Search Results

Search found 40650 results on 1626 pages for 'multiple select'.

Page 252/1626 | < Previous Page | 248 249 250 251 252 253 254 255 256 257 258 259  | Next Page >

  • Multiple Forms with Different Actions using Submit Buttons

    - by Adam Coulson
    I have Two forms in my index.php and am trying to get them to submit and POST their data seperatly Form 1 echo '<form action="process.php?type=news" method="post">'; echo '<table cellspacing="0"><tr><th>'; echo 'Add News to News Feed'; echo '</th></tr><tr><td>'; echo 'Title:<br /><input name="newstitle" type="text" id="add" style="height:16px;width:525px;" size="80" maxlength="186" /><br />'; echo 'Main Body Text:<br /><textarea name="newsfeed" id="add" style="width:525px;height:78px;" maxlength="2000" ></textarea>'; echo '<input style="float:right;margin-top:5px;" id="button" type="submit" value="Submit" />'; echo '</td></tr></table></from>'; And Form 2 echo '<form action="process.php?type=suggest" method="post">'; echo '<table cellspacing="0"><tr><th>'; echo 'Suggest Additions to the Intranet'; echo '</th></tr><tr><td>'; echo '<textarea name="suggest" id="add" style="width:330px;height:60px;" maxlength="800" ></textarea>'; echo '<input style="float:right;margin-top:5px;" id="button" type="submit" value="Submit" />'; echo '</td></tr></table></from>'; I want these both to post and do the action after pressing the submit button, but currently the second form submit to the first forms action How can i fix this??? EDIT: Also i am using .PHP for both the index and process page then using it to echo the forms onto the page Also here is the process.php data $type=$_REQUEST['type']; $suggest=$_POST['suggest']; $newstitle=$_POST['newstitle']; $news=mysql_real_escape_string($_POST['newsfeed']); if ($type == "news") { $sql=mysql_query("SELECT * FROM newsfeed WHERE title = ('$newstitle')"); $number_of_rows = mysql_num_rows($sql); if ($number_of_rows > 0) { echo 'This Title is Already Taken'; } else { $sql="INSERT INTO newsfeed (title, news) VALUES ('$newstitle','$news')"; if (!mysql_query($sql,$con)) { die('Error: ' . mysql_error()); } header('Location: index.php'); exit; } } elseif ($type == "suggest") { $sql="INSERT INTO suggestions VALUES ('$suggest')"; if (!mysql_query($sql,$con)) { die('Error: ' . mysql_error()); } header('Location: index.php'); exit; }

    Read the article

  • Can <Setter.Value> have multiple grids inside it

    - by Subhen
    Hi, I want to define the background for my application in App.XAML. The background was previously defined in another xaml page,which have multiple Grids inside it like following: <Grid x:Key="GridGeneric" d:LayoutOverrides="Width, Height"> <Grid.Background> <LinearGradientBrush EndPoint="0.5,1" StartPoint="0.5,0"> <GradientStop Color="#FF00172E" Offset="1"/> <GradientStop Color="#FF004074" Offset="0.433"/> <GradientStop Color="#FF081316"/> <GradientStop Color="#FF001D3F" Offset="0.215"/> <GradientStop Color="#FF002043" Offset="0.818"/> <GradientStop Color="#FF003B6C" Offset="0.642"/> </LinearGradientBrush> </Grid.Background> <Grid> <Grid.Background> <RadialGradientBrush RadiusY="0.973" GradientOrigin="0.497,-0.276" RadiusX="1.003"> <GradientStop Color="#FFB350EE" Offset="0"/> <GradientStop Color="#001D3037" Offset="0.847"/> </RadialGradientBrush> </Grid.Background> </Grid> ------ ----- </Grid> Now I want to place the same in my App.xaml like following: <Style x:Key="backgroundStyle" TargetType="Grid"> <Setter Property="Background"> <Setter.Value> <Grid> <Grid.Background> <LinearGradientBrush EndPoint="0.5,1" StartPoint="0.5,0"> <GradientStop Color="#FF00172E" Offset="1"/> <GradientStop Color="#FF004074" Offset="0.433"/> <GradientStop Color="#FF081316"/> <GradientStop Color="#FF001D3F" Offset="0.215"/> <GradientStop Color="#FF002043" Offset="0.818"/> <GradientStop Color="#FF003B6C" Offset="0.642"/> </LinearGradientBrush> </Grid.Background> <Grid> <Grid.Background> <RadialGradientBrush RadiusY="0.973" GradientOrigin="0.497,-0.276" RadiusX="1.003"> <GradientStop Color="#FFB350EE" Offset="0"/> <GradientStop Color="#001D3037" Offset="0.847"/> </RadialGradientBrush> </Grid.Background> </Grid> --------- --------- </Grid> </Setter.Value> </Setter> </Style> But While doing this I am getting the following Exception.

    Read the article

  • What is the most efficient way to study multiple languages, frameworks, and APIs as a developer?

    - by Akromyk
    I know there are those out there who have read a slurry of books on a specific technology and only code in that one particular language, but this question is aimed at those who need bounce around between using multiple technologies and yet still manage to be productive. What is the most efficient way to study multiple languages, frameworks, and APIs as a developer without becoming a cheap swiss army knife? And how much time should one dedicate to a particular subject before moving to another?

