parent controller which has a method hasAccess. This method calls also other methods like getAllowedEditStatuses which are here and there overridden by the child controllers. The hasAccess method gets called from the showForm method (below code was minimized for your readability): @Override protected ModelAndView showForm(final HttpServletRequest request, final HttpServletResponse response, final BindException errors) throws Exception { Integer id = Integer.valueOf(request.getParameter("ID")); Project project = this.getProject(id); if (!this.hasAccess(project, this.getActiveUser())) { return new ModelAndView("errorNoAccess", "code", project != null ? project.getCode() : null); } return this.showForm(request, response, project, errors); } So, if the User has no access to the view then he gets redirected to an error page. Now the 'pickle': how to set this up when using annotations. There no longer is a showForm or other method that is always called by the framework. My (and maybe your) first thought was: simply call this method from within each controller before going to the view. This would of course work but I was hoping for a nicer, more generic solution (less code duplication). The only other solution I could think of is preceeding the hasAccess method with the @ModelAttribute annotation but this feels a lot like raping the framework :-). So, does anyone have a (better) idea? thanks, Stijn

    Read the article

  • Please help me work out this error, regarding the use of a HTTPService to connect Flex4 & Ruby on Ra

    - by ben
    I have a HTTPService in Flash Builder 4, that is defined as follows: <s:HTTPService id="getUserDetails" url="http://localhost:3000/users/getDetails" method="GET"/> It gets called as follows: getUserDetails.send({'user[username]': calleeInput.text}); Here is a screenshot of the network monitor, showing that the parameter is being sent correctly (it is 'kirsty'): Here is the Ruby on Rails method that it's connected to: def getDetails @user = User.find_by_username(:username) render :xml => @user end When I run it, I get the following error output in the console: Processing UsersController#list (for 127.0.0.1 at 2010-04-30 17:48:03) [GET] User Load (1.1ms) SELECT * FROM "users" Completed in 30ms (View: 16, DB: 1) | 200 OK [http://localhost/users/list] Processing UsersController#getDetails (for 127.0.0.1 at 2010-04-30 17:48:13) [GET] Parameters: {"user"={"username"="kirsty"}} User Load (0.3ms) SELECT * FROM "users" WHERE ("users"."username" = '--- :username ') LIMIT 1 ActionView::MissingTemplate (Missing template users/getDetails.erb in view path app/views): app/controllers/users_controller.rb:36:in getDetails' /usr/local/lib/ruby/1.8/webrick/httpserver.rb:104:in service' /usr/local/lib/ruby/1.8/webrick/httpserver.rb:65:in run' /usr/local/lib/ruby/1.8/webrick/server.rb:173:in start_thread' /usr/local/lib/ruby/1.8/webrick/server.rb:162:in start' /usr/local/lib/ruby/1.8/webrick/server.rb:162:in start_thread' /usr/local/lib/ruby/1.8/webrick/server.rb:95:in start' /usr/local/lib/ruby/1.8/webrick/server.rb:92:in each' /usr/local/lib/ruby/1.8/webrick/server.rb:92:in start' /usr/local/lib/ruby/1.8/webrick/server.rb:23:in start' /usr/local/lib/ruby/1.8/webrick/server.rb:82:in `start' Rendering rescues/layout (internal_server_error) I'm not sure if the error is being caused by bad code in the getDetails Ruby on Rails method? I'm new to RoR, and I think I remember reading somewhere that every method should have a view. I'm just using this method to get info into the Flex 4 app, do I still need to make a view for it? Is that what's causing the error? Any help would be GREATLY appreciated, I've been stuck on this for a few days now! Thanks.

    Read the article

  • Iphone CATextLayer doesn't show it's text.

