Search Results

Search found 6323 results on 253 pages for 'angularjs compile'.

Page 250/253 | < Previous Page | 246 247 248 249 250 251 252 253  | Next Page >

  • Hibernate error: cannot resolve table

    - by Roman
    I'm trying to make work the example from hibernate reference. I've got simple table Pupil with id, name and age fields. I've created correct (as I think) java-class for it according to all java-beans rules. I've created configuration file - hibernate.cfg.xml, just like in the example from reference. I've created hibernate mapping for one class Pupil, and here is the error occured. <hibernate-mapping> <class name="Pupil" table="pupils"> ... </class> </hibernate-mapping> table="pupils" is red in my IDE and I see message "cannot resolve table pupils". I've also founded very strange note in reference which says that most users fail with the same problem trying to run the example. Ah.. I'm very angry with this example.. IMHO if authors know that there is such problem they should add some information about it. But, how should I fix it? I don't want to deal with Ant here and with other instruments used in example. I'm using MySql 5.0, but I think it doesn't matter. UPD: source code Pupil.java - my persistent class package domain; public class Pupil { private Integer id; private String name; private Integer age; protected Pupil () { } public Pupil (String name, int age) { this.age = age; this.name = name; } public Integer getId () { return id; } public void setId (Integer id) { this.id = id; } public String getName () { return name; } public void setName (String name) { this.name = name; } public Integer getAge () { return age; } public void setAge (Integer age) { this.age = age; } public String toString () { return "Pupil [ name = " + name + ", age = " + age + " ]"; } } Pupil.hbm.xml is mapping for this class <?xml version="1.0"?> <!DOCTYPE hibernate-mapping PUBLIC "-//Hibernate/Hibernate Mapping DTD 3.0//EN" "http://hibernate.sourceforge.net/hibernate-mapping-3.0.dtd"> <hibernate-mapping package="domain" > <class name="Pupil" table="pupils"> <id name="id"> <generator class="native" /> </id> <property name="name" not-null="true"/> <property name="age"/> </class> </hibernate-mapping> hibernate.cfg.xml - configuration for hibernate <hibernate-configuration> <session-factory> <!-- Database connection settings --> <property name="connection.driver_class">com.mysql.jdbc.Driver</property> <property name="connection.url">jdbc:mysql://localhost/hbm_test</property> <property name="connection.username">root</property> <property name="connection.password">root</property> <property name="connection.pool_size">1</property> <property name="dialect">org.hibernate.dialect.MySQL5Dialect</property> <property name="current_session_context_class">thread</property> <property name="show_sql">true</property> <mapping resource="domain/Pupil.hbm.xml"/> </session-factory> </hibernate-configuration> HibernateUtils.java package utils; import org.hibernate.SessionFactory; import org.hibernate.HibernateException; import org.hibernate.cfg.Configuration; public class HibernateUtils { private static final SessionFactory sessionFactory; static { try { sessionFactory = new Configuration ().configure ().buildSessionFactory (); } catch (HibernateException he) { System.err.println (he); throw new ExceptionInInitializerError (he); } } public static SessionFactory getSessionFactory () { return sessionFactory; } } Runner.java - class for testing hibernate import org.hibernate.Session; import java.util.*; import utils.HibernateUtils; import domain.Pupil; public class Runner { public static void main (String[] args) { Session s = HibernateUtils.getSessionFactory ().getCurrentSession (); s.beginTransaction (); List pups = s.createQuery ("from Pupil").list (); for (Object obj : pups) { System.out.println (obj); } s.getTransaction ().commit (); HibernateUtils.getSessionFactory ().close (); } } My libs: antlr-2.7.6.jar, asm.jar, asm-attrs.jar, cglib-2.1.3.jar, commons-collections-2.1.1.jar, commons-logging-1.0.4.jar, dom4j-1.6.1.jar, hibernate3.jar, jta.jar, log4j-1.2.11.jar, mysql-connector-java-5.1.7-bin.jar Compile error: cannot resolve table pupils

    Read the article

  • GCC ICE -- alternative function syntax, variadic templates and tuples

    - by Marc H.
    (Related to C++0x, How do I expand a tuple into variadic template function arguments?.) The following code (see below) is taken from this discussion. The objective is to apply a function to a tuple. I simplified the template parameters and modified the code to allow for a return value of generic type. While the original code compiles fine, when I try to compile the modified code with GCC 4.4.3, g++ -std=c++0x main.cc -o main GCC reports an internal compiler error (ICE) with the following message: main.cc: In function ‘int main()’: main.cc:53: internal compiler error: in tsubst_copy, at cp/pt.c:10077 Please submit a full bug report, with preprocessed source if appropriate. See <file:///usr/share/doc/gcc-4.4/README.Bugs> for instructions. Question: Is the code correct? or is the ICE triggered by illegal code? // file: main.cc #include <tuple> // Recursive case template<unsigned int N> struct Apply_aux { template<typename F, typename T, typename... X> static auto apply(F f, const T& t, X... x) -> decltype(Apply_aux<N-1>::apply(f, t, std::get<N-1>(t), x...)) { return Apply_aux<N-1>::apply(f, t, std::get<N-1>(t), x...); } }; // Terminal case template<> struct Apply_aux<0> { template<typename F, typename T, typename... X> static auto apply(F f, const T&, X... x) -> decltype(f(x...)) { return f(x...); } }; // Actual apply function template<typename F, typename T> auto apply(F f, const T& t) -> decltype(Apply_aux<std::tuple_size<T>::value>::apply(f, t)) { return Apply_aux<std::tuple_size<T>::value>::apply(f, t); } // Testing #include <string> #include <iostream> int f(int p1, double p2, std::string p3) { std::cout << "int=" << p1 << ", double=" << p2 << ", string=" << p3 << std::endl; return 1; } int g(int p1, std::string p2) { std::cout << "int=" << p1 << ", string=" << p2 << std::endl; return 2; } int main() { std::tuple<int, double, char const*> tup(1, 2.0, "xxx"); std::cout << apply(f, tup) << std::endl; std::cout << apply(g, std::make_tuple(4, "yyy")) << std::endl; } Remark: If I hardcode the return type in the recursive case (see code), then everything is fine. That is, substituting this snippet for the recursive case does not trigger the ICE: // Recursive case (hardcoded return type) template<unsigned int N> struct Apply_aux { template<typename F, typename T, typename... X> static int apply(F f, const T& t, X... x) { return Apply_aux<N-1>::apply(f, t, std::get<N-1>(t), x...); } }; Alas, this is an incomplete solution to the original problem.

    Read the article

  • Why does calling IEnumerable<string>.Count() create an additional assembly dependency ?

    - by Gishu
    Assume this chain of dll references Tests.dll >> Automation.dll >> White.Core.dll with the following line of code in Tests.dll, where everything builds result.MissingPaths Now when I change this to result.MissingPaths.Count() I get the following build error for Tests.dll "White.UIItem is not defined in an assembly that is not referenced. You must add a reference to White.Core.dll." And I don't want to do that because it breaks my layering. Here is the type definition for result, which is in Automation.dll public class HasResult { public HasResult(IEnumerable<string> missingPaths ) { MissingPaths = missingPaths; } public IEnumerable<string> MissingPaths { get; set; } public bool AllExist { get { return !MissingPaths.Any(); } } } Down the call chain the input param to this ctor is created via (The TreeNode class is in White.Core.dll) assetPaths.Where(assetPath => !FindTreeNodeUsingCache(treeHandle, assetPath)); Why does this dependency leak when calling Count() on IEnumerable ? I then suspected that lazy evaluation was causing this (for some reason) - so I slotted in an ToArray() in the above line but didn't work. Update 2011 01 07: Curiouser and Curiouser! it won't build until I add a White.Core reference. So I add a reference and build it (in order to find the elusive dependency source). Open it up in Reflector and the only references listed are Automation, mscorlib, System.core and NUnit. So the compiler threw away the White reference as it was not needed. ILDASM also confirms that there is no White AssemblyRef entry. Any ideas on how to get to the bottom of this thing (primarily for 'now I wanna know why' reasons)? What are the chances that this is an VS2010/MSBuild bug? Update 2011 01 07 #2 As per Shimmy's suggestion, tried calling the method explcitly as an extension method Enumerable.Count(result.MissingPaths) and it stops cribbing (not sure why). However I moved some code around after that and now I'm getting the same issue at a different location using IEnumerable - this time reading and filtering lines out of a file on disk (totally unrelated to White). Seems like it's a 'symptom-fix'. var lines = File.ReadLines(aFilePath).ToArray(); once again, if I remove the ToArray() it compiles again - it seems that any method that causes the enumerable to be evaluated (ToArray, Count, ToList, etc.) causes this. Let me try and get a working tiny-app to demo this issue... Update 2011 01 07 #3 Phew! More information.. It turns out the problem is just in one source file - this file is LINQ-phobic. Any call to an Enumerable extension method has to be explicitly called out. The refactorings that I did caused a new method to be moved into this source file, which had some LINQ :) Still no clue as to why this class dislikes LINQ. using System; using System.Collections.Generic; using System.IO; using System.Linq; using G.S.OurAutomation.Constants; using G.S.OurAutomation.Framework; using NUnit.Framework; namespace G.S.AcceptanceTests { public abstract class ConfigureThingBase : OurTestFixture { .... private static IEnumerable<string> GetExpectedThingsFor(string param) { // even this won't compile - although it compiles fine in an adjoining source file in the same assembly //IEnumerable<string> s = new string[0]; //Console.WriteLine(s.Count()); // this is the line that is now causing a build failure // var expectedInfo = File.ReadLines(someCsvFilePath)) // .Where(line => !line.StartsWith("REM", StringComparison.InvariantCultureIgnoreCase)) // .Select(line => line.Replace("%PLACEHOLDER%", param)) // .ToArray(); // Unrolling the LINQ above removes the build error var expectedInfo = Enumerable.ToArray( Enumerable.Select( Enumerable.Where( File.ReadLines(someCsvFilePath)), line => !line.StartsWith("REM", StringComparison.InvariantCultureIgnoreCase)), line => line.Replace("%PLACEHOLDER%", param)));

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Completing install of ruby 1.9.3 with Ruby for for Mac OS X 10.7.5 Leopard, Xcode 4.5.2 -- problems with rvm pkg install openssl