    Read the article

  • How to configure multiple WCF binding configurations for the same scheme

    - by Sandor Drieënhuizen
    I have a set of IIS7-hosted net.tcp WCF services that serve my ASP.NET MVC web application. The web application is accessed over the internet. WCF Services (IIS7) <--> ASP.NET MVC Application <--> Client Browser The services are username authenticated, the account that a client (of my web application) uses to logon ends up as the current principal on the host. I want one of the services to be authenticated differently, because it serves the view model for my logon view. When it's called, the client is obviously not logged on yet. I figure Windows authentication serves best or perhaps just certificate based security (which in fact I should use for the authenticated services as well) if the services are hosted on a machine that is not in the same domain as the web application. That's not the point here though. Using multiple TCP bindings is what's giving me trouble. I tried setting it up like this in my client configuration: <bindings> <netTcpBinding> <binding> <security mode="TransportWithMessageCredential"> <message clientCredentialType="UserName"/> </security> </binding> <binding name="public"> <security mode="Transport"> <message clientCredentialType="Windows"/> </security> </binding> </netTcpBinding> </bindings> <client> <endpoint contract="Server.IService1" binding="netTcpBinding" address="net.tcp://localhost:8081/Service1.svc"/> <endpoint contract="Server.IService2" binding="netTcpBinding" address="net.tcp://localhost:8081/Service2.svc"/> </client> The server configuration is this: <bindings> <netTcpBinding> <binding portSharingEnabled="true"> <security mode="TransportWithMessageCredential"> <message clientCredentialType="UserName"/> </security> </binding> <binding name="public"> <security mode="Transport"> <message clientCredentialType="Windows"/> </security> </binding> </netTcpBinding> </bindings> <services> <service name="Service1"> <endpoint contract="Server.IService1, Library" binding="netTcpBinding" address=""/> </service> <service name="Service2"> <endpoint contract="Server.IService2, Library" binding="netTcpBinding" address=""/> </service> </services> <serviceHostingEnvironment> <serviceActivations> <add relativeAddress="Service1.svc" service="Server.Service1"/> <add relativeAddress="Service2.svc" service="Server.Service2"/> </serviceActivations> </serviceHostingEnvironment> The thing is that both bindings don't seem to want live together in my host. When I remove either of them, all's fine but together they produce the following exception on the client: The requested upgrade is not supported by 'net.tcp://localhost:8081/Service2.svc'. This could be due to mismatched bindings (for example security enabled on the client and not on the server). In the server trace log, I find the following exception: Protocol Type application/negotiate was sent to a service that does not support that type of upgrade. Am I looking into the right direction or is there a better way to solve this?

    Read the article

  • Configuring multiple WCF binding configurations for the same scheme doesn't work

    - by Sandor Drieënhuizen
    I have a set of IIS7-hosted net.tcp WCF services that serve my ASP.NET MVC web application. The web application is accessed over the internet. WCF Services (IIS7) <--> ASP.NET MVC Application <--> Client Browser The services are username authenticated, the account that a client (of my web application) uses to logon ends up as the current principal on the host. I want one of the services to be authenticated differently, because it serves the view model for my logon view. When it's called, the client is obviously not logged on yet. I figure Windows authentication serves best or perhaps just certificate based security (which in fact I should use for the authenticated services as well) if the services are hosted on a machine that is not in the same domain as the web application. That's not the point here though. Using multiple TCP bindings is what's giving me trouble. I tried setting it up like this in my client configuration: <bindings> <netTcpBinding> <binding> <security mode="TransportWithMessageCredential"> <message clientCredentialType="UserName"/> </security> </binding> <binding name="public"> <security mode="Transport"> <message clientCredentialType="Windows"/> </security> </binding> </netTcpBinding> </bindings> <client> <endpoint contract="Server.IService1" binding="netTcpBinding" address="net.tcp://localhost:8081/Service1.svc"/> <endpoint contract="Server.IService2" binding="netTcpBinding" bindingConfiguration="public" address="net.tcp://localhost:8081/Service2.svc"/> </client> The server configuration is this: <bindings> <netTcpBinding> <binding portSharingEnabled="true"> <security mode="TransportWithMessageCredential"> <message clientCredentialType="UserName"/> </security> </binding> <binding name="public"> <security mode="Transport"> <message clientCredentialType="Windows"/> </security> </binding> </netTcpBinding> </bindings> <services> <service name="Service1"> <endpoint contract="Server.IService1, Library" binding="netTcpBinding" address=""/> </service> <service name="Service2"> <endpoint contract="Server.IService2, Library" binding="netTcpBinding" bindingConfiguration="public" address=""/> </service> </services> <serviceHostingEnvironment> <serviceActivations> <add relativeAddress="Service1.svc" service="Server.Service1"/> <add relativeAddress="Service2.svc" service="Server.Service2"/> </serviceActivations> </serviceHostingEnvironment> The thing is that both bindings don't seem to want live together in my host. When I remove either of them, all's fine but together they produce the following exception on the client: The requested upgrade is not supported by 'net.tcp://localhost:8081/Service2.svc'. This could be due to mismatched bindings (for example security enabled on the client and not on the server). In the server trace log, I find the following exception: Protocol Type application/negotiate was sent to a service that does not support that type of upgrade. Am I looking into the right direction or is there a better way to solve this?

    Read the article

  • How to configurie multiple distinct WCF binding configurations for the same scheme

    - by Sandor Drieënhuizen
    I have a set of IIS7-hosted net.tcp WCF services that serve my ASP.NET MVC web application. The web application is accessed over the internet. WCF Services (IIS7) <--> ASP.NET MVC Application <--> Client Browser The services are username authenticated, the account that a client (of my web application) uses to logon ends up as the current principal on the host. I want one of the services to be authenticated differently, because it serves the view model for my logon view. When it's called, the client is obviously not logged on yet. I figure Windows authentication serves best or perhaps just certificate based security (which in fact I should use for the authenticated services as well) if the services are hosted on a machine that is not in the same domain as the web application. That's not the point here though. Using multiple TCP bindings is what's giving me trouble. I tried setting it up like this in my client configuration: <bindings> <netTcpBinding> <binding> <security mode="TransportWithMessageCredential"> <message clientCredentialType="UserName"/> </security> </binding> <binding name="public"> <security mode="Transport"> <message clientCredentialType="Windows"/> </security> </binding> </netTcpBinding> </bindings> <client> <endpoint contract="Server.IService1" binding="netTcpBinding" address="net.tcp://localhost:8081/Service1.svc"/> <endpoint contract="Server.IService2" binding="netTcpBinding" address="net.tcp://localhost:8081/Service2.svc"/> </client> The server configuration is this: <bindings> <netTcpBinding> <binding portSharingEnabled="true"> <security mode="TransportWithMessageCredential"> <message clientCredentialType="UserName"/> </security> </binding> <binding name="public"> <security mode="Transport"> <message clientCredentialType="Windows"/> </security> </binding> </netTcpBinding> </bindings> <services> <service name="Service1"> <endpoint contract="Server.IService1, Library" binding="netTcpBinding" address=""/> </service> <service name="Service2"> <endpoint contract="Server.IService2, Library" binding="netTcpBinding" address=""/> </service> </services> <serviceHostingEnvironment> <serviceActivations> <add relativeAddress="Service1.svc" service="Server.Service1"/> <add relativeAddress="Service2.svc" service="Server.Service2"/> </serviceActivations> </serviceHostingEnvironment> The thing is that both bindings don't seem to want live together in my host. When I remove either of them, all's fine but together they produce the following exception on the client: The requested upgrade is not supported by 'net.tcp://localhost:8081/Service2.svc'. This could be due to mismatched bindings (for example security enabled on the client and not on the server). In the server trace log, I find the following exception: Protocol Type application/negotiate was sent to a service that does not support that type of upgrade. Am I looking into the right direction or is there a better way to solve this?