    - by lovecactus
    Here is my new bee issue: I was simply trying to add a CATextlayer in an UIView layer. However, according to the following code, I only get the CATextlayer's background color be displayed in the UIView, without any text. Just wonder what did I missed to display the text. Could anyone ofter a hint/sample how to use CATextlayer? Thanks. (id)initWithNibName:(NSString *)nibNameOrNil bundle:(NSBundle *)nibBundleOrNil { if ((self = [super initWithNibName:nibNameOrNil bundle:nibBundleOrNil])) { // Custom initialization CATextLayer *TextLayer = [CATextLayer layer]; TextLayer.bounds = CGRectMake(0.0f, 0.0f, 100.0f, 100.0f); TextLayer.string = @"Test"; TextLayer.font = [UIFont boldSystemFontOfSize:18].fontName; TextLayer.backgroundColor = [UIColor whiteColor].CGColor; TextLayer.wrapped = NO; //TextLayer.backgroundColor = [UIColor blueColor]; self.view = [[UIView alloc] initWithFrame:CGRectMake(0.0f, 0.0f, 100.0f, 100.0f)]; self.view.backgroundColor = [UIColor blueColor]; [self.view.layer addSublayer:TextLayer]; [self.view.layer layoutSublayers]; } return self; }

    Read the article

  • Does changing the order of class private data members breaks ABI

    - by Dmitry Yudakov
    I have a class with number of private data members (some of them static), accessed by virtual and non-virtual member functions. There's no inline functions and no friend classes. class A { int number; string str; static const int static_const_number; public: // got virtual and non-virtual functions, working with these memebers virtual void func1(); void func2(); // no inline functions or friends }; Does changing the order of private data members breaks ABI in this case? class A { string str; static const int static_const_number; int number; // <-- integer member moved here ... };

    Read the article

  • ASP.Net MVC vs ASP.Net for Complex workflows

    - by Grant Sutcliffe
    I have just become involved in migrating a series of complex workflows with InfoPath UIs to Web-based UIs. I am new to ASP.Net MVC but have started to evaluate it as the technology versus classic ASP.Net for the job. As is typical of most workflows, in each state there are a number of business rules that determine (a) who can view what content; (2) who can edit what content; (3) what the user action options might be (Edit; Reject; Approve), etc. In essence, there is a lot of logic that needs to be applied to each request before presenting the appropriate view. Being more experienced in ASP.Net, I know that presenting the form(s) as required can be easily achieved through code behind pages (enable / disable / hide fields). I have not seen how this can be achieved with ASP.Net MVC (but am realising that new thinking is required of me when working with MVC - ‘Give only the content on a particular View + limited user action options’). Therefore, if using ASP.Net MVC, it looks like I would need to create a lot of views. Much of the content in each view would be the same. Only field enabled status or buttons would differ in most instances for these views in each state. For example: Step01Initiate (‘Has Save’ button); Step01OriginatorView (has ‘Edit’ Button) ; Step01OriginatorEdit (has ‘Save’ button); Step01Review (has ‘Accept’ / ‘Reject’ buttons); Step01ReviewReject (for reviewer notes; has ‘Save’ / ‘Cancel’ buttons). With workflows of up to six states, this would result in a lot of views. I can see the advantages of choosing ASP.MVC (1) ‘thin’ Views in terms of content; and (2) with logic consolidation in Controllers and different Models. Am I thinking along the right lines in terms of applying the MVC – ‘plenty of views’; or is there a better way to achieve my goal (using ASP.Net MVC or classic ASP.Net)?

    Read the article

  • Layering Cocoa WebView - Drawing on top?

    - by Josh
    http://stackoverflow.com/questions/1618498/webview-in-core-animation-layer The only other thread I can find is the above which doesn't necessarily fit my needs. Is there a reliable way to simply draw a view on top of a webview? I've tried to layer a regular NSView on top of WebView, and it draws right at first, but any movement in the webview (scrolling the page etc) appears to invalidate the view and produces visual artifacts. I've tried: [[[NSApp mainWindow] contentView] addSubview:view positioned:NSWindowAbove relativeTo:webView]; No luck there, same problems -- z-ordering doesn't seem to work unless I'm missing something. Is this just a limitation of webviews? I also tried implementing the view above as a window, which worked much better (just controlled the location of the window programmatically). However, the desired behavior is for the user to enter some text into this window, but for it not to steal "focus" -- ie the main window goes inactive (the x - + go gray) when the user clicks on the text field in the new window. Any way to avoid that? I've tried subclassing NSWindow and overriding canBecomeKey (return YES) and canBecomeMain (return NO) but the window still steals focus. Josh