    - by user1848361
    First, many thanks in advance for any help. I'm a complete novice with programming and I'm trying to get started with this Ruby on Rails tutorial (http://ruby.railstutorial.org/ruby-on-rails-tutorial-book?version=3.2) I have been trying figure this out for about 7 hours now and since I don't have any hair left to pull out I'm turning to these hallowed pages. I have searched for solutions here again and again. System: Mac OS X 10.7.5 Leopard, Xcode 4.5.2 I installed homebrew and have updated it multiple times I used homebrew to install rvm and have updated it multiple times I installed git The standard ruby on the system (checking with $ ruby -v) is 1.8.7 My problem is that every time I try to use rvm to install a new version of Ruby ($ rvm install 1.9.3) I get the following error: Ruby (and needed base gems) for your selection will be installed shortly. Before it happens, please read and execute the instructions below. Please use a separate terminal to execute any additional commands. Notes for Mac OS X 10.7.5, Xcode 4.5.2. For JRuby: Install the JDK. See http://developer.apple.com/java/download/ # Current Java version "1.6.0_26" For IronRuby: Install Mono >= 2.6 For Ruby 1.9.3: Install libksba # If using Homebrew, 'brew install libksba' For Opal: Install Nodejs with NPM. See http://nodejs.org/download/ To use an RVM installed Ruby as default, instead of the system ruby: rvm install 1.8.7 # installs patch 357: closest supported version rvm system ; rvm gemset export system.gems ; rvm 1.8.7 ; rvm gemset import system.gems # migrate your gems rvm alias create default 1.8.7 And reopen your terminal windows. Xcode and gcc: : I have performed $ brew install libksba and when I try to do it again it tells me that libksba is installed already. When I type "$ rvm requirements" I get: Notes for Mac OS X 10.7.5, Xcode 4.5.2. For JRuby: Install the JDK. See http://developer.apple.com/java/download/ # Current Java version "1.6.0_26" For IronRuby: Install Mono >= 2.6 For Ruby 1.9.3: Install libksba # If using Homebrew, 'brew install libksba' For Opal: Install Nodejs with NPM. See http://nodejs.org/download/ To use an RVM installed Ruby as default, instead of the system ruby: rvm install 1.8.7 # installs patch 357: closest supported version rvm system ; rvm gemset export system.gems ; rvm 1.8.7 ; rvm gemset import system.gems # migrate your gems rvm alias create default 1.8.7 And reopen your terminal windows. Xcode and gcc: Right now Ruby requires gcc to compile, but Xcode 4.2 and later no longer ship with gcc. Instead they ship with llvm-gcc (to which gcc is a symlink) and clang, neither of which are supported for building Ruby. Xcode 4.1 was the last version to ship gcc, which was /usr/bin/gcc-4.2. Xcode 4.1 and earlier: - Ruby will build fine. Xcode 4.2 and later (including Command Line Tools for Xcode): - If you have gcc-4.2 (and friends) from an earlier Xcode version, Ruby will build fine. - If you don't have gcc-4.2, you have two options to get it: * Install apple-gcc42 from Homebrew * Install osx-gcc-installer Homebrew: If you are using Homebrew, you can install the apple-gcc42 and required libraries from homebrew/dupes: brew update brew tap homebrew/dupes brew install autoconf automake apple-gcc42 rvm pkg install openssl Xcode 4.2+ install or/and Command Line Tools for Xcode is required to provide make and other tools. osx-gcc-installer: If you don't use Homebrew, you can download and install osx-gcc-installer: https://github.com/kennethreitz/osx-gcc-installer. Warning: Installing osx-gcc-installer on top of a recent Xcode is known to cause problems, so you must uninstall Xcode before installing osx-gcc-installer. Afterwards you may install Xcode 4.2+ or Command Line Tools for Xcode if you desire. ** NOTE: Currently, Node.js is having issues building with osx-gcc-installer. The only fix is to install Xcode over osx-gcc-installer. So I assume I have to do something with brew update brew tap homebrew/dupes brew install autoconf automake apple-gcc42 rvm pkg install openssl Everything seemed to work fine until "$ rvm pkg install openssl", which returns: Fetching openssl-1.0.1c.tar.gz to /Users/thierinvestmentservices/.rvm/archives Extracting openssl to /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c Configuring openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Compiling openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Error running 'make', please read /Users/thierinvestmentservices/.rvm/log/openssl/make.log Please note that it's required to reinstall all rubies: rvm reinstall all --force Updating openssl certificates Error running 'update_openssl_certs', please read /Users/thierinvestmentservices/.rvm/log/openssl.certs.log Johns-MacBook-Pro:~ thierinvestmentservices$ rvm pkg install openssl Fetching openssl-1.0.1c.tar.gz to /Users/thierinvestmentservices/.rvm/archives Extracting openssl to /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c Configuring openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Compiling openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Error running 'make', please read /Users/thierinvestmentservices/.rvm/log/openssl/make.log Please note that it's required to reinstall all rubies: rvm reinstall all --force Updating openssl certificates Error running 'update_openssl_certs', please read /Users/thierinvestmentservices/.rvm/log/openssl.certs.log make.log reads "[2012-11-23 13:15:28] make /Users/thierinvestmentservices/.rvm/scripts/functions/utility: line 116: make: command not found" and openssl.certs.log reads "[2012-11-23 14:04:04] update_openssl_certs update_openssl_certs () { ( chpwd_functions="" builtin cd $rvm_usr_path/ssl && command curl -O http://curl.haxx.se/ca/cacert.pem && mv cacert.pem cert.pem ) } current path: /Users/thierinvestmentservices command(1): update_openssl_certs /Users/thierinvestmentservices/.rvm/scripts/functions/pkg: line 205: cd: /Users/thierinvestmentservices/.rvm/usr/ssl: No such file or directory" At this point the letters might as well be wingdings I have no idea what is going on. I have tried to install rvm make with something I saw on one forum post but I got a bunch of warnings. If anyone has any suggestions I would be deeply grateful, I am completely in over my head,

    Read the article

  • Problem measuring N times the execution time of a code block

    - by Nazgulled
    EDIT: I just found my problem after writing this long post explaining every little detail... If someone can give me a good answer on what I'm doing wrong and how can I get the execution time in seconds (using a float with 5 decimal places or so), I'll mark that as accepted. Hint: The problem was on how I interpreted the clock_getttime() man page. Hi, Let's say I have a function named myOperation that I need to measure the execution time of. To measure it, I'm using clock_gettime() as it was recommend here in one of the comments. My teacher recommends us to measure it N times so we can get an average, standard deviation and median for the final report. He also recommends us to execute myOperation M times instead of just one. If myOperation is a very fast operation, measuring it M times allow us to get a sense of the "real time" it takes; cause the clock being used might not have the required precision to measure such operation. So, execution myOperation only one time or M times really depends if the operation itself takes long enough for the clock precision we are using. I'm having trouble dealing with that M times execution. Increasing M decreases (a lot) the final average value. Which doesn't make sense to me. It's like this, on average you take 3 to 5 seconds to travel from point A to B. But then you go from A to B and back to A 5 times (which makes it 10 times, cause A to B is the same as B to A) and you measure that. Than you divide by 10, the average you get is supposed to be the same average you take traveling from point A to B, which is 3 to 5 seconds. This is what I want my code to do, but it's not working. If I keep increasing the number of times I go from A to B and back A, the average will be lower and lower each time, it makes no sense to me. Enough theory, here's my code: #include <stdio.h> #include <time.h> #define MEASUREMENTS 1 #define OPERATIONS 1 typedef struct timespec TimeClock; TimeClock diffTimeClock(TimeClock start, TimeClock end) { TimeClock aux; if((end.tv_nsec - start.tv_nsec) < 0) { aux.tv_sec = end.tv_sec - start.tv_sec - 1; aux.tv_nsec = 1E9 + end.tv_nsec - start.tv_nsec; } else { aux.tv_sec = end.tv_sec - start.tv_sec; aux.tv_nsec = end.tv_nsec - start.tv_nsec; } return aux; } int main(void) { TimeClock sTime, eTime, dTime; int i, j; for(i = 0; i < MEASUREMENTS; i++) { printf(" » MEASURE %02d\n", i+1); clock_gettime(CLOCK_REALTIME, &sTime); for(j = 0; j < OPERATIONS; j++) { myOperation(); } clock_gettime(CLOCK_REALTIME, &eTime); dTime = diffTimeClock(sTime, eTime); printf(" - NSEC (TOTAL): %ld\n", dTime.tv_nsec); printf(" - NSEC (OP): %ld\n\n", dTime.tv_nsec / OPERATIONS); } return 0; } Notes: The above diffTimeClock function is from this blog post. I replaced my real operation with myOperation() because it doesn't make any sense to post my real functions as I would have to post long blocks of code, you can easily code a myOperation() with whatever you like to compile the code if you wish. As you can see, OPERATIONS = 1 and the results are: » MEASURE 01 - NSEC (TOTAL): 27456580 - NSEC (OP): 27456580 For OPERATIONS = 100 the results are: » MEASURE 01 - NSEC (TOTAL): 218929736 - NSEC (OP): 2189297 For OPERATIONS = 1000 the results are: » MEASURE 01 - NSEC (TOTAL): 862834890 - NSEC (OP): 862834 For OPERATIONS = 10000 the results are: » MEASURE 01 - NSEC (TOTAL): 574133641 - NSEC (OP): 57413 Now, I'm not a math wiz, far from it actually, but this doesn't make any sense to me whatsoever. I've already talked about this with a friend that's on this project with me and he also can't understand the differences. I don't understand why the value is getting lower and lower when I increase OPERATIONS. The operation itself should take the same time (on average of course, not the exact same time), no matter how many times I execute it. You could tell me that that actually depends on the operation itself, the data being read and that some data could already be in the cache and bla bla, but I don't think that's the problem. In my case, myOperation is reading 5000 lines of text from an CSV file, separating the values by ; and inserting those values into a data structure. For each iteration, I'm destroying the data structure and initializing it again. Now that I think of it, I also that think that there's a problem measuring time with clock_gettime(), maybe I'm not using it right. I mean, look at the last example, where OPERATIONS = 10000. The total time it took was 574133641ns, which would be roughly 0,5s; that's impossible, it took a couple of minutes as I couldn't stand looking at the screen waiting and went to eat something.

    Read the article

  • When building a web Application project, TFS 2008 Builds two spearate projects in the _PublishedFold

    - by Steve Johnson
    Hi all, I am trying to a perform build automation on one of web application projects built using VS 2008. The _PublishedWebSites contains two folders: Web and Deploy. I just want the TFS 2008 to generate only the Deploy Folder and Not the Web Folder. Here is my TFSBuild.proj File <Project ToolsVersion="3.5" DefaultTargets="Compile" xmlns="http://schemas.microsoft.com/developer/msbuild/2003"> <Import Project="$(MSBuildExtensionsPath)\Microsoft\VisualStudio\TeamBuild\Microsoft.TeamFoundation.Build.targets" /> <Import Project="$(MSBuildExtensionsPath)\Microsoft\WebDeployment\v9.0\Microsoft.WebDeployment.targets" /> <ItemGroup> <SolutionToBuild Include="$(BuildProjectFolderPath)/../../Development/Main/MySoftware.sln"> <Targets></Targets> <Properties></Properties> </SolutionToBuild> </ItemGroup> <ItemGroup> <ConfigurationToBuild Include="Release|AnyCPU"> <FlavorToBuild>Release</FlavorToBuild> <PlatformToBuild>Any CPU</PlatformToBuild> </ConfigurationToBuild> </ItemGroup> <!--<ItemGroup> <SolutionToBuild Include="$(BuildProjectFolderPath)/../../Development/Main/MySoftware.sln"> <Targets></Targets> <Properties></Properties> </SolutionToBuild> </ItemGroup> <ItemGroup> <ConfigurationToBuild Include="Release|x64"> <FlavorToBuild>Release</FlavorToBuild> <PlatformToBuild>x64</PlatformToBuild> </ConfigurationToBuild> </ItemGroup>--> <ItemGroup> <AdditionalReferencePath Include="C:\3PR" /> </ItemGroup> <Target Name="GetCopyToOutputDirectoryItems" Outputs="@(AllItemsFullPathWithTargetPath)" DependsOnTargets="AssignTargetPaths;_SplitProjectReferencesByFileExistence"> <!-- Get items from child projects first. --> <MSBuild Projects="@(_MSBuildProjectReferenceExistent)" Targets="GetCopyToOutputDirectoryItems" Properties="%(_MSBuildProjectReferenceExistent.SetConfiguration); %(_MSBuildProjectReferenceExistent.SetPlatform)" Condition="'@(_MSBuildProjectReferenceExistent)'!=''"> <Output TaskParameter="TargetOutputs" ItemName="_AllChildProjectItemsWithTargetPathNotFiltered"/> </MSBuild> <!-- Remove duplicates. --> <RemoveDuplicates Inputs="@(_AllChildProjectItemsWithTargetPathNotFiltered)"> <Output TaskParameter="Filtered" ItemName="_AllChildProjectItemsWithTargetPath"/> </RemoveDuplicates> <!-- Target outputs must be full paths because they will be consumed by a different project. --> <CreateItem Include="@(_AllChildProjectItemsWithTargetPath->'%(FullPath)')" Exclude= "$(BuildProjectFolderPath)/../../Development/Main/Web/Bin*.pdb; *.refresh; *.vshost.exe; *.manifest; *.compiled; $(BuildProjectFolderPath)/../../Development/Main/Web/Auth/MySoftware.dll; $(BuildProjectFolderPath)/../../Development/Main/Web/BinApp_Web_*.dll;" Condition="'%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='Always' or '%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='PreserveNewest'" > <Output TaskParameter="Include" ItemName="AllItemsFullPathWithTargetPath"/> <Output TaskParameter="Include" ItemName="_SourceItemsToCopyToOutputDirectoryAlways" Condition="'%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='Always'"/> <Output TaskParameter="Include" ItemName="_SourceItemsToCopyToOutputDirectory" Condition="'%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='PreserveNewest'"/> </CreateItem> </Target> <!-- To modify your build process, add your task inside one of the targets below and uncomment it. Other similar extension points exist, see Microsoft.WebDeployment.targets. <Target Name="BeforeBuild"> </Target> <Target Name="BeforeMerge"> </Target> <Target Name="AfterMerge"> </Target> <Target Name="AfterBuild"> </Target> --> </Project> I want to build everything that the builtin Deploy project is doing for me. But i dont want the generated Web Project as it conatains App_Web_xxxx.dll assemblies instead of a single compiled assembly. Please help. Thanks