    Read the article

  • Linker errors between multiple projects in Visual C++

    - by rlbond
    Hi, I have a solution with multiple projects. I have a "main" project, which acts as a menu and from there, the user can access any of the other projects. On this main project, I get linker errors for every function called. How do I avoid these linker errors? I set the project dependencies already in the "Project Dependencies..." dialog. Thanks EDIT -- I did as suggested and added the output folder to the linker's additional directories. Now, however, I get a million errors as follows: 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: void __thiscall std::basic_ios ::setstate(int,bool)" (?setstate@?$basic_ios@DU?$char_traits@D@std@@@std@@QAEXH_N@Z) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: int __thiscall std::ios_base::width(int)" (?width@ios_base@std@@QAEHH@Z) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: int __thiscall std::basic_streambuf ::sputn(char const *,int)" (?sputn@?$basic_streambuf@DU?$char_traits@D@std@@@std@@QAEHPBDH@Z) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: static bool __cdecl std::char_traits::eq_int_type(int const &,int const &)" (?eq_int_type@?$char_traits@D@std@@SA_NABH0@Z) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: static int __cdecl std::char_traits::eof(void)" (?eof@?$char_traits@D@std@@SAHXZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: int __thiscall std::basic_streambuf ::sputc(char)" (?sputc@?$basic_streambuf@DU?$char_traits@D@std@@@std@@QAEHD@Z) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: class std::basic_streambuf * __thiscall std::basic_ios ::rdbuf(void)const " (?rdbuf@?$basic_ios@DU?$char_traits@D@std@@@std@@QBEPAV?$basic_streambuf@DU?$char_traits@D@std@@@2@XZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: char __thiscall std::basic_ios ::fill(void)const " (?fill@?$basic_ios@DU?$char_traits@D@std@@@std@@QBEDXZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: int __thiscall std::ios_base::flags(void)const " (?flags@ios_base@std@@QBEHXZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: int __thiscall std::ios_base::width(void)const " (?width@ios_base@std@@QBEHXZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: static unsigned int __cdecl std::char_traits::length(char const *)" (?length@?$char_traits@D@std@@SAIPBD@Z) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: class std::basic_ostream & __thiscall std::basic_ostream ::flush(void)" (?flush@?$basic_ostream@DU?$char_traits@D@std@@@std@@QAEAAV12@XZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: class std::basic_ostream * __thiscall std::basic_ios ::tie(void)const " (?tie@?$basic_ios@DU?$char_traits@D@std@@@std@@QBEPAV?$basic_ostream@DU?$char_traits@D@std@@@2@XZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: bool __thiscall std::ios_base::good(void)const " (?good@ios_base@std@@QBE_NXZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: void __thiscall std::basic_ostream ::_Osfx(void)" (?_Osfx@?$basic_ostream@DU?$char_traits@D@std@@@std@@QAEXXZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: void __thiscall std::basic_streambuf ::_Lock(void)" (?_Lock@?$basic_streambuf@DU?$char_traits@D@std@@@std@@QAEXXZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: void __thiscall std::basic_streambuf ::_Unlock(void)" (?_Unlock@?$basic_streambuf@DU?$char_traits@D@std@@@std@@QAEXXZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: class std::locale::facet * __thiscall std::locale::facet::_Decref(void)" (?_Decref@facet@locale@std@@QAEPAV123@XZ) already defined in panels.lib(panel_main.obj) 3libcpmtd.lib(ios.obj) : error LNK2005: "private: static void __cdecl std::ios_base::_Ios_base_dtor(class std::ios_base *)" (?_Ios_base_dtor@ios_base@std@@CAXPAV12@@Z) already defined in msvcprtd.lib(MSVCP90D.dll) 3libcpmtd.lib(ios.obj) : error LNK2005: "public: static void __cdecl std::ios_base::_Addstd(class std::ios_base *)" (?_Addstd@ios_base@std@@SAXPAV12@@Z) already defined in msvcprtd.lib(MSVCP90D.dll) 3libcpmtd.lib(locale0.obj) : error LNK2005: "void __cdecl _AtModuleExit(void (__cdecl*)(void))" (?_AtModuleExit@@YAXP6AXXZ@Z) already defined in msvcprtd.lib(locale0_implib.obj) 3libcpmtd.lib(locale0.obj) : error LNK2005: __Fac_tidy already defined in msvcprtd.lib(locale0_implib.obj) 3libcpmtd.lib(locale0.obj) : error LNK2005: "private: static void __cdecl std::locale::facet::facet_Register(class std::locale::facet *)" (?facet_Register@facet@locale@std@@CAXPAV123@@Z) already defined in msvcprtd.lib(locale0_implib.obj) 3libcpmtd.lib(locale0.obj) : error LNK2005: "private: static class std::locale::_Locimp * __cdecl std::locale::_Getgloballocale(void)" (?_Getgloballocale@locale@std@@CAPAV_Locimp@12@XZ) already defined in msvcprtd.lib(MSVCP90D.dll) 3libcpmtd.lib(locale0.obj) : error LNK2005: "private: static class std::locale::_Locimp * __cdecl std::locale::_Init(void)" (?_Init@locale@std@@CAPAV_Locimp@12@XZ) already defined in msvcprtd.lib(MSVCP90D.dll) 3libcpmtd.lib(locale0.obj) : error LNK2005: "public: static void __cdecl std::_Locinfo::_Locinfo_ctor(class std::_Locinfo *,class std::basic_string,class std::allocator const &)" (?_Locinfo_ctor@_Locinfo@std@@SAXPAV12@ABV?$basic_string@DU?$char_traits@D@std@@V?$allocator@D@2@@2@@Z) already defined in msvcprtd.lib(MSVCP90D.dll) 3libcpmtd.lib(locale0.obj) : error LNK2005: "public: static void __cdecl std::_Locinfo::_Locinfo_dtor(class std::_Locinfo *)" (?_Locinfo_dtor@_Locinfo@std@@SAXPAV12@@Z) already defined in msvcprtd.lib(MSVCP90D.dll) 3libcpmtd.lib(xlock.obj) : error LNK2005: "public: __thiscall std::_Lockit::_Lockit(int)" (??0_Lockit@std@@QAE@H@Z) already defined in msvcprtd.lib(MSVCP90D.dll) 3libcpmtd.lib(xlock.obj) : error LNK2005: "public: __thiscall std::_Lockit::~_Lockit(void)" (??1_Lockit@std@@QAE@XZ) already defined in msvcprtd.lib(MSVCP90D.dll)