    Read the article

  • Inactive area after device rotation

    - by Sébastien
    Hi all, I don't understand what's wrong in my very simple application with device rotation : I built my view with interface builder. (See screen capture here) I specified <key>UIInterfaceOrientation</key><string>UIInterfaceOrientationLandscapeRight</string> in my info.plist file. I had a (BOOL)shouldAutorotateToInterfaceOrientation:(UIInterfaceOrientation)interfaceOrientation {return YES;} in my root view controller. The area on the left (shown in red on the capture), around 20 pixel width, keeps inactive (nothing append if I hit a button in this area). In fact the full screen is active only in portrait mode, in landscape right mode there is this 20 pixels width inactive area, in landscape left mode this inactive area is on the right, in portrait upside down mode this area is on the bottom. I read lots of posts and documentation about UIView rotation, but I did not find anything to solve this problem (I tried to play with view.frame and view.bounds without any success). Anybody has an idea ? Thanks a lot. Regards. Sébastien.

    Read the article

  • Wordpress css and ie6

    - by marc-andre menard
    my website : http://www.equipe94.com have a two column layout and in ie6 the right column is flushed at the button... it look like and inline problem, but even WITH the inline widget.. it's still at the bottom.. any idea to fix a wordpress template to play well with ie6 ? thanks in advance n.b. As mentioned in the comment... my page don't validate... after fixing the multiples problems now I validate in XHTML 1.0 Strict... but the problem is still there !

    Read the article

  • Migrating from Maven to SBT

    - by Vasil Remeniuk
    Hi people, As you know, SBT is compatible with Maven in some way -- SBT recognizes simple Maven POMs and can use dependencies and repositories specified in them. However, SBT wiki says that, if inline dependency is specified in SBT project definition, POM will be ignored (so using both in this case is impossible): Maven and Ivy configurations (pom.xml and ivy.xml) are ignored when inline dependency declarations are present. Does anyone know, if any kind of converter from Maven POM to SBT project definition exists (translating POM's XML into project definition Scala code)? I'm considering writing such script (that will help to migrate my old Scala/Maven projects to SBT), but want to know first, if this functionality already exists. Thanks in advance.

    Read the article

  • PHP fails silently when php-code is within html tag

    - by Michal M
    PROBLEM UPDATED, READ BELOW For some reason my CI fails silently when loading view. Loading view is simply called from controller $this->load->view('templates/default.php'); Now. There are some functions in the loaded view that are not defined unless a proper helper is loaded as well. Normally, php would throw an error, but instead it fails silently here. I have no idea why. The template gets outputted till the line containing the undefined function. It took me long time to realise where my script is failing. Here's my setup: Windows 7 Ultimate Apache 2.2.15 PHP 5.3.2 with following error reporting settings: display_errors = On display_startup_errors = On error_reporting = E_ALL | E_STRICT CodeIgniter 1.7.2 Any ideas why would that be? UPDATE After further debugging, it turned out that PHP fails to report any errors when php code is inline with HTML and within the HTML tag. Now this is bizarre. This returns Fatal Error: <p><?php echo $bogus(); ?></p> This doesn't and fails silently: <p class="<?php echo $bogus(); ?>">paragraph</p> Why? :O UPDATE 2 Further investigation showed that if an error_log in PHP is specified, the errors are in fact reported in that file, but still not in the browser... Again, why? UPDATE 3 Actually my code should be slightly different. Checked another PHP installation on completely different machine and it confirmed the PHP bug. Reported here: http://bugs.php.net/bug.php?id=52040

    Read the article

  • ContextMenu not popping up on Long click

    - by primal
    Hi, The context menu is not popping up on the long click on the list items in the list view. I've extended the base adapter and used a view holder to implement the custom list with textviews and an imagebutton. adapter = new MyClickableListAdapter(this, R.layout.timeline, mObjectList); list.setAdapter(adapter); registerForContextMenu(list); Implementation of onCreateContextMenu @Override public void onCreateContextMenu(ContextMenu menu, View v, ContextMenuInfo menuInfo) { // TODO Auto-generated method stub super.onCreateContextMenu(menu, v, menuInfo); Log.d(TAG, "Entering Context Menu"); menu.setHeaderTitle("Context Menu"); menu.add(Menu.NONE, DELETE_ID, Menu.NONE, "Delete") .setIcon(R.drawable.icon); } The XML for listview is here <ListView android:id="@+id/list" android:layout_width="fill_parent" android:layout_height="wrap_content" /> I've been trying this for many days. I think its impossible to register Context-menu for a custom list view like this. Correct me if I am wrong (possibly with sample code). Now I am thinking of a adding a button to the list item and it displays a menu on clicking it. Is it possible with some other way than using Dialogs? Any help would be much appreciated..