    Read the article

  • Convert Decimal to ASCII

    - by Dan Snyder
    I'm having difficulty using reinterpret_cast. Before I show you my code I'll let you know what I'm trying to do. I'm trying to get a filename from a vector full of data being used by a MIPS I processor I designed. Basically what I do is compile a binary from a test program for my processor, dump all the hex's from the binary into a vector in my c++ program, convert all of those hex's to decimal integers and store them in a DataMemory vector which is the data memory unit for my processor. I also have instruction memory. So When my processor runs a SYSCALL instruction such as "Open File" my C++ operating system emulator receives a pointer to the beginning of the filename in my data memory. So keep in mind that data memory is full of ints, strings, globals, locals, all sorts of stuff. When I'm told where the filename starts I do the following: Convert the whole decimal integer element that is being pointed to to its ASCII character representation, and then search from left to right to see if the string terminates, if not then just load each character consecutively into a "filename" string. Do this until termination of the string in memory and then store filename in a table. My difficulty is generating filename from my memory. Here is an example of what I'm trying to do: C++ Syntax (Toggle Plain Text) 1.Index Vector NewVector ASCII filename 2.0 240faef0 128123792 'abc7' 'a' 3.0 240faef0 128123792 'abc7' 'ab' 4.0 240faef0 128123792 'abc7' 'abc' 5.0 240faef0 128123792 'abc7' 'abc7' 6.1 1234567a 243225 'k2s0' 'abc7k' 7.1 1234567a 243225 'k2s0' 'abc7k2' 8.1 1234567a 243225 'k2s0' 'abc7k2s' 9. //EXIT LOOP// 10.1 1234567a 243225 'k2s0' 'abc7k2s' Index Vector NewVector ASCII filename 0 240faef0 128123792 'abc7' 'a' 0 240faef0 128123792 'abc7' 'ab' 0 240faef0 128123792 'abc7' 'abc' 0 240faef0 128123792 'abc7' 'abc7' 1 1234567a 243225 'k2s0' 'abc7k' 1 1234567a 243225 'k2s0' 'abc7k2' 1 1234567a 243225 'k2s0' 'abc7k2s' //EXIT LOOP// 1 1234567a 243225 'k2s0' 'abc7k2s' Here is the code that I've written so far to get filename (I'm just applying this to element 1000 of my DataMemory vector to test functionality. 1000 is arbitrary.): C++ Syntax (Toggle Plain Text) 1.int i = 0; 2.int step = 1000;//top->a0; 3.string filename; 4.char *temp = reinterpret_cast<char*>( DataMemory[1000] );//convert to char 5.cout << "a0:" << top->a0 << endl;//pointer supplied 6.cout << "Data:" << DataMemory[top->a0] << endl;//my vector at pointed to location 7.cout << "Data(1000):" << DataMemory[1000] << endl;//the element I'm testing 8.cout << "Characters:" << &temp << endl;//my temporary char array 9. 10.while(&temp[i]!=0) 11.{ 12. filename+=temp[i];//add most recent non-terminated character to string 13. i++; 14. if(i==4)//when 4 chatacters have been added.. 15. { 16. i=0; 17. step+=1;//restart loop at the next element in DataMemory 18. temp = reinterpret_cast<char*>( DataMemory[step] ); 19. } 20. } 21. cout << "Filename:" << filename << endl; int i = 0; int step = 1000;//top-a0; string filename; char *temp = reinterpret_cast( DataMemory[1000] );//convert to char cout << "a0:" << top-a0 << endl;//pointer supplied cout << "Data:" << DataMemory[top-a0] << endl;//my vector at pointed to location cout << "Data(1000):" << DataMemory[1000] << endl;//the element I'm testing cout << "Characters:" << &temp << endl;//my temporary char array while(&temp[i]!=0) { filename+=temp[i];//add most recent non-terminated character to string i++; if(i==3)//when 4 chatacters have been added.. { i=0; step+=1;//restart loop at the next element in DataMemory temp = reinterpret_cast( DataMemory[step] ); } } cout << "Filename:" << filename << endl; So the issue is that when I do the conversion of my decimal element to a char array I assume that 8 hex #'s will give me 4 characters. Why isn't this this case? Here is my output: C++ Syntax (Toggle Plain Text) 1.a0:0 2.Data:0 3.Data(1000):4428576 4.Characters:0x7fff5fbff128 5.Segmentation fault

    Read the article

  • When building a web application project, TFS 2008 builds two separate projects in _PublishedFolder.

    - by Steve Johnson
    I am trying to perform build automation on one of my web application projects built using VS 2008. The _PublishedWebSites contains two folders: Web and Deploy. I want TFS 2008 to generate only the deploy folder and not the web folder. Here is my TFSBuild.proj file: <Project ToolsVersion="3.5" DefaultTargets="Compile" xmlns="http://schemas.microsoft.com/developer/msbuild/2003"> <Import Project="$(MSBuildExtensionsPath)\Microsoft\VisualStudio\TeamBuild\Microsoft.TeamFoundation.Build.targets" /> <Import Project="$(MSBuildExtensionsPath)\Microsoft\WebDeployment\v9.0\Microsoft.WebDeployment.targets" /> <ItemGroup> <SolutionToBuild Include="$(BuildProjectFolderPath)/../../Development/Main/MySoftware.sln"> <Targets></Targets> <Properties></Properties> </SolutionToBuild> </ItemGroup> <ItemGroup> <ConfigurationToBuild Include="Release|AnyCPU"> <FlavorToBuild>Release</FlavorToBuild> <PlatformToBuild>Any CPU</PlatformToBuild> </ConfigurationToBuild> </ItemGroup> <!--<ItemGroup> <SolutionToBuild Include="$(BuildProjectFolderPath)/../../Development/Main/MySoftware.sln"> <Targets></Targets> <Properties></Properties> </SolutionToBuild> </ItemGroup> <ItemGroup> <ConfigurationToBuild Include="Release|x64"> <FlavorToBuild>Release</FlavorToBuild> <PlatformToBuild>x64</PlatformToBuild> </ConfigurationToBuild> </ItemGroup>--> <ItemGroup> <AdditionalReferencePath Include="C:\3PR" /> </ItemGroup> <Target Name="GetCopyToOutputDirectoryItems" Outputs="@(AllItemsFullPathWithTargetPath)" DependsOnTargets="AssignTargetPaths;_SplitProjectReferencesByFileExistence"> <!-- Get items from child projects first. --> <MSBuild Projects="@(_MSBuildProjectReferenceExistent)" Targets="GetCopyToOutputDirectoryItems" Properties="%(_MSBuildProjectReferenceExistent.SetConfiguration); %(_MSBuildProjectReferenceExistent.SetPlatform)" Condition="'@(_MSBuildProjectReferenceExistent)'!=''"> <Output TaskParameter="TargetOutputs" ItemName="_AllChildProjectItemsWithTargetPathNotFiltered"/> </MSBuild> <!-- Remove duplicates. --> <RemoveDuplicates Inputs="@(_AllChildProjectItemsWithTargetPathNotFiltered)"> <Output TaskParameter="Filtered" ItemName="_AllChildProjectItemsWithTargetPath"/> </RemoveDuplicates> <!-- Target outputs must be full paths because they will be consumed by a different project. --> <CreateItem Include="@(_AllChildProjectItemsWithTargetPath->'%(FullPath)')" Exclude= "$(BuildProjectFolderPath)/../../Development/Main/Web/Bin*.pdb; *.refresh; *.vshost.exe; *.manifest; *.compiled; $(BuildProjectFolderPath)/../../Development/Main/Web/Auth/MySoftware.dll; $(BuildProjectFolderPath)/../../Development/Main/Web/BinApp_Web_*.dll;" Condition="'%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='Always' or '%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='PreserveNewest'" > <Output TaskParameter="Include" ItemName="AllItemsFullPathWithTargetPath"/> <Output TaskParameter="Include" ItemName="_SourceItemsToCopyToOutputDirectoryAlways" Condition="'%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='Always'"/> <Output TaskParameter="Include" ItemName="_SourceItemsToCopyToOutputDirectory" Condition="'%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='PreserveNewest'"/> </CreateItem> </Target> <!-- To modify your build process, add your task inside one of the targets below and uncomment it. Other similar extension points exist, see Microsoft.WebDeployment.targets. <Target Name="BeforeBuild"> </Target> <Target Name="BeforeMerge"> </Target> <Target Name="AfterMerge"> </Target> <Target Name="AfterBuild"> </Target> --> </Project> I want to build everything that the builtin Deploy project is doing for me. But I don't want the generated web project as it contains App_Web_xxxx.dll assemblies instead of a single compiled assembly. How can I do this?

    Read the article

  • Array subscript is not an integer

    - by Dimitri
    Hello folks, following this previous question Malloc Memory Corruption in C, now i have another problem. I have the same code. Now I am trying to multiply the values contained in the arrays A * vc and store in res. Then A is set to zero and i do a second multiplication with res and vc and i store the values in A. (A and Q are square matrices and mc and vc are N lines two columns matrices or arrays). Here is my code : int jacobi_gpu(double A[], double Q[], double tol, long int dim){ int nrot, p, q, k, tid; double c, s; double *mc, *vc, *res; int i,kc; double vc1, vc2; mc = (double *)malloc(2 * dim * sizeof(double)); vc = (double *)malloc(2 * dim * sizeof(double)); vc = (double *)malloc(dim * dim * sizeof(double)); if( mc == NULL || vc == NULL){ fprintf(stderr, "pb allocation matricre\n"); exit(1); } nrot = 0; for(k = 0; k < dim - 1; k++){ eye(mc, dim); eye(vc, dim); for(tid = 0; tid < floor(dim /2); tid++){ p = (tid + k)%(dim - 1); if(tid != 0) q = (dim - tid + k - 1)%(dim - 1); else q = dim - 1; printf("p = %d | q = %d\n", p, q); if(fabs(A[p + q*dim]) > tol){ nrot++; symschur2(A, dim, p, q, &c, &s); mc[2*tid] = p; vc[2 * tid] = c; mc[2*tid + 1] = q; vc[2*tid + 1] = -s; mc[2*tid + 2*(dim - 2*tid) - 2] = p; vc[2*tid + 2*(dim - 2*tid) - 2 ] = s; mc[2*tid + 2*(dim - 2*tid) - 1] = q; vc[2 * tid + 2*(dim - 2*tid) - 1 ] = c; } } for( i = 0; i< dim; i++){ for(kc=0; kc < dim; kc++){ if( kc < floor(dim/2)) { vc1 = vc[2*kc + i*dim]; vc2 = vc[2*kc + 2*(dim - 2*kc) - 2]; }else { vc1 = vc[2*kc+1 + i*dim]; vc2 = vc[2*kc - 2*(dim - 2*kc) - 1]; } res[kc + i*dim] = A[mc[2*kc] + i*dim]*vc1 + A[mc[2*kc + 1] + i*dim]*vc2; } } zero(A, dim); for( i = 0; i< dim; i++){ for(kc=0; kc < dim; k++){ if( k < floor(dim/2)){ vc1 = vc[2*kc + i*dim]; vc2 = vc[2*kc + 2*(dim - 2*kc) - 2]; }else { vc1 = vc[2*kc+1 + i*dim]; vc2 = vc[2*kc - 2*(dim - 2*kc) - 1]; } A[kc + i*dim] = res[mc[2*kc] + i*dim]*vc1 + res[mc[2*kc + 1] + i*dim]*vc2; } } affiche(mc,dim,2,"Matrice creuse"); affiche(vc,dim,2,"Valeur creuse"); } free(mc); free(vc); free(res); return nrot; } When i try to compile, i have this error : jacobi_gpu.c: In function ‘jacobi_gpu’: jacobi_gpu.c:103: error: array subscript is not an integer jacobi_gpu.c:103: error: array subscript is not an integer jacobi_gpu.c:118: error: array subscript is not an integer jacobi_gpu.c:118: error: array subscript is not an integer make: *** [jacobi_gpu.o] Erreur 1 The corresponding lines are where I store the results in res and A : res[kc + i*dim] = A[mc[2*kc] + i*dim]*vc1 + A[mc[2*kc + 1] + i*dim]*vc2; and A[kc + i*dim] = res[mc[2*kc] + i*dim]*vc1 + res[mc[2*kc + 1] + i*dim]*vc2; Can someone explain me what is this error and how can i correct it? Thanks for your help. ;)