    Read the article

  • Actionscript multiple file upload, with parameter passing is not working

    - by Metropolis
    Hey everyone, First off, I am very bad at flash/actionscript, it is not my main programming language. I have created my own file upload flash app that has been working great for me up until this point. It uses PHP to upload the files and sends back a status message which gets displayed in a status box to the user. Now I have run into a situation where I need the HTML to pass a parameter to the Actionscript, and then to the PHP file using POST. I have tried to set this up just like adobe has it on http://livedocs.adobe.com/flex/3/html/help.html?content=17_Networking_and_communications_7.html without success. Here is my Actionscript code import fl.controls.TextArea; //Set filters var imageTypes:FileFilter = new FileFilter("Images (*.jpg, *.jpeg, *.gif, *.png)", "*.jpg; *.jpeg; *.gif; *.png"); var textTypes:FileFilter = new FileFilter("Documents (*.txt, *.rtf, *.pdf, *.doc)", "*.txt; *.rtf; *.pdf; *.doc"); var allTypes:Array = new Array(textTypes, imageTypes); var fileRefList:FileReferenceList = new FileReferenceList(); //Add event listeners for its various fileRefList functions below upload_buttn.addEventListener(MouseEvent.CLICK, browseBox); fileRefList.addEventListener(Event.SELECT, selectHandler); function browseBox(event:MouseEvent):void { fileRefList.browse(allTypes); } function selectHandler(event:Event):void { var phpRequest:URLRequest = new URLRequest("ajax/upload.ajax.php"); var flashVars:URLVariables = objectToURLVariables(this.root.loaderInfo); phpRequest.method = URLRequestMethod.POST; phpRequest.data = flashVars; var file:FileReference; var files:FileReferenceList = FileReferenceList(event.target); var selectedFileArray:Array = files.fileList; var listener:Object = new Object(); for (var i:uint = 0; i < selectedFileArray.length; i++) { file = FileReference(selectedFileArray[i]); try { file.addEventListener(DataEvent.UPLOAD_COMPLETE_DATA, phpResponse); file.upload(phpRequest); } catch (error:Error) { status_txt.text = file.name + " Was not uploaded correctly (" + error.message + ")"; } } } function phpResponse(event:DataEvent):void { var file:FileReference = FileReference(event.target); status_txt.htmlText += event.data; } function objectToURLVariables(parameters:Object):URLVariables { var paramsToSend:URLVariables = new URLVariables(); for(var i:String in parameters) { if(i!=null) { if(parameters[i] is Array) paramsToSend[i] = parameters[i]; else paramsToSend[i] = parameters[i].toString(); } } return paramsToSend; } The flashVars variable is the one that should contain the values from the HTML file. But whenever I run the program and output the variables in the PHP file I receive the following. //Using this command on the PHP page print_r($_POST); //I get this for output Array ( [Filename] => testfile.txt [Upload] => Submit Query ) Its almost like the parameters are getting over written or are just not working at all. Thanks for any help, Metropolis

    Read the article

  • XPath expression with condition on multiple ancestors

    - by Rest Wing
    The application I am developing receives an XML structure similar to following: <Root> <Valid> <Child name="Child1" /> <Container> <Child name="Child2" /> </Container> <Container> <Container> <Child name="Child3"/> <Child name="Child4"/> </Container> </Container> <Wrapper> <Child name="Child5" /> </Wrapper> <Wrapper> <Container> <Child name="Child19" /> </Container> </Wrapper> <Container> <Wrapper> <Child name="Child6" /> </Wrapper> </Container> <Container> <Wrapper> <Container> <Child name="Child20" /> </Container> </Wrapper> </Container> </Valid> <Invalid> <Child name="Child7" /> <Container> <Child name="Child8" /> </Container> <Container> <Container> <Child name="Child9"/> <Child name="Child10"/> </Container> </Container> <Wrapper> <Child name="Child11" /> </Wrapper> <Container> <Wrapper> <Child name="Child12" /> </Wrapper> </Container> </Invalid> </Root> I need to get a list of of Child elements under following conditions: Child is n generation descendant of Valid ancestor. Child may be m generation descendant of Container ancestor which is o generation descendant of Valid ancestor. Valid ancestors for Child element are Container elements as m generation ancestors and Valid element as first generation ancestor. where m, n, o are natural numbers. I need to write following XPath expressions Valid/Child Valid/Container/Child Valid/Container/Container/Child Valid/Container/Container/Container/Child ... as a single XPath expression. For provided example, the XPath expression would return only Child elements having name attribute equal to Child1, Child2, Child3 and Child4. The closest I have come to solution is following expression. Valid/Child | Valid//*[self::Container]/Child However, this would select Child element with name attribute equal to Child19 and Child20. Does XPath syntax supports either optional occurrence of an element or setting condition similar to self in previous example to all ancestors between Child and Valid elements?