    Read the article

  • Android ScrollView jumps around when resized

    - by Mike
    I have a ScrollView that contains an number of other views (TextViews, ImageViews, etc.). The ScrollView is taller than the screen. I have an AsyncTask that updates the children of the ScrollView based on an http response. I've discovered an interesting behavior that I can't figure out how to work around. If I set any of the children's visibilities to View.INVISIBLE as part of the AsyncTask.onPostExecute(), everything works fine. However, if I set any of the children's visibilities to View.GONE, the ScrollView jumps down from the top when onPostExecute() is called. Exactly how far seems to vary. I'm guessing that re-laying out the ScrollView is causing it to scroll away from the top for some reason. So the question is: is there a way to either prevent or work around this behavior? PS. Using ScrollView.jump(FOCUS_UP) as a workaround isn't ideal since that'll force the user to the top even if they had intended to scroll down. EDIT: Actually, I was wrong. The problem wasn't with a child view being marked gone, the problem was with a sibling view being marked gone and the ScrollView getting resized. My ScrollView is inside a LinearLayout that also contains a Button. When the button is set to GONE, the ScrollView gets resized to take up the available space, causing it to scroll away from the top. Different cause, still looking for a workaround though if possible.

    Read the article

  • UIViewController remaining

    - by Guy
    Hi Guys. I have a UIViewController named equationVC who's user interface is being programmatically created from another NSObject class called equationCon. Upon loading equationVC, a method called chooseInterface is called from the equationCon class. I have a global variable (globalVar) that points to a user defined string. chooseInterface finds a method in the equationCon class that matches the string globalVar points to. In this case, let's say that globalVar points to a string that is called "methodThatMatches." In methodThatMatches, another view controller needs to show the results of what methodThatMatches did. methodThatMatches creates a new equationVC that calls upon methodThatMatches2. As a test, each method changes the color of the background. When the application starts up, I get a purple background, but as soon as I hit backwards I get another purple screen, which should be yellow. I do not think that I am release the view properly. Can anyone help? -(void)chooseInterface { NSString* equationTemp = [globalVar stringByReplacingOccurrencesOfString:@" " withString:@""]; equationTemp = [equationTemp stringByReplacingOccurrencesOfString:@"'" withString:@""]; SEL equationName = NSSelectorFromString(equationTemp); NSLog(@"selector! %@",NSStringFromSelector(equationName)); if([self respondsToSelector:equationName]){ [self performSelector:equationName]; } } -(void)methodThatMatches{ self.equationVC.view.backgroundColor = [UIColor yellowColor]; [setGlobalVar:@"methodThatMatches2"]; EquationVC* temp = [[EquationVC alloc] init]; [[self.equationVC navigationController] pushViewController:temp animated:YES ]; [temp release]; } -(void)methodThatmatches2{ self.equationVC.view.backgroundColor = [UIColor purpleColor]; }

    Read the article

  • Loading UITableView form UIView

    - by Amarpreet
    Hi Guys, I am working on navigation based application in which i can navigate to many views starting from default UITableView which is starting view in application template. I have added another UIView and added tableView control on that UIView. I am calling that view form one of the many views on a button click. Its showing the view but not populating the data in the table. And I also want to handle the event when user taps on the cell of the table of that view. Below is the Code I am using on button click: if(self.lstView == nil) { ListViewController *viewController = [[ListViewController alloc] initWithNibName:@"ListViewController" bundle:nil]; self.lstView = viewController; [viewController release]; } [self.navigationController pushViewController:lstView animated:YES]; self.lstView.title = @"Select";//@"System"; [self.lstView.tblList.dataSource fillList]; Below is the fillList function code: -(NSArray *)fillList { NSArray *tempArray = [[[NSArray alloc] initWithObjects:@"Item 1" , @"Item 2" , nil]autorelease]; return tempArray; } I am pretty new in Iphone programming and don't have much understanding. Helping with detailed description and code will be highly appreciated. Thanks.