    Read the article

  • Silverlight/Web Service Serializing Interface for use Client Side

    - by Steve Brouillard
    I have a Silverlight solution that references a third-party web service. This web service generates XML, which is then processed into objects for use in Silverlight binding. At one point we the processing of XML to objects was done client-side, but we ran into performance issues and decided to move this processing to the proxies in the hosting web project to improve performance (which it did). This is obviously a gross over-simplification, but should work. My basic project structure looks like this. Solution Solution.Web - Holds the web page that hosts Silverlight as well as proxies that access web services and processes as required and obviously the references to those web services). Solution.Infrastructure - Holds references to the proxy web services in the .Web project, all genned code from serialized objects from those proxies and code around those objects that need to be client-side. Solution.Book - The particular project that uses the objects in question after processed down into Infrastructure. I've defined the following Interface and Class in the Web project. They represent the type of objects that the XML from the original third-party gets transformed into and since this is the only project in the Silverlight app that is actually server-side, that was the place to define and use them. //Doesn't get much simpler than this. public interface INavigable { string Description { get; set; } } //Very simple class too public class IndexEntry : INavigable { public List<IndexCM> CMItems { get; set; } public string CPTCode { get; set; } public string DefinitionOfAbbreviations { get; set; } public string Description { get; set; } public string EtiologyCode { get; set; } public bool HighScore { get; set; } public IndexToTabularCommandArguments IndexToTabularCommandArgument { get; set; } public bool IsExpanded { get; set; } public string ManifestationCode { get; set; } public string MorphologyCode { get; set; } public List<TextItem> NonEssentialModifiersAndQualifyingText { get; set; } public string OtherItalics { get; set; } public IndexEntry Parent { get; set; } public int Score { get; set; } public string SeeAlsoReference { get; set; } public string SeeReference { get; set; } public List<IndexEntry> SubEntries { get; set; } public int Words { get; set; } } Again; both of these items are defined in the Web project. Notice that IndexEntry implments INavigable. When the code for IndexEntry is auto-genned in the Infrastructure project, the definition of the class does not include the implmentation of INavigable. After discovering this, I thought "no problem, I'll create another partial class file reiterating the implmentation". Unfortunately (I'm guessing because it isn't being serialized), that interface isn't recognized in the Infrastructure project, so I can't simply do that. Here's where it gets really weird. The BOOK project CAN see the INavigable interface. In fact I use it in Book, though Book has no reference to the Web Service in the Web project where the thing is define, though Infrastructure does. Just as a test, I linked to the INavigable source file from indside the Infrastructure project. That allowed me to reference it in that project and compile, but causes havoc in the Book project, because now there's a conflick between the one define in Infrastructure and the one defined in the Web project's web service. This is behavior I would expect. So, to try and sum up a bit. Web project has a web service that process data from a third-party service and has a class and interface defined in it. The class implements the interface. The Infrastructure project references the web service in the Web Project and the Book project references the Infrastructure project. The implmentation of the interface in the class does NOT serialize down, so the auto-genned code in INfrastructure does not show this relationship, breaking code further down-stream. The Book project, whihc is further down-stream CAN see the interface as defined in the Web Project, even though its only reference is through the Infrastructure project; whihc CAN'T see it. Am I simple missing something easy here? Can I apply an attribute to either the Interface definition or to the its implmentation in the class to ensure its visibility downstream? Anything else I can do here? I know this is a bit convoluted and anyone still with me here, thanks for your patience and any advice you might have. Cheers, Steve

    Read the article

  • Unknown error in Producer/Consumer program, believe it to be an infinite loop.

    - by ray2k
    Hello, I am writing a program that is solving the producer/consumer problem, specifically the bounded-buffer version(i believe they mean the same thing). The producer will be generating x number of random numbers, where x is a command line parameter to my program. At the current moment, I believe my program is entering an infinite loop, but I'm not sure why it is occurring. I believe I am executing the semaphores correctly. You compile it like this: gcc -o prodcon prodcon.cpp -lpthread -lrt Then to run, ./prodcon 100(the number of randum nums to produce) This is my code. typedef int buffer_item; #include <stdlib.h> #include <stdio.h> #include <pthread.h> #include <semaphore.h> #include <unistd.h> #define BUFF_SIZE 10 #define RAND_DIVISOR 100000000 #define TRUE 1 //two threads void *Producer(void *param); void *Consumer(void *param); int insert_item(buffer_item item); int remove_item(buffer_item *item); int returnRandom(); //the global semaphores sem_t empty, full, mutex; //the buffer buffer_item buf[BUFF_SIZE]; //buffer counter int counter; //number of random numbers to produce int numRand; int main(int argc, char** argv) { /* thread ids and attributes */ pthread_t pid, cid; pthread_attr_t attr; pthread_attr_init(&attr); pthread_attr_setscope(&attr, PTHREAD_SCOPE_SYSTEM); numRand = atoi(argv[1]); sem_init(&empty,0,BUFF_SIZE); sem_init(&full,0,0); sem_init(&mutex,0,0); printf("main started\n"); pthread_create(&pid, &attr, Producer, NULL); pthread_create(&cid, &attr, Consumer, NULL); printf("main gets here"); pthread_join(pid, NULL); pthread_join(cid, NULL); printf("main done\n"); return 0; } //generates a randum number between 1 and 100 int returnRandom() { int num; srand(time(NULL)); num = rand() % 100 + 1; return num; } //begin producing items void *Producer(void *param) { buffer_item item; int i; for(i = 0; i < numRand; i++) { //sleep for a random period of time int rNum = rand() / RAND_DIVISOR; sleep(rNum); //generate a random number item = returnRandom(); //acquire the empty lock sem_wait(&empty); //acquire the mutex lock sem_wait(&mutex); if(insert_item(item)) { fprintf(stderr, " Producer report error condition\n"); } else { printf("producer produced %d\n", item); } /* release the mutex lock */ sem_post(&mutex); /* signal full */ sem_post(&full); } return NULL; } /* Consumer Thread */ void *Consumer(void *param) { buffer_item item; int i; for(i = 0; i < numRand; i++) { /* sleep for a random period of time */ int rNum = rand() / RAND_DIVISOR; sleep(rNum); /* aquire the full lock */ sem_wait(&full); /* aquire the mutex lock */ sem_wait(&mutex); if(remove_item(&item)) { fprintf(stderr, "Consumer report error condition\n"); } else { printf("consumer consumed %d\n", item); } /* release the mutex lock */ sem_post(&mutex); /* signal empty */ sem_post(&empty); } return NULL; } /* Add an item to the buffer */ int insert_item(buffer_item item) { /* When the buffer is not full add the item and increment the counter*/ if(counter < BUFF_SIZE) { buf[counter] = item; counter++; return 0; } else { /* Error the buffer is full */ return -1; } } /* Remove an item from the buffer */ int remove_item(buffer_item *item) { /* When the buffer is not empty remove the item and decrement the counter */ if(counter > 0) { *item = buf[(counter-1)]; counter--; return 0; } else { /* Error buffer empty */ return -1; } }

    Read the article

  • What's wrong with Bundler working with RubyGems to push a Git repo to Heroku?

    - by stanigator
    I've made sure that all the files are in the root of the repository as recommended in this discussion. However, as I follow the instructions in this section of the book, I can't get through the section without the problems. What do you think is happening with my system that's causing the error? I have no clue at the moment of what the problem means despite reading the following in the log. Thanks in advance for your help! stanley@ubuntu:~/rails_sample/first_app$ git push heroku master Warning: Permanently added the RSA host key for IP address '50.19.85.156' to the list of known hosts. Counting objects: 96, done. Compressing objects: 100% (79/79), done. Writing objects: 100% (96/96), 28.81 KiB, done. Total 96 (delta 22), reused 0 (delta 0) -----> Heroku receiving push -----> Ruby/Rails app detected -----> Installing dependencies using Bundler version 1.2.0.pre Running: bundle install --without development:test --path vendor/bundle --binstubs bin/ --deployment Fetching gem metadata from https://rubygems.org/....... Installing rake (0.9.2.2) Installing i18n (0.6.0) Installing multi_json (1.3.5) Installing activesupport (3.2.3) Installing builder (3.0.0) Installing activemodel (3.2.3) Installing erubis (2.7.0) Installing journey (1.0.3) Installing rack (1.4.1) Installing rack-cache (1.2) Installing rack-test (0.6.1) Installing hike (1.2.1) Installing tilt (1.3.3) Installing sprockets (2.1.3) Installing actionpack (3.2.3) Installing mime-types (1.18) Installing polyglot (0.3.3) Installing treetop (1.4.10) Installing mail (2.4.4) Installing actionmailer (3.2.3) Installing arel (3.0.2) Installing tzinfo (0.3.33) Installing activerecord (3.2.3) Installing activeresource (3.2.3) Installing coffee-script-source (1.3.3) Installing execjs (1.3.2) Installing coffee-script (2.2.0) Installing rack-ssl (1.3.2) Installing json (1.7.3) with native extensions Installing rdoc (3.12) Installing thor (0.14.6) Installing railties (3.2.3) Installing coffee-rails (3.2.2) Installing jquery-rails (2.0.2) Using bundler (1.2.0.pre) Installing rails (3.2.3) Installing sass (3.1.18) Installing sass-rails (3.2.5) Installing sqlite3 (1.3.6) with native extensions Gem::Installer::ExtensionBuildError: ERROR: Failed to build gem native extension. /usr/local/bin/ruby extconf.rb checking for sqlite3.h... no sqlite3.h is missing. Try 'port install sqlite3 +universal' or 'yum install sqlite-devel' and check your shared library search path (the location where your sqlite3 shared library is located). *** extconf.rb failed *** Could not create Makefile due to some reason, probably lack of necessary libraries and/or headers. Check the mkmf.log file for more details. You may need configuration options. Provided configuration options: --with-opt-dir --without-opt-dir --with-opt-include --without-opt-include=${opt-dir}/include --with-opt-lib --without-opt-lib=${opt-dir}/lib --with-make-prog --without-make-prog --srcdir=. --curdir --ruby=/usr/local/bin/ruby --with-sqlite3-dir --without-sqlite3-dir --with-sqlite3-include --without-sqlite3-include=${sqlite3-dir}/include --with-sqlite3-lib --without-sqlite3-lib=${sqlite3-dir}/lib --enable-local --disable-local Gem files will remain installed in /tmp/build_3tplrxvj7qa81/vendor/bundle/ruby/1.9.1/gems/sqlite3-1.3.6 for inspection. Results logged to /tmp/build_3tplrxvj7qa81/vendor/bundle/ruby/1.9.1/gems/sqlite3-1.3.6/ext/sqlite3/gem_make.out An error occurred while installing sqlite3 (1.3.6), and Bundler cannot continue. Make sure that `gem install sqlite3 -v '1.3.6'` succeeds before bundling. ! ! Failed to install gems via Bundler. ! ! Heroku push rejected, failed to compile Ruby/rails app To [email protected]:growing-mountain-2788.git ! [remote rejected] master -> master (pre-receive hook declined) error: failed to push some refs to '[email protected]:growing-mountain-2788.git' ------Gemfile------------------------ As requested, here's the auto-generated gemfile: source 'https://rubygems.org' gem 'rails', '3.2.3' # Bundle edge Rails instead: # gem 'rails', :git => 'git://github.com/rails/rails.git' gem 'sqlite3' gem 'json' # Gems used only for assets and not required # in production environments by default. group :assets do gem 'sass-rails', '~> 3.2.3' gem 'coffee-rails', '~> 3.2.1' # See https://github.com/sstephenson/execjs#readme for more supported runtimes # gem 'therubyracer', :platform => :ruby gem 'uglifier', '>= 1.0.3' end gem 'jquery-rails' # To use ActiveModel has_secure_password # gem 'bcrypt-ruby', '~> 3.0.0' # To use Jbuilder templates for JSON # gem 'jbuilder' # Use unicorn as the app server # gem 'unicorn' # Deploy with Capistrano # gem 'capistrano' # To use debugger # gem 'ruby-debug'

    Read the article

  • C++ Sentinel/Count Controlled Loop beginning programming

    - by Bryan Hendricks
    Hello all this is my first post. I'm working on a homework assignment with the following parameters. Piecework Workers are paid by the piece. Often worker who produce a greater quantity of output are paid at a higher rate. 1 - 199 pieces completed $0.50 each 200 - 399 $0.55 each (for all pieces) 400 - 599 $0.60 each 600 or more $0.65 each Input: For each worker, input the name and number of pieces completed. Name Pieces Johnny Begood 265 Sally Great 650 Sam Klutz 177 Pete Precise 400 Fannie Fantastic 399 Morrie Mellow 200 Output: Print an appropriate title and column headings. There should be one detail line for each worker, which shows the name, number of pieces, and the amount earned. Compute and print totals of the number of pieces and the dollar amount earned. Processing: For each person, compute the pay earned by multiplying the number of pieces by the appropriate price. Accumulate the total number of pieces and the total dollar amount paid. Sample Program Output: Piecework Weekly Report Name Pieces Pay Johnny Begood 265 145.75 Sally Great 650 422.50 Sam Klutz 177 88.5 Pete Precise 400 240.00 Fannie Fantastic 399 219.45 Morrie Mellow 200 110.00 Totals 2091 1226.20 You are required to code, compile, link, and run a sentinel-controlled loop program that transforms the input to the output specifications as shown in the above attachment. The input items should be entered into a text file named piecework1.dat and the ouput file stored in piecework1.out . The program filename is piecework1.cpp. Copies of these three files should be e-mailed to me in their original form. Read the name using a single variable as opposed to two different variables. To accomplish this, you must use the getline(stream, variable) function as discussed in class, except that you will replace the cin with your textfile stream variable name. Do not forget to code the compiler directive #include < string at the top of your program to acknowledge the utilization of the string variable, name . Your nested if-else statement, accumulators, count-controlled loop, should be properly designed to process the data correctly. The code below will run, but does not produce any output. I think it needs something around line 57 like a count control to stop the loop. something like (and this is just an example....which is why it is not in the code.) count = 1; while (count <=4) Can someone review the code and tell me what kind of count I need to introduce, and if there are any other changes that need to be made. Thanks. [code] //COS 502-90 //November 2, 2012 //This program uses a sentinel-controlled loop that transforms input to output. #include <iostream> #include <fstream> #include <iomanip> //output formatting #include <string> //string variables using namespace std; int main() { double pieces; //number of pieces made double rate; //amout paid per amount produced double pay; //amount earned string name; //name of worker ifstream inFile; ofstream outFile; //***********input statements**************************** inFile.open("Piecework1.txt"); //opens the input text file outFile.open("piecework1.out"); //opens the output text file outFile << setprecision(2) << showpoint; outFile << name << setw(6) << "Pieces" << setw(12) << "Pay" << endl; outFile << "_____" << setw(6) << "_____" << setw(12) << "_____" << endl; getline(inFile, name, '*'); //priming read inFile >> pieces >> pay >> rate; // ,, while (name != "End of File") //while condition test { //begining of loop pay = pieces * rate; getline(inFile, name, '*'); //get next name inFile >> pieces; //get next pieces } //end of loop inFile.close(); outFile.close(); return 0; }[/code]

    Read the article

  • Undefined reference to ...