    Read the article

  • XSD Schema for XML with multiple structures

    - by Xetius
    I am attempting to write an XML Schema to cover a number of XML conditions which I may encounter. I have the same root element (serviceRequest) with different child elements. I was trying to use the xs:extension element to define multiple versions, but it is complaining about unexpected element orderInclusionCriteria etc. Am I going about this the right way, or is there a better way to define this? The other way I thought about this was to have a single xs:choice with all the options inside it, but this seemed somewhat inelegant. These XSD files are for use within XMLBeans if that makes any difference. I have Given the following 2 examples of XML: 1) <?xml version="1.0" encoding="utf-8"?> <serviceRequest method="GOO" debug="NO"> <sessionId sID="ABC1234567" /> <orderInclusionCriteria accountId="1234567" accountNum="1234567890" /> </serviceRequest> 2) <?xml version="1.0" encoding="utf-8"?> <serviceRequest method="GOO" debug="NO"> <sessionId sID="ABC1234567" /> <action aType='MakePayment'> <makePayment accountID='CH91015165S' amount='5.00' /> </action> </serviceRequest> I thought I could use the following schema file: <?xml version="1.0" encoding="UTF-8"?> <xs:schema xmlns:xs="http://www.w3.org/2001/XMLSchema"> <xs:element name="serviceRequest" type="ServiceRequestType" /> <xs:element name="session" type="SessionType" /> <xs:attribute name="method" type="xs:string" /> <xs:attribute name="debug" type="xs:string" /> <xs:complexType name="SessionType"> <xs:attribute name="sID" use="required"> <xs:simpleType> <xs:restriction base="xs:string"/> </xs:simpleType> </xs:attribute> </xs:complexType> <xs:complexType name="ServiceRequestType"> <xs:sequence> <xs:element ref="session" /> </xs:sequence> <xs:attribute ref="method" /> <xs:attribute ref="debug" /> </xs:complexType> <xs:complexType name="OrderTrackingServiceRequest"> <xs:complexContent> <xs:extension base="ServiceRequestType"> <xs:complexType> <xs:sequence> <xs:element name="OrderInclusionCriteria" type="xs:string" /> </xs:sequence> </xs:complexType> </xs:extension> </xs:complexContent> </xs:complexType> <xs:complexType name="Action"> <xs:complexContent> <xs:extension base="ServiceRequestType"> <xs:complexType> <xs:sequence> <xs:element name="makePayment"> <xs:complexType> <xs:attribute name="accountID" type="xs:string" /> <xs:attribute name="amount" type="xs:string" /> <xs:complexType> </xs:element> </xs:sequence> <xs:attribute name="aType" type="xs:string" /> </xs:complexType> </xs:extension> </xs:complexContent> </xs:complexType> </xs:schema>

    Read the article

  • Reuse a facelet in multiple beans

    - by Seitaridis
    How do I invoke/access a property of a managed bean when the bean name is known, but is not yet constructed? For example: <p:selectOneMenu value="#{eval.evaluateAsBean(bean).text}" > <f:selectItems value="#{eval.evaluateAsBean(bean).values}" var="val" itemLabel="#{val}" itemValue="#{val}" /> </p:selectOneMenu> If there is a managed bean called testBean and in my view bean has the "testBean"value, I want the text or values property of testBean to be called. EDIT1 The context An object consists of a list of properties(values). One property is modified with a custom JSF editor, depending on its type. The list of editors is determined from the object's type, and displayed in a form using custom:include tags. This custom tag is used to dynamically include the editors <custom:include src="#{editor.component}">. The component property points to the location of the JSF editor. In my example some editors(rendered as select boxes) will use the same facelet(dynamicDropdown.xhtml). Every editor has a session scoped managed bean. I want to reuse the same facelet with multiple beans and to pass the name of the bean to dynamicDropdown.xhtml using the bean param. genericAccount.xhtml <p:dataTable value="#{group.editors}" var="editor"> <p:column headerText="Key"> <h:outputText value="#{editor.name}" /> </p:column> <p:column headerText="Value"> <h:panelGroup rendered="#{not editor.href}"> <h:outputText value="#{editor.component}" escape="false" /> </h:panelGroup> <h:panelGroup rendered="#{editor.href}"> <custom:include src="#{editor.component}"> <ui:param name="enabled" value="#{editor.enabled}"/> <ui:param name="bean" value="#{editor.bean}"/> <custom:include> </h:panelGroup> </p:column> </p:dataTable> #{editor.component} refers to a dynamicDropdown.xhtml file. dynamicDropdown.xhtml <ui:composition xmlns="http://www.w3.org/1999/xhtml" xmlns:ui="http://java.sun.com/jsf/facelets" xmlns:h="http://java.sun.com/jsf/html" xmlns:f="http://java.sun.com/jsf/core" xmlns:p="http://primefaces.prime.com.tr/ui"> <p:selectOneMenu value="#{eval.evaluateAsBean(bean).text}" > <f:selectItems value="#{eval.evaluateAsBean(bean).values}" var="val" itemLabel="#{val}" itemValue="#{val}" /> </p:selectOneMenu> </ui:composition> eval is a managed bean: @ManagedBean(name = "eval") @ApplicationScoped public class ELEvaluator { ... public Object evaluateAsBean(String el) { FacesContext context = FacesContext.getCurrentInstance(); Object bean = context.getELContext() .getELResolver().getValue(context.getELContext(), null, el); return bean; } ... }

    Read the article

  • using getScript to import plugin on page using multiple versions of jQuery

    - by mikez302
    I am developing an app on a page that uses jQuery 1.2.6, but I would like to use jQuery 1.4.2 for my app. I really don't like to use multiple versions of jQuery like this but the copy on the page (1.2.6) is something I have no control over. I decided to isolate my code like this: <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd"> <html><head> <script type="text/javascript" src="jquery-1.2.6.min.js> <script type="text/javascript" src="pageStuff.js"> </head> <body> Welcome to our page. <div id="app"> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1.4.2/jquery.js"></script> <script type="text/javascript" src="myStuff.js"> </div> </body></html> The file myStuff.js has my own code that is supposed to use jQuery 1.4.2, and it looks like this: (function($) { //wrap everything in function to add ability to use $ var with noConflict var jQuery = $; //my code })(jQuery.noConflict(true)); This is an extremely simplified version, but I hope you get the idea of what I did. For a while, everything worked fine. However, I decided to want to use a jQuery plugin in a separate file. I tested it and it acted funny. After some experimentation, I found out that the plugin was using the old version of jQuery, when I wanted it to use the new version. Does anyone know how to import and run a js file from the context within the function wrapping the code in myStuff.js? In case this matters to anyone, here is how I know the plugin is using the old version, and what I did to try to solve the problem: I made a file called test.js, consisting of this line: alert($.fn.jquery); I tried referencing the file in a script tag the way external Javascript is usually included, below myStuff.js, and it came up as 1.2.6, like I expected. I then got rid of that script tag and put this line in myStuff.js: $.getScript("test.js"); and it still came back as 1.2.6. That wasn't a big surprise -- according to jQuery's documentation, scripts included that way are executed in the global context. I then tried doing this instead: var testFn = $.proxy($.getScript, this); testFn("test.js"); and it still came back as 1.2.6. After some tinkering, I found out that the "this" keyword referred to the window, which I assume means the global context. I am looking for something to put in place of "this" to refer to the context of the enclosing function, or some other way to make the code in the file run from the enclosing function. I noticed that if I copy and paste the code, it works fine, but it is a big plugin that is used in many places, and I would prefer not to clutter up my file with their code. I am out of ideas. Does anyone else know how to do this?