    Read the article

  • How to add validation errors in the validation collection asp.net mvc?

    - by johndoe
    Inside my controller's action I have the following code: public ActionResult GridAction(string id) { if (String.IsNullOrEmpty(id)) { // add errors to the errors collection and then return the view saying that you cannot select the dropdownlist value with the "Please Select" option } return View(); UPDATE: if (String.IsNullOrEmpty(id)) { // add error ModelState.AddModelError("GridActionDropDownList", "Please select an option"); return RedirectToAction("Orders"); } } UPDATE 2: Here is my updated code: @Html.DropDownListFor(x => x.SelectedGridAction, Model.GridActions,"Please Select") @Html.ValidationMessageFor(x => x.SelectedGridAction) The Model looks like the following: public class MyInvoicesViewModel { private List<SelectListItem> _gridActions; public int CurrentGridAction { get; set; } [Required(ErrorMessage = "Please select an option")] public string SelectedGridAction { get; set; } public List<SelectListItem> GridActions { get { _gridActions = new List<SelectListItem>(); _gridActions.Add(new SelectListItem() { Text = "Export to Excel", Value = "1"}); return _gridActions; } } } And here is my controller action: public ActionResult GridAction(string id) { if (String.IsNullOrEmpty(id)) { // add error ModelState.AddModelError("SelectedGridAction", "Please select an option"); return RedirectToAction("Orders"); } return View(); } Nothing happens! I am totally lost on this one! UPDATE 3: I am now using the following code but still the validation is not firing: public ActionResult GridAction(string id) { var myViewModel= new MyViewModel(); myViewModel.SelectedGridAction = id; // id is passed as null if (!ModelState.IsValid) { return View("Orders"); }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Why does presentModalViewController not always work?

    - by E-Madd
    My application requires data from a server in order to run. The first thing it does is displays a view controller (LoadingViewController) that is responsible for checking if the data is saved to my PersistentStoreCoordinator. If the data isn't cached locally, it gets it from my server and caches it, and posts a notification that the LoadingViewController is listening for. When that notification comes through, LoadingViewController presents the application's MainViewController using the presentModalViewController with a flip animation. So far, so good... no errors. However, if the application loads and determines the data IS cached - the presentModalViewController does not work and the main application view never appears. No errors. I've even gone as far as adding a button to the Loading view that executes the same code when pressed and the damn thing works. I'm suspicious it has something to do with the timing of it all but I'm clueless as to what I can do to ensure the view is displayed with that flipping animation if the data is already cached locally. Any suggestions?

    Read the article

  • How to dismiss the MFMailComposeViewController in cocos2d ?

    - by srikanth rongali
    I have changed my code to this way. Now mail controller is opening in landscape mode. But the problem is If I touch on cancel button or send button the mail controller is not dismissing its view. How can I do it ? -(void)goToFirstScreen:(id)sender { NSLog(@"goToFirstScreen: "); CCScene *Scene = [CCScene node]; CCLayer *Layer = [EmailScene node]; [Scene addChild:Layer]; [[CCDirector sharedDirector] setAnimationInterval:1.0/60]; [[CCDirector sharedDirector] pushScene: Scene]; } Th EmailScene class is #import "EmailScene.h" #import "testOfEnd.h" @implementation EmailScene - (id) init { self = [super init]; if (self != nil) { [self displayComposerSheet]; } return self; } -(void)displayComposerSheet { [[CCDirector sharedDirector] pause]; picker = [[MFMailComposeViewController alloc] init]; picker.mailComposeDelegate = self; [[[CCDirector sharedDirector] openGLView] addSubview:picker.view]; [[CCDirector sharedDirector] stopAnimation]; [picker presentModalViewController:picker animated:YES]; [picker release]; } - (void)mailComposeController:(MFMailComposeViewController*)controller didFinishWithResult:(MFMailComposeResult)result error:(NSError*)error { [[CCDirector sharedDirector] resume]; //dismiss view after otherwise the code is not executed [picker.view removeFromSuperview]; [[CCDirector sharedDirector] startAnimation]; [picker dismissModalViewControllerAnimated:YES]; //return to previous scene CCScene *Scene = [CCScene node]; CCLayer *Layer = [testOfEnd node]; [Scene addChild:Layer]; [[CCDirector sharedDirector] replaceScene:Scene]; } @end Thank You.