    - by Patrick LaChance
    I keep getting this error message every time I try to compile, and I cannot find out what the problem is. any help would be greatly appreciated: C:\DOCUME~1\Patrick\LOCALS~1\Temp/ccL92mj9.o:main.cpp:(.txt+0x184): undefined reference to 'List::List()' C:\DOCUME~1\Patrick\LOCALS~1\Temp/ccL92mj9.o:main.cpp:(.txt+0x184): undefined reference to 'List::add(int)' collect2: ld returned 1 exit status code: //List.h #ifndef LIST_H #define LIST_H #include <exception> //brief Definition of linked list class class List { public: /** \brief Exception for operating on empty list */ class Empty : public std::exception { public: virtual const char* what() const throw(); }; /** \brief Exception for invalid operations other than operating on an empty list */ class InvalidOperation : public std::exception { public: virtual const char* what() const throw(); }; /** \brief Node within List */ class Node { public: /** data element stored in this node */ int element; /** next node in list */ Node* next; /** previous node in list */ Node* previous; Node (int element); ~Node(); void print() const; void printDebug() const; }; List(); ~List(); void add(int element); void remove(int element); int first()const; int last()const; int removeFirst(); int removeLast(); bool isEmpty()const; int size()const; void printForward() const; void printReverse() const; void printDebug() const; /** enables extra output for debugging purposes */ static bool traceOn; private: /** head of list */ Node* head; /** tail of list */ Node* tail; /** count of number of nodes */ int count; }; #endif //List.cpp I only included the parts of List.cpp that might be the issue #include "List.h" #include <iostream> #include <iomanip> using namespace std; List::List() { //List::size = NULL; head = NULL; tail = NULL; } List::~List() { Node* current; while(head != NULL) { current = head-> next; delete current->previous; if (current->next!=NULL) { head = current; } else { delete current; } } } void List::add(int element) { Node* newNode; Node* current; newNode->element = element; if(newNode->element > head->element) { current = head->next; } else { head->previous = newNode; newNode->next = head; newNode->previous = NULL; return; } while(newNode->element > current->element) { current = current->next; } if(newNode->element <= current->element) { newNode->previous = current->previous; newNode->next = current; } } //main.cpp #include "List.h" #include <iostream> #include <string> using namespace std; //void add(int element); int main (char** argv, int argc) { List* MyList = new List(); bool quit = false; string value; int element; while(quit==false) { cin>>value; if(value == "add") { cin>>element; MyList->add(element); } if(value=="quit") { quit = true; } } return 0; } I'm doing everything I think I'm suppose to be doing. main.cpp isn't complete yet, just trying to get the add function to work first. Any help will be greatly appreciated.

    Read the article

  • Problem with GCC calling static templates functions in templated parent class.

    - by Adisak
    I have some code that compiles and runs on MSVC++ but will not compile on GCC. I have made a test snippet that follows. My goal was to move the static method from BFSMask to BFSMaskSized. Can someone explain what is going on with the errors (esp. the weird 'operator<' error)? Thank you. In the case of both #defines are 0, then the code compiles on GCC. #define DOESNT_COMPILE_WITH_GCC 0 #define FUNCTION_IN_PARENT 0 I get errors if I change either #define to 1. Here are the errors I see. #define DOESNT_COMPILE_WITH_GCC 0 #define FUNCTION_IN_PARENT 1 Test.cpp: In static member function 'static typename Snapper::BFSMask<T>::T_Parent::T_SINT Snapper::BFSMask<T>::Create_NEZ(TCMP)': Test.cpp(492): error: 'CreateMaskFromHighBitSized' was not declared in this scope #define DOESNT_COMPILE_WITH_GCC 1 #define FUNCTION_IN_PARENT 0 Test.cpp: In static member function 'static typename Snapper::BFSMask<T>::T_Parent::T_SINT Snapper::BFSMask<T>::Create_NEZ(TCMP) [with TCMP = int, T = int]': Test.cpp(500): instantiated from 'TVAL Snapper::BFWrappedInc(TVAL, TVAL, TVAL) [with TVAL = int]' Test.cpp(508): instantiated from here Test.cpp(490): error: invalid operands of types '<unresolved overloaded function type>' and 'unsigned int' to binary 'operator<' #define DOESNT_COMPILE_WITH_GCC 1 #define FUNCTION_IN_PARENT 1 Test.cpp: In static member function 'static typename Snapper::BFSMask<T>::T_Parent::T_SINT Snapper::BFSMask<T>::Create_NEZ(TCMP) [with TCMP = int, T = int]': Test.cpp(500): instantiated from 'TVAL Snapper::BFWrappedInc(TVAL, TVAL, TVAL) [with TVAL = int]' Test.cpp(508): instantiated from here Test.cpp(490): error: invalid operands of types '<unresolved overloaded function type>' and 'unsigned int' to binary 'operator<' Here is the code namespace Snapper { #define DOESNT_COMPILE_WITH_GCC 0 #define FUNCTION_IN_PARENT 0 // MASK TYPES // NEZ - Not Equal to Zero #define BFSMASK_NEZ(A) ( ( A ) | ( 0 - A ) ) #define BFSELECT_MASK(MASK,VTRUE,VFALSE) ( ((MASK)&(VTRUE)) | ((~(MASK))&(VFALSE)) ) template<typename TVAL> TVAL BFSelect_MASK(TVAL MASK,TVAL VTRUE,TVAL VFALSE) { return(BFSELECT_MASK(MASK,VTRUE,VFALSE)); } //----------------------------------------------------------------------------- // Branch Free Helpers template<int BYTESIZE> struct BFSMaskBase {}; template<> struct BFSMaskBase<2> { typedef UINT16 T_UINT; typedef SINT16 T_SINT; }; template<> struct BFSMaskBase<4> { typedef UINT32 T_UINT; typedef SINT32 T_SINT; }; template<int BYTESIZE> struct BFSMaskSized : public BFSMaskBase<BYTESIZE> { static const int SizeBytes = BYTESIZE; static const int SizeBits = SizeBytes*8; static const int MaskShift = SizeBits-1; typedef typename BFSMaskBase<BYTESIZE>::T_UINT T_UINT; typedef typename BFSMaskBase<BYTESIZE>::T_SINT T_SINT; #if FUNCTION_IN_PARENT template<int N> static T_SINT CreateMaskFromHighBitSized(typename BFSMaskBase<N>::T_SINT inmask); #endif }; template<typename T> struct BFSMask : public BFSMaskSized<sizeof(T)> { // BFSMask = -1 (all bits set) typedef BFSMask<T> T_This; // "Import" the Parent Class typedef BFSMaskSized<sizeof(T)> T_Parent; typedef typename T_Parent::T_SINT T_SINT; #if FUNCTION_IN_PARENT typedef T_Parent T_MaskGen; #else typedef T_This T_MaskGen; template<int N> static T_SINT CreateMaskFromHighBitSized(typename BFSMaskSized<N>::T_SINT inmask); #endif template<typename TCMP> static T_SINT Create_NEZ(TCMP A) { //ReDefineType(const typename BFSMask<TCMP>::T_SINT,SA,A); //const typename BFSMask<TCMP>::T_SINT cmpmask = BFSMASK_NEZ(SA); const typename BFSMask<TCMP>::T_SINT cmpmask = BFSMASK_NEZ(A); #if DOESNT_COMPILE_WITH_GCC return(T_MaskGen::CreateMaskFromHighBitSized<sizeof(TCMP)>(cmpmask)); #else return(CreateMaskFromHighBitSized<sizeof(TCMP)>(cmpmask)); #endif } }; template<typename TVAL> TVAL BFWrappedInc(TVAL x,TVAL minval,TVAL maxval) { const TVAL diff = maxval-x; const TVAL mask = BFSMask<TVAL>::Create_NEZ(diff); const TVAL incx = x + 1; return(BFSelect_MASK(mask,incx,minval)); } SINT32 currentsnap = 0; SINT32 SetSnapshot() { currentsnap=BFWrappedInc<SINT32>(currentsnap,0,20); return(currentsnap); } }

    Read the article

  • c++ / c confusion

    - by mrbuxley
    Im trying to make a small app in c++ that saves midifiles with this library. http://musicnote.sourceforge.net/docs/html/index.html The sample code that is given on the homepage looks like this. #include "MusicNoteLib.h" void main() { MusicNoteLib::Player player; // Create the Player Object player.Play("C D E F G A B"); // Play the Music Notes on the default MIDI output port } This piece of code won't compile in Visual studio 2008, I get many errors like MusicNoteLib.h(22) : error C4430: missing type specifier - int assumed. Note: C++ does not support default-int I don't understand the error or where to start looking... There also was some dll files that can be used instead of this h file. #ifndef __MUSICNOTE_LIB_H__EBEE094C_FF6E_43a1_A6CE_D619564F9C6A__ #define __MUSICNOTE_LIB_H__EBEE094C_FF6E_43a1_A6CE_D619564F9C6A__ /** @file MusicNoteLib.h * \brief Main header file for accessing the MusicNote Library */ /// <Summary> /// This header file can be included directly in your project or through /// MusicNoteLib.h of the MusicNoteDll project. If included directly, this /// will be built directly as a satic library. If included through MusicNoteDll /// this will use dllImports through MUSICNOTELIB_API /// </Summary> #ifndef MUSICNOTELIB_API #define MUSICNOTELIB_API #endif // MUSICNOTELIB_API //#include "Player.h" namespace MusicNoteLib /// Music Programming Library { typedef void (__stdcall *LPFNTRACEPROC)(void* pUserData, const TCHAR* szTraceMsg); typedef void (__stdcall *LPFNERRORPROC)(void* pUserData, long lErrCode, const TCHAR* szErrorMsg, const TCHAR* szToken); extern "C" { MUSICNOTELIB_API typedef void MStringPlayer; MUSICNOTELIB_API void* GetCarnaticMusicNoteReader(); /// <Summary> /// Creates a MusicString Player object. /// </Summary> MUSICNOTELIB_API MStringPlayer* CreateMusicStringPlayer(); /// <Summary> /// Plays Music string notes on the default MIDI Output device with the default Timer Resolution. /// Use PlayMusicStringWithOpts() to use custom values. /// @param szMusicNotes the Music string to be played on the MIDI output device /// @return True if the notes were played successfully, False otherwise /// </Summary> MUSICNOTELIB_API bool PlayMusicString(const TCHAR* szMusicNotes); /// <Summary> /// Same as PlayMusicString() except that this method accepts Callbacks. /// The Trace and Error callbacks will be used during the Parse of the Music Notes. /// @param szMusicNotes the Music string to be played on the MIDI output device /// @param traceCallbackProc the Callback to used to report Trace messages /// @param errorCallbackProc the Callback to used to report Error messages /// @param pUserData any user supplied data that should be sent to the Callback /// @return True if the notes were played successfully, False otherwise /// </Summary> MUSICNOTELIB_API bool PlayMusicStringCB(const TCHAR* szMusicNotes, LPFNTRACEPROC traceCallbackProc, LPFNERRORPROC errorCallbackProc, void* pUserData); /// <Summary> /// Plays Music string notes on the given MIDI Output device using the given Timer Resolution. /// Use PlayMusicString() to use default values. /// @param szMusicNotes the Music notes to be played /// @param nMidiOutPortID the device ID of the MIDI output port to be used for the play /// @param nTimerResMS preferred MIDI timer resolution, in MilliSeconds /// @return True if Play was successful, False otherwise /// </Summary> MUSICNOTELIB_API bool PlayMusicStringWithOpts(const TCHAR* szMusicNotes, int nMidiOutPortID, unsigned int nTimerResMS); /// <Summary> /// Same as PlayMusicStringWithOpts() except that this method accepts Callbacks. /// The Trace and Error callbacks will be used during the Parse of the Music Notes. /// @param szMusicNotes the Music notes to be played /// @param nMidiOutPortID the device ID of the MIDI output port to be used for the play /// @param nTimerResMS preferred MIDI timer resolution, in MilliSeconds /// @param traceCallbackProc the Callback to used to report Trace messages /// @param errorCallbackProc the Callback to used to report Error messages /// @param pUserData any user supplied data that should be sent to the Callback /// @return True if Play was successful, False otherwise /// </Summary> MUSICNOTELIB_API bool PlayMusicStringWithOptsCB(const TCHAR* szMusicNotes, int nMidiOutPortID, unsigned int nTimerResMS, LPFNTRACEPROC traceCallbackProc, LPFNERRORPROC errorCallbackProc, void* pUserData); /// <Summary> /// Save the given MusicString content into a MIDI output file /// @param szMusicNotes Music Notes to be converted to MIDI output /// @param szOutputFilePath path of the MIDI output file /// @return True if the the content was saved successfully, False otherwise /// </Summary> MUSICNOTELIB_API bool SaveAsMidiFile(const TCHAR* szMusicNotes, const char* szOutputFilePath); //MUSICNOTELIB_API typedef void (*ParseErrorProc)(const MusicNoteLib::CParser*, MusicNoteLib::CParser::ErrorEventHandlerArgs* pEvArgs); //MUSICNOTELIB_API typedef void (*ParseTraceProc)(const MusicNoteLib::CParser*, MusicNoteLib::CParser::TraceEventHandlerArgs* pEvArgs); MUSICNOTELIB_API void Parse(const TCHAR* szNotes, LPFNTRACEPROC traceCallbackProc, void* pUserData); } // extern "C" } // namespace MusicNoteLib #endif // __MUSICNOTE_LIB_H__EBEE094C_FF6E_43a1_A6CE_D619564F9C6A__