    Read the article

  • Multiple data series in real time plot

    - by Gr3n
    Hi, I'm kind of new to Python and trying to create a plotting app for values read via RS232 from a sensor. I've managed (after some reading and copying examples online) to get a plot working that updates on a timer which is great. My only trouble is that I can't manage to get multiple data series into the same plot. Does anyone have a solution to this? This is the code that I've worked out this far: import os import pprint import random import sys import wx # The recommended way to use wx with mpl is with the WXAgg backend import matplotlib matplotlib.use('WXAgg') from matplotlib.figure import Figure from matplotlib.backends.backend_wxagg import FigureCanvasWxAgg as FigCanvas, NavigationToolbar2WxAgg as NavigationToolbar import numpy as np import pylab DATA_LENGTH = 100 REDRAW_TIMER_MS = 20 def getData(): return int(random.uniform(1000, 1020)) class GraphFrame(wx.Frame): # the main frame of the application def __init__(self): wx.Frame.__init__(self, None, -1, "Usart plotter", size=(800,600)) self.Centre() self.data = [] self.paused = False self.create_menu() self.create_status_bar() self.create_main_panel() self.redraw_timer = wx.Timer(self) self.Bind(wx.EVT_TIMER, self.on_redraw_timer, self.redraw_timer) self.redraw_timer.Start(REDRAW_TIMER_MS) def create_menu(self): self.menubar = wx.MenuBar() menu_file = wx.Menu() m_expt = menu_file.Append(-1, "&Save plot\tCtrl-S", "Save plot to file") self.Bind(wx.EVT_MENU, self.on_save_plot, m_expt) menu_file.AppendSeparator() m_exit = menu_file.Append(-1, "E&xit\tCtrl-X", "Exit") self.Bind(wx.EVT_MENU, self.on_exit, m_exit) self.menubar.Append(menu_file, "&File") self.SetMenuBar(self.menubar) def create_main_panel(self): self.panel = wx.Panel(self) self.init_plot() self.canvas = FigCanvas(self.panel, -1, self.fig) # pause button self.pause_button = wx.Button(self.panel, -1, "Pause") self.Bind(wx.EVT_BUTTON, self.on_pause_button, self.pause_button) self.Bind(wx.EVT_UPDATE_UI, self.on_update_pause_button, self.pause_button) self.hbox1 = wx.BoxSizer(wx.HORIZONTAL) self.hbox1.Add(self.pause_button, border=5, flag=wx.ALL | wx.ALIGN_CENTER_VERTICAL) self.vbox = wx.BoxSizer(wx.VERTICAL) self.vbox.Add(self.canvas, 1, flag=wx.LEFT | wx.TOP | wx.GROW) self.vbox.Add(self.hbox1, 0, flag=wx.ALIGN_LEFT | wx.TOP) self.panel.SetSizer(self.vbox) #self.vbox.Fit(self) def create_status_bar(self): self.statusbar = self.CreateStatusBar() def init_plot(self): self.dpi = 100 self.fig = Figure((3.0, 3.0), dpi=self.dpi) self.axes = self.fig.add_subplot(111) self.axes.set_axis_bgcolor('white') self.axes.set_title('Usart data', size=12) pylab.setp(self.axes.get_xticklabels(), fontsize=8) pylab.setp(self.axes.get_yticklabels(), fontsize=8) # plot the data as a line series, and save the reference # to the plotted line series # self.plot_data = self.axes.plot( self.data, linewidth=1, color="blue", )[0] def draw_plot(self): # redraws the plot xmax = len(self.data) if len(self.data) > DATA_LENGTH else DATA_LENGTH xmin = xmax - DATA_LENGTH ymin = 0 ymax = 4096 self.axes.set_xbound(lower=xmin, upper=xmax) self.axes.set_ybound(lower=ymin, upper=ymax) # enable grid #self.axes.grid(True, color='gray') # Using setp here is convenient, because get_xticklabels # returns a list over which one needs to explicitly # iterate, and setp already handles this. # pylab.setp(self.axes.get_xticklabels(), visible=True) self.plot_data.set_xdata(np.arange(len(self.data))) self.plot_data.set_ydata(np.array(self.data)) self.canvas.draw() def on_pause_button(self, event): self.paused = not self.paused def on_update_pause_button(self, event): label = "Resume" if self.paused else "Pause" self.pause_button.SetLabel(label) def on_save_plot(self, event): file_choices = "PNG (*.png)|*.png" dlg = wx.FileDialog( self, message="Save plot as...", defaultDir=os.getcwd(), defaultFile="plot.png", wildcard=file_choices, style=wx.SAVE) if dlg.ShowModal() == wx.ID_OK: path = dlg.GetPath() self.canvas.print_figure(path, dpi=self.dpi) self.flash_status_message("Saved to %s" % path) def on_redraw_timer(self, event): if not self.paused: newData = getData() self.data.append(newData) self.draw_plot() def on_exit(self, event): self.Destroy() def flash_status_message(self, msg, flash_len_ms=1500): self.statusbar.SetStatusText(msg) self.timeroff = wx.Timer(self) self.Bind( wx.EVT_TIMER, self.on_flash_status_off, self.timeroff) self.timeroff.Start(flash_len_ms, oneShot=True) def on_flash_status_off(self, event): self.statusbar.SetStatusText('') if __name__ == '__main__': app = wx.PySimpleApp() app.frame = GraphFrame() app.frame.Show() app.MainLoop()