    Read the article

  • MVC: model of type Nullable<T>

    - by Fyodor Soikin
    I have a partial view that inherits from ViewUserControl<Guid?> - i.e. it's model is of type Nullable<Guid>. Very simple view, nothing special, but that's not the point. Somewhere else, I do Html.RenderPartial( "MyView", someGuid ), where someGuid is of type Nullable<Guid>. Everything's perfectly legal, should work OK, right? But here's the gotcha: the second argument of Html.RenderPartial is of type object, and therefore, Nullable<Guid> being a value type, it must be boxed. But nullable types are somehow special in the CLR, so that when you box one of those, you actually get either a boxed value of type T (Nullable's argument), or a null if the nullable didn't have a value to begin with. And that last case is actually interesting. Turns out, sometimes, I do have a situation when someGuid.HasValue == false. And in those cases, I effectively get a call Html.RenderPartial( "MyView", null ). And what does the HtmlHelper do when the model is null? Believe it or not, it just goes ahead and takes the parent view's model. Regardless of it's type. So, naturally, in those cases, I get an exception saying: "The model item passed into the dictionary is of type 'Parent.View.Model.Type', but this dictionary requires a model item of type 'System.Guid?'" So the question is: how do I make MVC correctly pass new Nullable<Guid> { HasValue = false } instead of trying to grab the parent's model? Note: I did consider wrapping my Guid? in an object of another type, specifically created for this occasion, but this seems completely ridiculous. Don't want to do that as long as there's another way. Note 2: now that I've wrote all this, I've realized that the question may be reduced to how to pass a null for model without ending up with parent's model?

    Read the article

  • how to link a java class to a image button in eclipse?

    - by Isabella Chan
    I am trying to create a application that includes a Imagebutton and by clicking on the imagebutton, the application will start to run another java class that is within the package itself. I try using this method, however the program stopped working immediately? how should i code the codes instead? can anyone help me? Thanks :D package com.fyp.gulliver; import android.app.Activity; import android.content.Intent; import android.os.Bundle; import android.view.View; import android.widget.Button; public class GulliverActivity extends Activity { /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); //---Map button--- Button btnMap = (Button) findViewById(R.id.map); btnMap.setOnClickListener(new View.OnClickListener() { Class ourClass; public void onClick(View v) { // TODO Auto-generated method stub try { ourClass = Class.forName ("com.fyp.gulliver.Maps"); Intent ourIntent = new Intent(GulliverActivity.this, ourClass); startActivity(ourIntent); } catch (ClassNotFoundException e) { // TODO Auto-generated catch block e.printStackTrace(); } } }); } }

    Read the article

  • iPhone: Creating a hierarchy-based table navigation.

    - by Jack Griffiths
    Hi there, I've tried to ask this before, but nothing got answered. Basically, I would like someone to explain to me how to create a table, which when a cell is tapped, pushes the user to the next view for that cell. I have this so far: Click here to view what I have. I would further like to, say when CSS is tapped, it goes to a new view which has another table in it. This table would then take the user to a detail view, which is scrollable and you can switch pages through it. I would appreciate longer, more structured tutorials on how to do each and every bit to get it to work. Here's my array in my implementation file: - (void)viewDidLoad { arryClientSide = [[NSArray alloc] initWithObjects:@"CSS", @"HTML", @"JavaScript", @"XML", nil]; arryServerSide = [[NSArray alloc] initWithObjects:@"Apache", @"PHP", @"SQL", nil]; self.title = @"Select a Language"; [super viewDidLoad]; } and my .h: @interface RootViewController : UITableViewController <UITableViewDelegate, UITableViewDataSource> { IBOutlet UITableView *tblSimpleTable; NSArray *arryClientSide; NSArray *arryServerSide; } My current code crashes the script, and this error is returned in the console: Terminating app due to uncaught exception 'NSInternalInconsistencyException', reason: '-[UITableViewController loadView] loaded the "NextView" nib but didn't get a UITableView.' If that error is the source of why it's not pushing, then an explanation of how to remedy that would also be appreciated Many thanks, Jack

    Read the article

  • Zend Framework :: Is this code good for user login (Its begining- because that I want to know if its