    Read the article

  • Linux C: "Interactive session" with separate read and write named pipes?

    - by ~sd-imi
    Hi all, I am trying to work with "Introduction to Interprocess Communication Using Named Pipes - Full-Duplex Communication Using Named Pipes", http://developers.sun.com/solaris/articles/named_pipes.html#5 ; in particular fd_server.c (included below for reference) Here is my info and compile line: :~$ cat /etc/issue Ubuntu 10.04 LTS \n \l :~$ gcc --version gcc (Ubuntu 4.4.3-4ubuntu5) 4.4.3 :~$ gcc fd_server.c -o fd_server fd_server.c creates two named pipes, one for reading and one for writing. What one can do, is: in one terminal, run the server and read (through cat) its write pipe: :~$ ./fd_server & 2/dev/null [1] 11354 :~$ cat /tmp/np2 and in another, write (using echo) to server's read pipe: :~$ echo "heeellloooo" /tmp/np1 going back to first terminal, one can see: :~$ cat /tmp/np2 HEEELLLOOOO 0[1]+ Exit 13 ./fd_server 2 /dev/null What I would like to do, is make sort of a "interactive" (or "shell"-like) session; that is, the server is run as usual, but instead of running "cat" and "echo", I'd like to use something akin to screen. What I mean by that, is that screen can be called like screen /dev/ttyS0 38400, and then it makes a sort of a interactive session, where what is typed in terminal is passed to /dev/ttyS0, and its response is written to terminal. Now, of course, I cannot use screen, because in my case the program has two separate nodes, and as far as I can tell, screen can refer to only one. How would one go about to achieve this sort of "interactive" session in this context (with two separate read/write pipes)? Thanks, Cheers! Code below: #include <stdio.h> #include <errno.h> #include <ctype.h> #include <sys/types.h> #include <sys/stat.h> #include <fcntl.h> //#include <fullduplex.h> /* For name of the named-pipe */ #define NP1 "/tmp/np1" #define NP2 "/tmp/np2" #define MAX_BUF_SIZE 255 #include <stdlib.h> //exit #include <string.h> //strlen int main(int argc, char *argv[]) { int rdfd, wrfd, ret_val, count, numread; char buf[MAX_BUF_SIZE]; /* Create the first named - pipe */ ret_val = mkfifo(NP1, 0666); if ((ret_val == -1) && (errno != EEXIST)) { perror("Error creating the named pipe"); exit (1); } ret_val = mkfifo(NP2, 0666); if ((ret_val == -1) && (errno != EEXIST)) { perror("Error creating the named pipe"); exit (1); } /* Open the first named pipe for reading */ rdfd = open(NP1, O_RDONLY); /* Open the second named pipe for writing */ wrfd = open(NP2, O_WRONLY); /* Read from the first pipe */ numread = read(rdfd, buf, MAX_BUF_SIZE); buf[numread] = '0'; fprintf(stderr, "Full Duplex Server : Read From the pipe : %sn", buf); /* Convert to the string to upper case */ count = 0; while (count < numread) { buf[count] = toupper(buf[count]); count++; } /* * Write the converted string back to the second * pipe */ write(wrfd, buf, strlen(buf)); } Edit: Right, just to clarify - it seems I found a document discussing something very similar, it is http://en.wikibooks.org/wiki/Serial_Programming/Serial_Linux#Configuration_with_stty - a modification of the script there ("For example, the following script configures the device and starts a background process for copying all received data from the serial device to standard output...") for the above program is below: # stty raw # ( ./fd_server 2>/dev/null; )& bgPidS=$! ( cat < /tmp/np2 ; )& bgPid=$! # Read commands from user, send them to device echo $(kill -0 $bgPidS 2>/dev/null ; echo $?) while [ "$(kill -0 $bgPidS 2>/dev/null ; echo $?)" -eq "0" ] && read cmd; do # redirect debug msgs to stderr, as here we're redirected to /tmp/np1 echo "$? - $bgPidS - $bgPid" >&2 echo "$cmd" echo -e "\nproc: $(kill -0 $bgPidS 2>/dev/null ; echo $?)" >&2 done >/tmp/np1 echo OUT # Terminate background read process - if they still exist if [ "$(kill -0 $bgPid 2>/dev/null ; echo $?)" -eq "0" ] ; then kill $bgPid fi if [ "$(kill -0 $bgPidS 2>/dev/null ; echo $?)" -eq "0" ] ; then kill $bgPidS fi # stty cooked So, saving the script as say starter.sh and calling it, results with the following session: $ ./starter.sh 0 i'm typing here and pressing [enter] at end 0 - 13496 - 13497 I'M TYPING HERE AND PRESSING [ENTER] AT END 0~?.N=?(?~? ?????}????@??????~? [garble] proc: 0 OUT which is what I'd call for "interactive session" (ignoring the debug statements) - server waits for me to enter a command; it gives its output after it receives a command (and as in this case it exits after first command, so does the starter script as well). Except that, I'd like to not have buffered input, but sent character by character (meaning the above session should exit after first key press, and print out a single letter only - which is what I expected stty raw would help with, but it doesn't: it just kills reaction to both Enter and Ctrl-C :) ) I was just wandering if there already is an existing command (akin to screen in respect to serial devices, I guess) that would accept two such named pipes as arguments, and establish a "terminal" or "shell" like session through them; or would I have to use scripts as above and/or program own 'client' that will behave as a terminal..

    Read the article

  • c windows connect() fails. error 10049

    - by Joshua Moore
    The following two pieces of code compile, but I get a connect() failed error on the client side. (compiled with MinGW). Client Code: // thanks to cs.baylor.edu/~donahoo/practical/CSockets/code/TCPEchoClientWS.c #include <stdio.h> #include <winsock.h> #include <stdlib.h> #define RCVBUFSIZE 32 // size of receive buffer void DieWithError(char *errorMessage); int main(int argc, char* argv[]) { int sock; struct sockaddr_in echoServAddr; unsigned short echoServPort; char *servIP; char *echoString; char echoBuffer[RCVBUFSIZE]; int echoStringLen; int bytesRcvd, totalBytesRcvd; WSAData wsaData; if((argc < 3) || (argc > 4)){ fprintf(stderr, "Usage: %s <Sever IP> <Echo Word> [<Echo Port>]\n", argv[0]); exit(1); } if (argc==4) echoServPort = atoi(argv[3]); // use given port if any else echoServPort = 7; // echo is well-known port for echo service if(WSAStartup(MAKEWORD(2, 0), &wsaData) != 0){ // load winsock 2.0 dll fprintf(stderr, "WSAStartup() failed"); exit(1); } // create reliable, stream socket using tcp if((sock=socket(PF_INET, SOCK_STREAM, IPPROTO_TCP)) < 0) DieWithError("socket() failed"); // construct the server address structure memset(&echoServAddr, 0, sizeof(echoServAddr)); echoServAddr.sin_family = AF_INET; echoServAddr.sin_addr.s_addr = inet_addr(servIP); // server IP address echoServAddr.sin_port = htons(echoServPort); // establish connection to the echo server if(connect(sock, (struct sockaddr*)&echoServAddr, sizeof(echoServAddr)) < 0) DieWithError("connect() failed"); echoStringLen = strlen(echoString); // determine input length // send the string, includeing the null terminator to the server if(send(sock, echoString, echoStringLen, 0)!= echoStringLen) DieWithError("send() sent a different number of bytes than expected"); totalBytesRcvd = 0; printf("Received: "); // setup to print the echoed string while(totalBytesRcvd < echoStringLen){ // receive up to the buffer size (minus 1 to leave space for a null terminator) bytes from the sender if(bytesRcvd = recv(sock, echoBuffer, RCVBUFSIZE-1, 0) <= 0) DieWithError("recv() failed or connection closed prematurely"); totalBytesRcvd += bytesRcvd; // keep tally of total bytes echoBuffer[bytesRcvd] = '\0'; printf("%s", echoBuffer); // print the echo buffer } printf("\n"); closesocket(sock); WSACleanup(); exit(0); } void DieWithError(char *errorMessage) { fprintf(stderr, "%s: %d\n", errorMessage, WSAGetLastError()); exit(1); } Server Code: // thanks cs.baylor.edu/~donahoo/practical/CSockets/code/TCPEchoServerWS.c #include <stdio.h> #include <winsock.h> #include <stdlib.h> #define MAXPENDING 5 // maximum outstanding connection requests #define RCVBUFSIZE 1000 void DieWithError(char *errorMessage); void HandleTCPClient(int clntSocket); // tcp client handling function int main(int argc, char **argv) { int serverSock; int clientSock; struct sockaddr_in echoServerAddr; struct sockaddr_in echoClientAddr; unsigned short echoServerPort; int clientLen; // length of client address data structure WSAData wsaData; if (argc!=2){ fprintf(stderr, "Usage: %s <Server Port>\n", argv[0]); exit(1); } echoServerPort = atoi(argv[1]); if(WSAStartup(MAKEWORD(2, 0), &wsaData)!=0){ fprintf(stderr, "WSAStartup() failed"); exit(1); } // create socket for incoming connections if((serverSock=socket(PF_INET, SOCK_STREAM, IPPROTO_TCP))<0) DieWithError("socket() failed"); // construct local address structure memset(&echoServerAddr, 0, sizeof(echoServerAddr)); echoServerAddr.sin_family = AF_INET; echoServerAddr.sin_addr.s_addr = htonl(INADDR_ANY); // any incoming interface echoServerAddr.sin_port = htons(echoServerPort); // local port // bind to the local address if(bind(serverSock, (struct sockaddr*)&echoServerAddr, sizeof(echoServerAddr) )<0) DieWithError("bind() failed"); // mark the socket so it will listen for incoming connections if(listen(serverSock, MAXPENDING)<0) DieWithError("listen() failed"); for (;;){ // run forever // set the size of the in-out parameter clientLen = sizeof(echoClientAddr); // wait for a client to connect if((clientSock = accept(serverSock, (struct sockaddr*)&echoClientAddr, &clientLen)) < 0) DieWithError("accept() failed"); // clientSock is connected to a client printf("Handling client %s\n", inet_ntoa(echoClientAddr.sin_addr)); HandleTCPClient(clientSock); } // NOT REACHED } void DieWithError(char *errorMessage) { fprintf(stderr, "%s: %d\n", errorMessage, WSAGetLastError()); exit(1); } void HandleTCPClient(int clientSocket) { char echoBuffer[RCVBUFSIZE]; // buffer for echostring int recvMsgSize; // size of received message // receive message from client if((recvMsgSize = recv(clientSocket, echoBuffer, RCVBUFSIZE, 0) <0)) DieWithError("recv() failed"); // send received string and receive again until end of transmission while(recvMsgSize > 0){ // echo message back to client if(send(clientSocket, echoBuffer, recvMsgSize, 0)!=recvMsgSize) DieWithError("send() failed"); // see if there's more data to receive if((recvMsgSize = recv(clientSocket, echoBuffer, RCVBUFSIZE, 0)) <0) DieWithError("recv() failed"); } closesocket(clientSocket); // close client socket } How can I fix this?