    Read the article

  • opengl - Rendering multiple cubes

    - by opiop65
    I have this code (Doesn't work at all) static void initGl() { glViewport(0, 0, Display.getWidth(), Display.getHeight()); glMatrixMode(GL_PROJECTION); glLoadIdentity(); GLU.gluPerspective(45.0f, Display.getWidth() / Display.getHeight(), 1.0f, 1000.0f); glMatrixMode(GL_MODELVIEW); glLoadIdentity(); glClearColor(0.0f, 0.0f, 0.0f, 0.0f); glClearDepth(1.0f); glDepthFunc(GL_LEQUAL); glEnable(GL_DEPTH_TEST); glShadeModel(GL_SMOOTH); glHint(GL_PERSPECTIVE_CORRECTION_HINT, GL_NICEST); } public static void renderGL() { glViewport(0, 0, Display.getWidth(), Display.getHeight()); glClearColor(0.0f, 0.0f, 0.0f, 0.5f); glLoadIdentity(); glTranslatef(0.0f, 0.0f, -60.0f); drawCube(); } public static void drawCube() { for (int x = 0; x < 100; x++) { for (int y = 0; y < 100; y++) { for (int z = 0; z < 100; z++) { glBegin(GL_QUADS); glColor3f(1, 0, 0); glVertex3f(-x, -y, z); glVertex3f(x, -y, z); glVertex3f(x, y, z); glVertex3f(-x, y, z); glColor3f(1, 0, 1); glVertex3f(x, -y, -z); glVertex3f(-x, -y, -z); glVertex3f(-x, y, -z); glVertex3f(x, y, -z); glColor3f(1, 1, 1); glVertex3f(-x, y, z); glVertex3f(x, y, z); glVertex3f(x, y, -z); glVertex3f(-x, y, -z); glColor3f(0, 0, 1); glVertex3f(x, -y, z); glVertex3f(-x, -y, z); glVertex3f(-x, -y, -z); glVertex3f(x, -y, -z); glColor3f(1, 1, 0); glVertex3f(x, -y, z); glVertex3f(x, -y, -z); glVertex3f(x, y, -z); glVertex3f(x, y, z); glColor3f(0, 2, 1); glVertex3f(-x, -y, -z); glVertex3f(-x, -y, z); glVertex3f(-x, y, z); glVertex3f(-x, y, -z); glEnd(); } } } All it does it freeze up the program and eventually it will render the red side of the cube. This obviously has to do with gltranslatef, but I don't know why that isn't working. My question is, how do I render multiple cubes at once? Are there any tutorials out there on voxel engines? Sorry for the horrible code, I realize I probably need a array to do this. I'm quite new at opengl.

    Read the article

  • Get Two row with multiple column in asp.net c#

    - by Gaurav Naik
    How to get data from database with two rows and multiple column with seperator will be there after the 1 row end as an example: <div class="_thum_bar"> <div class="box1"> <div class="_t1_box"><a href="#!/condom_details"><img src="images/pack/pack1.png" border="0"></a></div> <div class="_t2_box"> <h1>Dotted Condom</h1> <p>Dotted condoms for additional friction. Pure ecstasy makes this a KamaSutra all time favourite.</p> <h2><a href="#!/condom_details">Add to cart</a></h2> </div> </div> <div class="box2"> <div class="_t1_box"><a href="#!/condom_details"><img src="images/pack/pack1.png" border="0"></a></div> <div class="_t2_box"> <h1>Dotted Condom</h1> <p>Dotted condoms for additional friction. Pure ecstasy makes this a KamaSutra all time favourite.</p> <h2><a href="#!/condom_details">Add to cart</a></h2> </div> </div> <div class="box3"> <div class="_t1_box"><a href="#"><img src="images/pack/pack1.png" border="0"></a></div> <div class="_t2_box"> <h1>Dotted Condom</h1> <p>Dotted condoms for additional friction. Pure ecstasy makes this a KamaSutra all time favourite.</p> <h2><a href="#!/condom_details">Add to cart</a></h2> </div> </div> </div> <div class="_t_spacer">&nbsp;</div> <div class="_thum_bar"> <div class="box1"> <div class="_t1_box"><a href="#!/condom_details"><img src="images/pack/pack1.png" border="0"></a></div> <div class="_t2_box"> <h1>Dotted Condom</h1> <p>Dotted condoms for additional friction. Pure ecstasy makes this a KamaSutra all time favourite.</p> <h2><a href="#!/condom_details">Add to cart</a></h2> </div> </div> <div class="box2"> <div class="_t1_box"><a href="#!/condom_details"><img src="images/pack/pack1.png" border="0"></a></div> <div class="_t2_box"> <h1>Dotted Condom</h1> <p>Dotted condoms for additional friction. Pure ecstasy makes this a KamaSutra all time favourite.</p> <h2><a href="#!/condom_details">Add to cart</a></h2> </div> </div> </div> <div class="_t_spacer">&nbsp;</div>

    Read the article

  • Hover/Fadeto/Toggle Multiple Class Changing

    - by Slick Willis
    So my problem is rather simple and complex at the same time. I am trying to create links that fade in when you mouseover them and fade out when you mouseout of them. At the same time that you are going over them I would like a pic to slide from the left. This is the easy part, I have every thing working. The image fades and another image slides. I did this by using a hover, fadeto, and toggle("slide"). I would like to do this in a table format with multiple images being able to be scrolled over and sliding images out. The problem is that I am calling my sliding image to a class and when I hover over the letters both images slide out. Does anybody have a solution for this? I posted the code that I used below: <html> <head> <script type='text/javascript' src='http://accidentalwords.squarespace.com/storage/jquery/jquery-1.4.2.min.js'></script> <script type='text/javascript' src='http://accidentalwords.squarespace.com/storage/jquery/jquery-custom-181/jquery-ui-1.8.1.custom.min.js'></script> <style type="text/css"> .text-slide { display: none; margin: 0px; width: 167px; height: 50px; } </style> <script> $(document).ready(function(){ $(".letterbox-fade").fadeTo(1,0.25); $(".letterbox-fade").hover(function () { $(this).stop().fadeTo(250,1); $(".text-slide").toggle("slide", {}, 1000); }, function() { $(this).stop().fadeTo(250,0.25); $(".text-slide").toggle("slide", {}, 1000); }); }); </script> </head> <body style="background-color: #181818"> <table> <tr> <td><div class="letterbox-fade"><img src="http://accidentalwords.squarespace.com/storage/sidebar/icons/A-Letterbox-Selected.png" /></div></td> <td><div class="text-slide"><img src="http://accidentalwords.squarespace.com/storage/sidebar/icons/TEST.png" /></div></td> </tr> <tr> <td><div class="letterbox-fade"><img src="http://accidentalwords.squarespace.com/storage/sidebar/icons/B-Letterbox-Selected.png" /></div></td> <td><div class="text-slide"><img src="http://accidentalwords.squarespace.com/storage/sidebar/icons/TEST.png" /></div></td> </tr> </table> </body> </html>