    - by Yosef
    Hi, I new in Zend. Main Question: Is this code good for user login (Its beginning- because that I want to know if its can be improve)? Code understanding question: Is every time that in action call to his view- code execution in action not going to next row until view request? (I asking about IndexAction that I write down) Thanks view index.phtml <? echo $this->form controller IndexAction.php public function indexAction() { $form=new Application_Form_Login(); $this->view->form = $form; if ($this->getRequest()->isPost()) { $formData = $this->getRequest()->getPost(); if ($form->isValid($formData)) { echo " test value username: ".$form->getValue('username'); } } } form Login.php public function init() { $this->setMethod('post'); $this->setName('user login'); $username = new Zend_Form_Element_Text('username'); $username->setLabel("username") ->setRequired(true) ->addFilter('StripTags') ->addFilter('StringTrim') ->addValidator('NotEmpty'); $password = new Zend_Form_Element_Password('password'); $password->setLabel('password') ->setRequired(true) ->addFilter('StripTags') ->addFilter('StringTrim') ->addValidator('NotEmpty'); $submit = new Zend_Form_Element_Submit('submit'); $this->addElements(array($username, $password, $submit)); }

    Read the article

  • How can I add a portrait layout on top of a landscape Camera SurfaceView?

    - by user319919
    I need a Camera SurfaceView for my application. The camera should be set to fixed landscape view which is done by setting android:screenOrientation="landscape" for the activity in the AndroidManifest.xml. After doing some experiments and Google researches trying to use setRotation(int) inside the camera preview implementation, I came to the conclusion, that it is obviously the common practice to get a preview with correct behaviour. Now the camera preview itself looks fine for landscape orientation. But I need to have an overlay that holds a bunch of buttons. Due to usability the user interface should be in portrait view (or even better orientation aware). There seemed no other option to me, but to fix the activity screenOrientation, so that the camera preview looks normal (in portrait mode the whole view is streched and rotated to the left) Is there a workaround to get my buttons back to portrait orientation? Or another overall approach to deal with the camera view? Parameters.setRotation(int) obvisouly didnt work. I am quite new to the Android plattform programming. Of course I dont know much about the programming tricks and workarounds yet. I did a lot of research over the last two weeks, but couldnt find the right solution so far.

    Read the article

  • Jquery if statement help

    - by mtwallet
    Hi. I want to know how to correctly write an if statement with jquery. I have a bunch of div's with an anchor in each that when clicked expands the the div's width using toggleClass. This works fine but I want to write an if statement that checks to see if the other div's have the same class applied, if so contract that div, then expand the next div (hope that makes sense), my code so far: HTML: <div class="content-block"> <h2>Title</h2> <p>Content...</p> <a class="expand" href="#">Expand View</a> </div> <div class="content-block"> <h2>Title</h2> <p>Content...</p> <a class="expand" href="#">Expand View</a> </div> <div class="content-block"> <h2>Title</h2> <p>Content...</p> <a class="expand" href="#">Expand View</a> </div> <div class="content-block"> <h2>Title</h2> <p>Content...</p> <a class="expand" href="#">Expand View</a> </div> JQUERY: $(document).ready(function(){ $('a.expand').click(function(){ $(this).parent('.content-block').toggleClass('wide'); }); });

    Read the article

  • How to get `gcc` to generate `bts` instruction for x86-64 from standard C?

    - by Norman Ramsey
    Inspired by a recent question, I'd like to know if anyone knows how to get gcc to generate the x86-64 bts instruction (bit test and set) on the Linux x86-64 platforms, without resorting to inline assembly or to nonstandard compiler intrinsics. Related questions: Why doesn't gcc do this for a simple |= operation were the right-hand side has exactly 1 bit set? How to get bts using compiler intrinsics or the asm directive Portability is more important to me than bts, so I won't use and asm directive, and if there's another solution, I prefer not to use compiler instrinsics. EDIT: The C source language does not support atomic operations, so I'm not particularly interested in getting atomic test-and-set (even though that's the original reason for test-and-set to exist in the first place). If I want something atomic I know I have no chance of doing it with standard C source: it has to be an intrinsic, a library function, or inline assembly. (I have implemented atomic operations in compilers that support multiple threads.)

    Read the article

< Previous Page | 238 239 240 241 242 243 244 245 246 247 248 249  | Next Page >