    Read the article

  • JScrollPane content to image

    - by Sebastian Ikaros Rizzo
    I'm trying to save the main viewport and headers of a JScrollPane (larger than screen) to PNG image files. I created 3 classes extending JPanel (MainTablePanel, MapsHeaderPanel and ItemsHeaderPanel) and set them to the viewports. Each of them has this method: public BufferedImage createImage() { BufferedImage bi = new BufferedImage(getSize().width, getSize().height, BufferedImage.TYPE_INT_ARGB); Graphics g = bi.createGraphics(); paint(g); g.dispose(); return bi; } Each class has also a paint method, which paints the background and then call the super.paint() to paint some label. For example: public void paint(Graphics g){ g.setColor(Color.BLACK); g.fillRect(0, 0, getWidth(), getHeight()); g.setColor(new Color(255, 255, 0, 50)); // for loop that paints some vertical yellow lines for(int i=0; i<getWidth(); i+=K.mW){ g.fillRect(i-1, 0, 2, getHeight()); if(i%(K.mW*5)==0){ g.fillRect(i-2, 0, 4, getHeight()); } } // called to pain some rotated JLabels super.paint(g); } From an external JFrame I then tried to save them to PNG file, using this code: BufferedImage tableImg = mainTableP.createImage(); BufferedImage topImg = mapsHeaderP.createImage(); BufferedImage leftImg = itemsHeaderP.createImage(); ImageIO.write(tableImg, "png", new File(s.homeDir+"/table.png")); ImageIO.write(topImg, "png", new File(s.homeDir+"/top.png")); ImageIO.write(leftImg, "png", new File(s.homeDir+"/left.png")); This is a screenshot of the application running: screenshot And this is the header exported: top If I comment the "super.paint(g)" instruction, I obtain a correct image (thus without all JLables, clearly). It seems like the second paint (super.paint(g)) is painted shifted into the BufferedImage and taking elements outside its JPanel. Somebody could explain me this behaviour? Thank you. ========== EDIT for SSCCE ==================================== This should compile. You can execute it as it is, and in c:\ you'll find two images (top.png and left.png) that should be the same as the two headers. Unfortunately, they are not. Background is not painted. Moreover (especially if you look at left.png) you can see that the labels are painted twice and shifted (note, for example, "Left test 21"). import java.awt.*; import java.awt.image.BufferedImage; import java.io.File; import javax.imageio.ImageIO; import javax.swing.*; public class Main { public static void main(String[] args) { JFrame frame = new JFrame(); frame.setLayout(null); frame.setSize(800, 600); JScrollPane scrollP = new JScrollPane(); scrollP.setVerticalScrollBarPolicy(JScrollPane.VERTICAL_SCROLLBAR_ALWAYS); scrollP.setHorizontalScrollBarPolicy(JScrollPane.HORIZONTAL_SCROLLBAR_ALWAYS); MyPanel top = new MyPanel(); for(int i=0; i<30; i++){ JLabel label = new JLabel("Test "+i); label.setOpaque(false); label.setBounds(50*i, 40, 50, 20); label.setForeground(Color.GREEN); top.add(label); } top.setLayout(null); top.setOpaque(false); top.setPreferredSize(new Dimension(50*30, 200)); top.validate(); MyPanel left = new MyPanel(); for(int i=0; i<30; i++){ JLabel label = new JLabel("Left test "+i); label.setBounds(0, 50*i, 100, 20); label.setForeground(Color.RED); left.add(label); } left.setLayout(null); left.setOpaque(false); left.setPreferredSize(new Dimension(200, 50*30)); MyPanel center = new MyPanel(); center.setLayout(null); center.setOpaque(false); center.setPreferredSize(new Dimension(50*30, 50*30)); scrollP.setViewportView(center); scrollP.setColumnHeaderView(top); scrollP.setRowHeaderView(left); scrollP.setBounds(0, 50, 750, 500); frame.add(scrollP); frame.setDefaultCloseOperation(javax.swing.WindowConstants.EXIT_ON_CLOSE); frame.setVisible(true); try{ BufferedImage topImg = top.createImage(); ImageIO.write(topImg, "png", new File("C:/top.png")); BufferedImage leftImg = left.createImage(); ImageIO.write(leftImg, "png", new File("C:/left.png")); }catch(Exception e){ e.printStackTrace(); } } } class MyPanel extends JPanel{ public void paint(Graphics g){ g.setColor(Color.BLACK); g.fillRect(0, 0, getWidth(), getHeight()); g.setColor(new Color(255, 255, 0, 50)); for(int i=0; i<getWidth(); i+=50){ g.fillRect(i-1, 0, 2, getHeight()); } super.paint(g); // COMMENT this line to obtain background images } public BufferedImage createImage() { BufferedImage bi = new BufferedImage(getSize().width, getSize().height, BufferedImage.TYPE_INT_ARGB); Graphics g = bi.createGraphics(); paint(g); g.dispose(); return bi; } }

    Read the article

  • Java: Switch statements with methods involving arrays

    - by Shane
    Hi guys I'm currently creating a program that allows the user to create an array, search an array and delete an element from an array. Looking at the LibraryMenu Method, the first case where you create an array in the switch statement works fine, however the other ones create a "cannot find symbol error" when I try to compile. My question is I want the search and delete functions to refer to the first switch case - the create Library array. Any help is appreciated, even if its likely from a simple mistake. import java.util.*; public class EnterLibrary { public static void LibraryMenu() { java.util.Scanner scannerObject =new java.util.Scanner(System.in); LibraryMenu Menu = new LibraryMenu(); Menu.displayMenu(); switch (scannerObject.nextInt() ) { case '1': { System.out.println ("1 - Add Videos"); Library[] newLibrary; newLibrary = createLibrary(); } break; case '2': System.out.println ("2 - Search Videos"); searchLibrary(newLibrary); break; case '3': { System.out.println ("3 - Change Videos"); //Change video method TBA } break; case '4': System.out.println ("4 - Delete Videos"); deleteVideo(newLibrary); break; default: System.out.println ("Unrecognized option - please select options 1-3 "); break; } } public static Library[] createLibrary() { Library[] videos = new Library[4]; java.util.Scanner scannerObject =new java.util.Scanner(System.in); for (int i = 0; i < videos.length; i++) { //User enters values into set methods in Library class System.out.print("Enter video number: " + (i+1) + "\n"); String number = scannerObject.nextLine(); System.out.print("Enter video title: " + (i+1) + "\n"); String title = scannerObject.nextLine(); System.out.print("Enter video publisher: " + (i+1) + "\n"); String publisher = scannerObject.nextLine(); System.out.print("Enter video duration: " + (i+1) + "\n"); String duration = scannerObject.nextLine(); System.out.print("Enter video date: " + (i+1) + "\n"); String date= scannerObject.nextLine(); System.out.print("VIDEO " + (i+1) + " ENTRY ADDED " + "\n \n"); //Initialize arrays videos[i] = new Library (); videos[i].setVideo( number, title, publisher, duration, date ); } return videos; } public static void printVidLibrary( Library[] videos) { //Get methods to print results System.out.print("\n======VIDEO CATALOGUE====== \n"); for (int i = 0; i < videos.length; i++) { System.out.print("Video number " + (i+1) + ": \n" + videos[i].getNumber() + "\n "); System.out.print("Video title " + (i+1) + ": \n" + videos[i].getTitle() + "\n "); System.out.print("Video publisher " + (i+1) + ": \n" + videos[i].getPublisher() + "\n "); System.out.print("Video duration " + (i+1) + ": \n" + videos[i].getDuration() + "\n "); System.out.print("Video date " + (i+1) + ": \n" + videos[i].getDate() + "\n "); } } public static Library searchLibrary( Library[] videos) { //User enters values to setSearch Library titleResult = new Library(); java.util.Scanner scannerObject =new java.util.Scanner(System.in); for (int n = 0; n < videos.length; n++) { System.out.println("Search for video number:\n"); String newSearch = scannerObject.nextLine(); titleResult.getSearch( videos, newSearch); if (!titleResult.equals(-1)) { System.out.print("Match found!\n" + newSearch + "\n"); } else if (titleResult.equals(-1)) { System.out.print("Sorry, no matches found!\n"); } } return titleResult; } public static void deleteVideo( Library[] videos) { Library titleResult = new Library(); java.util.Scanner scannerObject =new java.util.Scanner(System.in); for (int n = 0; n < videos.length; n++) { System.out.println("Search for video number:\n"); String deleteSearch = scannerObject.nextLine(); titleResult.deleteVideo(videos, deleteSearch); System.out.print("Video deleted\n"); } } public static void main(String[] args) { Library[] newLibrary; new LibraryMenu(); } }

    Read the article

  • Java programming accessing object variables

    - by Haxed
    Helo, there are 3 files, CustomerClient.java, CustomerServer.java and Customer.java PROBLEM: In the CustomerServer.java file, i get an error when I compile the CustomerServer.java at line : System.out.println(a[k].getName()); ERROR: init: deps-jar: Compiling 1 source file to C:\Documents and Settings\TLNA\My Documents\NetBeansProjects\Server\build\classes C:\Documents and Settings\TLNA\My Documents\NetBeansProjects\Server\src\CustomerServer.java:44: cannot find symbol symbol : method getName() location: class Customer System.out.println(a[k].getName()); 1 error BUILD FAILED (total time: 0 seconds) CustomerClient.java import java.io.*; import java.net.*; import java.awt.*; import java.awt.event.*; import javax.swing.*; import javax.swing.border.*; public class CustomerClient extends JApplet { private JTextField jtfName = new JTextField(32); private JTextField jtfSeatNo = new JTextField(32); // Button for sending a student to the server private JButton jbtRegister = new JButton("Register to the Server"); // Indicate if it runs as application private boolean isStandAlone = false; // Host name or ip String host = "localhost"; public void init() { JPanel p1 = new JPanel(); p1.setLayout(new GridLayout(2, 1)); p1.add(new JLabel("Name")); p1.add(jtfName); p1.add(new JLabel("Seat No.")); p1.add(jtfSeatNo); add(p1, BorderLayout.CENTER); add(jbtRegister, BorderLayout.SOUTH); // Register listener jbtRegister.addActionListener(new ButtonListener()); // Find the IP address of the Web server if (!isStandAlone) { host = getCodeBase().getHost(); } } /** Handle button action */ private class ButtonListener implements ActionListener { public void actionPerformed(ActionEvent e) { try { // Establish connection with the server Socket socket = new Socket(host, 8000); // Create an output stream to the server ObjectOutputStream toServer = new ObjectOutputStream(socket.getOutputStream()); // Get text field String name = jtfName.getText().trim(); String seatNo = jtfSeatNo.getText().trim(); // Create a Student object and send to the server Customer s = new Customer(name, seatNo); toServer.writeObject(s); } catch (IOException ex) { System.err.println(ex); } } } /** Run the applet as an application */ public static void main(String[] args) { // Create a frame JFrame frame = new JFrame("Register Student Client"); // Create an instance of the applet CustomerClient applet = new CustomerClient(); applet.isStandAlone = true; // Get host if (args.length == 1) { applet.host = args[0]; // Add the applet instance to the frame } frame.add(applet, BorderLayout.CENTER); // Invoke init() and start() applet.init(); applet.start(); // Display the frame frame.pack(); frame.setVisible(true); } } CustomerServer.java import java.io.*; import java.net.*; public class CustomerServer { private String name; private int i; private ObjectOutputStream outputToFile; private ObjectInputStream inputFromClient; public static void main(String[] args) { new CustomerServer(); } public CustomerServer() { Customer[] a = new Customer[30]; try { // Create a server socket ServerSocket serverSocket = new ServerSocket(8000); System.out.println("Server started "); // Create an object ouput stream outputToFile = new ObjectOutputStream( new FileOutputStream("student.dat", true)); while (true) { // Listen for a new connection request Socket socket = serverSocket.accept(); // Create an input stream from the socket inputFromClient = new ObjectInputStream(socket.getInputStream()); // Read from input //Object object = inputFromClient.readObject(); for (int k = 0; k <= 2; k++) { if (a[k] == null) { a[k] = (Customer) inputFromClient.readObject(); // Write to the file outputToFile.writeObject(a[k]); //System.out.println("A new student object is stored"); System.out.println(a[k].getName()); break; } if (k == 2) { //fully booked outputToFile.writeObject("All seats are booked"); break; } } } } catch (ClassNotFoundException ex) { ex.printStackTrace(); } catch (IOException ex) { ex.printStackTrace(); } finally { try { inputFromClient.close(); outputToFile.close(); } catch (Exception ex) { ex.printStackTrace(); } } } } Customer.java public class Customer implements java.io.Serializable { private String name; private String seatno; public Customer(String name, String seatno) { this.name = name; this.seatno = seatno; } public String getName() { return name; } public String getSeatNo() { return seatno; } }

    Read the article

  • System.ServiceModel.Channels.MessageHeader Error

    - by user220511
    I'm trying to get the following to work on my machine but I get an error (Cannot create an instance of the abstract class or interface 'System.ServiceModel.Channels.MessageHeader') using System; using System.IO; using System.Reflection; namespace com.mycompanyname.business { /// /// Summary description for SessionCreateRQClient. /// class SessionCreateRQClient { /// /// The main entry point. /// [STAThread] static void Main(string[] args) { try { // Set user information, including security credentials and the IPCC. string username = "user"; string password = "password"; string ipcc = "IPCC"; string domain = "DEFAULT"; string temp = Environment.GetEnvironmentVariable("tmp"); // Get temp directory string PropsFileName = temp + "/session.properties"; // Define dir and file name DateTime dt = DateTime.UtcNow; string tstamp = dt.ToString("s") + "Z"; //Create the message header and provide the conversation ID. MessageHeader msgHeader = new MessageHeader(); msgHeader.ConversationId = "TestSession"; // Set the ConversationId From from = new From(); PartyId fromPartyId = new PartyId(); PartyId[] fromPartyIdArr = new PartyId[1]; fromPartyId.Value = "WebServiceClient"; fromPartyIdArr[0] = fromPartyId; from.PartyId = fromPartyIdArr; msgHeader.From = from; To to = new To(); PartyId toPartyId = new PartyId(); PartyId[] toPartyIdArr = new PartyId[1]; toPartyId.Value = "WebServiceSupplier"; toPartyIdArr[0] = toPartyId; to.PartyId = toPartyIdArr; msgHeader.To = to; //Add the value for eb:CPAId, which is the IPCC. //Add the value for the action code of this Web service, SessionCreateRQ. msgHeader.CPAId = ipcc; msgHeader.Action = "SessionCreateRQ"; Service service = new Service(); service.Value = "SessionCreate"; msgHeader.Service = service; MessageData msgData = new MessageData(); msgData.MessageId = "mid:[email protected]"; msgData.Timestamp = tstamp; msgHeader.MessageData = msgData; Security security = new Security(); SecurityUsernameToken securityUserToken = new SecurityUsernameToken(); securityUserToken.Username = username; securityUserToken.Password = password; securityUserToken.Organization = ipcc; securityUserToken.Domain = domain; security.UsernameToken = securityUserToken; SessionCreateRQ req = new SessionCreateRQ(); SessionCreateRQPOS pos = new SessionCreateRQPOS(); SessionCreateRQPOSSource source = new SessionCreateRQPOSSource(); source.PseudoCityCode = ipcc; pos.Source = source; req.POS = pos; SessionCreateRQService serviceObj = new SessionCreateRQService(); serviceObj.MessageHeaderValue = msgHeader; serviceObj.SecurityValue = security; SessionCreateRS resp = serviceObj.SessionCreateRQ(req); // Send the request if (resp.Errors != null && resp.Errors.Error != null) { Console.WriteLine("Error : " + resp.Errors.Error.ErrorInfo.Message); } else { msgHeader = serviceObj.MessageHeaderValue; security = serviceObj.SecurityValue; Console.WriteLine("**********************************************"); Console.WriteLine("Response of SessionCreateRQ service"); Console.WriteLine("BinarySecurityToken returned : " + security.BinarySecurityToken); Console.WriteLine("**********************************************"); string ConvIdLine = "convid="+msgHeader.ConversationId; // ConversationId to a string string TokenLine = "securitytoken="+security.BinarySecurityToken; // BinarySecurityToken to a string string ipccLine = "ipcc="+ipcc; // IPCC to a string File.Delete(PropsFileName); // Clean up TextWriter tw = new StreamWriter(PropsFileName); // Create & open the file tw.WriteLine(DateTime.Now); // Write the date for reference tw.WriteLine(TokenLine); // Write the BinarySecurityToken tw.WriteLine(ConvIdLine); // Write the ConversationId tw.WriteLine(ipccLine); // Write the IPCC tw.Close(); //Console.Read(); } } catch(Exception e) { Console.WriteLine("Exception Message : " + e.Message ); Console.WriteLine("Exception Stack Trace : " + e.StackTrace); Console.Read(); } } } } I have added the reference System.ServiceModel and the lines: using System.ServiceModel; using System.ServiceModel.Channels; but I continue to get that error when trying to compile -- "Cannot create an instance of the abstract class or interface 'System.ServiceModel.Channels.MessageHeader'" I am using Microsoft Visual Studio 2008 Version 9.0.21022.8 RTM Microsoft .NET Framework Version 3.5 SP1 Professional Edition Is there another reference I have to add? Or a dll to move over? I wonder was the code above written for Framework 2.0 only? Thanks for your help.

    Read the article

  • Elegant way for a recursive C++ template to do something different with the leaf class?

    - by Costas
    I have a C++ class template that makes an Array of pointers. This also gets typedefed to make Arrays of Arrays and so on: typedef Array<Elem> ElemArray; typedef Array<ElemArray> ElemArrayArray; typedef Array<ElemArrayArray> ElemArrayArrayArray; I would like to be able to set one leaf node from another by copying the pointer so they both refer to the same Elem. But I also want to be able to set one Array (or Array of Arrays etc) from another. In this case I don't want to copy the pointers, I want to keep the arrays seperate and descend into each one until I get to the leaf node, at where I finally copy the pointers. I have code that does this (below). When you set something in an Array it calls a CopyIn method to do the copying. But because this is templated it also has to call the CopyIn method on the leaf class, which means I have to add a dummy method to every leaf class that just returns false. I have also tried adding a flag to the template to tell it whether it contains Arrays or not, and so whether to call the CopyIn method. This works fine - the CopyIn method of the leaf nodes never gets called, but it still has to be there for the compile to work! Is there a better way to do this? #include <stdio.h> class Elem { public: Elem(int v) : mI(v) {} void Print() { printf("%d\n",mI); } bool CopyIn(Elem *v) { return false; } int mI; }; template < typename T > class Array { public: Array(int size) : mB(0), mN(size) { mB = new T* [size]; for (int i=0; i<mN; i++) mB[i] = new T(mN); } ~Array() { for (int i=0; i<mN; i++) delete mB[i]; delete [] mB; } T* Get(int i) { return mB[i]; } void Set(int i, T* v) { if (! mB[i]->CopyIn(v) ) { // its not an array, so copy the pointer mB[i] = v; } } bool CopyIn(Array<T>* v) { for (int i=0; i<mN; i++) { if (v && i < v->mN ) { if ( ! mB[i]->CopyIn( v->mB[i] )) { // its not an array, so copy the pointer mB[i] = v->mB[i]; } } else { mB[i] = 0; } } return true; // we did the copy, no need to copy pointer } void Print() { for (int i=0; i<mN; i++) { printf("[%d] ",i); mB[i]->Print(); } } private: T **mB; int mN; }; typedef Array<Elem> ElemArray; typedef Array<ElemArray> ElemArrayArray; typedef Array<ElemArrayArray> ElemArrayArrayArray; int main () { ElemArrayArrayArray* a = new ElemArrayArrayArray(2); ElemArrayArrayArray* b = new ElemArrayArrayArray(3); // In this case I need to copy the pointer to the Elem into the ElemArrayArray a->Get(0)->Get(0)->Set(0, b->Get(0)->Get(0)->Get(0)); // in this case I need go down through a and b until I get the to Elems // so I can copy the pointers a->Set(1,b->Get(2)); b->Get(0)->Get(0)->Get(0)->mI = 42; // this will also set a[0,0,0] b->Get(2)->Get(1)->Get(1)->mI = 96; // this will also set a[1,1,1] // should be 42,2, 2,2, 3,3, 3,96 a->Print(); }

    Read the article

  • How do I get a JComponent to resize after calling `setVisible(true)`?

    - by iWerner
    Our application displays a 2D view of our data (mainly maps) and then allows the user to change to a 3D view. The 2D and 3D views are generated by custom C++ code that is SWIG'ed into our Swing GUI and wrapped within a JComponent. These JComponents are then displayed within another parent JComponent. Our problem is that when we change from the 2D to the 3D view and then back to the 2D view, when we resize the window the 2D view does not get resized. The resize events don't get sent to the 2D view. Our application runs under Linux (Fedora 11). We're running Java version 1.6.0_12. Here is some sample code in which I've replaced the 2D view and 3D view with two 2 JButtons, that produces the same behaviour. Once you go to 3D and then back to 2D, resizing the window does not cause the 2D view to be resized. /* TestFrame.java * Compile with: $ javac TestFrame.java * Run with: $ java TestFrame */ import java.awt.BorderLayout; import java.awt.Container; import java.awt.event.ComponentEvent; import java.awt.event.ComponentListener; import javax.swing.JButton; public class TestFrame extends javax.swing.JFrame { private boolean mode2D = true; private JButton view2D = null; private JButton view3D = null; private Container parent = null; public TestFrame() { initComponents(); containerPanel.setLayout(new BorderLayout()); view2D = new JButton("2D View"); view2D.addComponentListener(new MyListener("2D VIEW")); containerPanel.add(view2D); } private void changerButtonActionPerformed(java.awt.event.ActionEvent evt) { if (parent == null) { parent = view2D.getParent(); } if (mode2D) { System.out.println("Going from 2D to 3D"); view2D.setVisible(false); if (view3D != null) { view3D.setVisible(true); } else { view3D = new JButton("3D View"); view3D.addComponentListener(new MyListener("3D VIEW")); parent.add(view3D); } ((JButton) evt.getSource()).setText("Change to 2D"); mode2D = false; } else { System.out.println("Going from 3D to 2D"); view3D.setVisible(false); view2D.setVisible(true); ((JButton) evt.getSource()).setText("Change to 3D"); mode2D = true; } } public static void main(String args[]) { java.awt.EventQueue.invokeLater(new Runnable() { public void run() { new TestFrame().setVisible(true); } }); } private javax.swing.JPanel containerPanel; private javax.swing.JButton changerButton; private class MyListener implements ComponentListener { private String name; public MyListener(String name) { this.name = name; } @Override public void componentHidden(ComponentEvent event) { System.out.println("@@@ [" + name + "] component Hidden"); } @Override public void componentResized(ComponentEvent event) { System.out.println("@@@ [" + name + "] component Resized"); } @Override public void componentShown(ComponentEvent event) { System.out.println("@@@ [" + name + "] component Shown"); } @Override public void componentMoved(ComponentEvent event) { System.out.println("@@@ [" + name + "] component Moved"); } }; @SuppressWarnings("unchecked") private void initComponents() { containerPanel = new javax.swing.JPanel(); changerButton = new javax.swing.JButton(); setDefaultCloseOperation(javax.swing.WindowConstants.EXIT_ON_CLOSE); containerPanel.setBorder(new javax.swing.border.MatteBorder(null)); javax.swing.GroupLayout containerPanelLayout = new javax.swing.GroupLayout(containerPanel); containerPanel.setLayout(containerPanelLayout); containerPanelLayout.setHorizontalGroup( containerPanelLayout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 374, Short.MAX_VALUE) ); containerPanelLayout.setVerticalGroup( containerPanelLayout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 239, Short.MAX_VALUE) ); changerButton.setText("Change to 3D"); changerButton.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { changerButtonActionPerformed(evt); } }); javax.swing.GroupLayout layout = new javax.swing.GroupLayout(getContentPane()); getContentPane().setLayout(layout); layout.setHorizontalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addContainerGap() .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addComponent(containerPanel, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, Short.MAX_VALUE) .addComponent(changerButton)) .addContainerGap()) ); layout.setVerticalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addContainerGap() .addComponent(containerPanel, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, Short.MAX_VALUE) .addPreferredGap(javax.swing.LayoutStyle.ComponentPlacement.RELATED) .addComponent(changerButton) .addContainerGap()) ); pack(); } } (My apologies for the Netbeans generated GUI code) I should mention that when we call parent.remove(view2D) and parent.add(view3D) to change the views the X Windows ID of our 3D view changes and we're unable to get our 3D view back. Therefore parent.remove(view2D) and parent.add(view3D) is not really a solution and we have to call setVisible(false) and setVisible(true) on the JComponents that contain our 2D and 3D views in order to hide and show them. Any help will be greatly appreciated.

    Read the article

< Previous Page | 246 247 248 249 250 251 252 253  | Next Page >