    Read the article

  • multiple timer to one process (without linking to rt)

    - by Richard
    Hi, is there any way to register multiple timer to a single process? I have tried following code, yet without success. (Use "gcc -lrt" to compile it...). Program output nothing, which should atleast print "test". Is it possibly due to the dependence to linking to rt? #define TT_SIGUSR1 (SIGRTMAX) #define TT_SIGUSR2 (SIGRTMAX - 1) #define TIME_INTERVAL_1 1 #define TIME_INTERVAL_2 2 #include <signal.h> #include <time.h> #include <stdio.h> #include <unistd.h> #include <linux/unistd.h> #include <sys/syscall.h> #include <sys/time.h> #include <sys/types.h> #include <sched.h> #include <signal.h> #include <setjmp.h> #include <errno.h> #include <assert.h> timer_t create_timer(int signo) { timer_t timerid; struct sigevent se; se.sigev_signo = signo; if (timer_create(CLOCK_REALTIME, &se, &timerid) == -1) { fprintf(stderr, "Failed to create timer\n"); exit(-1); } return timerid; } void set_timer(timer_t timerid, int seconds) { struct itimerspec timervals; timervals.it_value.tv_sec = seconds; timervals.it_value.tv_nsec = 0; timervals.it_interval.tv_sec = seconds; timervals.it_interval.tv_nsec = 0; if (timer_settime(timerid, 0, &timervals, NULL) == -1) { fprintf(stderr, "Failed to start timer\n"); exit(-1); } return; } void install_sighandler2(int signo, void(*handler)(int)) { struct sigaction sigact; sigemptyset(&sigact.sa_mask); sigact.sa_flags = SA_SIGINFO; //register the Signal Handler sigact.sa_sigaction = handler; // Set up sigaction to catch signal first timer if (sigaction(signo, &sigact, NULL) == -1) { printf("sigaction failed"); return -1; } } void install_sighandler(int signo, void(*handler)(int)) { sigset_t set; struct sigaction act; /* Setup the handler */ act.sa_handler = handler; act.sa_flags = SA_RESTART; sigaction(signo, &act, 0); /* Unblock the signal */ sigemptyset(&set); sigaddset(&set, signo); sigprocmask(SIG_UNBLOCK, &set, NULL); return; } void signal_handler(int signo) { printf("receiving sig %d", signo); } int main() { printf("test"); timer_t timer1 = create_timer(TT_SIGUSR1); timer_t timer2 = create_timer(TT_SIGUSR2); set_timer(timer1, TIME_INTERVAL_1); set_timer(timer2, TIME_INTERVAL_2); install_sighandler2(TT_SIGUSR1, signal_handler); install_sighandler(TT_SIGUSR2, signal_handler); while (1) ; return 0; }

    Read the article

  • VBScript Multiple folder check if then statement

    - by user2868186
    I had this working before just fine with the exception of getting an error if one of the folders was not there, so I tried to fix it. Searched for a while (as much as I can at work) for a solution and tried different methods, still no luck and my IT tickets are stacking up at work, lol, woohoo. Thanks for any help provided. Getting syntax error on line 60 character 60, thanks again. Option Explicit Dim objFSO, Folder1, Folder2, Folder3, zipFile Dim ShellApp, zip, oFile, CurDate, MacAdd, objWMIService Dim MyTarget, MyHex, MyBinary, i, strComputer, objItem, FormatMAC Dim oShell, oCTF, CurDir, scriptPath, oRegEx, colItems Dim FoldPath1, FoldPath2, FoldPath3, foldPathArray Const FOF_SIMPLEPROGRESS = 256 'Grabs MAC from current machine strComputer = "." Set objWMIService = GetObject("winmgmts:\\" & strComputer & "\root\cimv2") Set colItems = objWMIService.ExecQuery _ ("Select * From Win32_NetworkAdapterConfiguration Where IPEnabled = True") For Each objItem in colItems MacAdd = objItem.MACAddress Next 'Finds the pattern of a MAC address then changes it for 'file naming purposes. You can change the FormatMAC line of the code 'in parenthesis where the periods are, to whatever you like 'as long as its within the standard file naming convention Set oRegEx = CreateObject("VBScript.RegExp") oRegEx.Pattern = "([\dA-F]{2}).?([\dA-F]{2}).?([\dA-F]" _ & "{2}).?([\dA-F]{2}).?([\dA-F]{2}).?([\dA-F]{2})" FormatMAC = oRegEx.Replace(MacAdd, "$1.$2.$3.$4.$5.$6") 'Gets current date in a format for file naming 'Periods can be replaced with anything that is standard to 'file naming convention CurDate = Month(Date) & "." & Day(Date) & "." & Year(Date) 'Gets path of the directory where the script is being ran from Set objFSO = CreateObject("Scripting.FileSystemObject") scriptPath = Wscript.ScriptFullName Set oFile = objFSO.GetFile(scriptPath) CurDir = objFSO.GetParentFolderName(oFile) 'where and what the zip file will be called/saved MyTarget = CurDir & "\" & "IRAP_LOGS_" & CurDate & "_" & FormatMAC & ".zip" 'Actual creation of the zip file MyHex = Array(80, 75, 5, 6, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,0, 0) For i = 0 To UBound(MyHex) MyBinary = MyBinary & Chr(MyHex(i)) Next Set oShell = CreateObject("WScript.Shell") Set oCTF = objFSO.CreateTextFile(MyTarget, True) oCTF.Write MyBinary oCTF.Close Set oCTF = Nothing wScript.Sleep(3000) folder1 = True folder2 = True folder3 = True 'Adds folders to the zip file created earlier 'change these folders to whatever is needing to be copied into the zip folder 'Folder1 If not objFSO.FolderExists("C:\Windows\Temp\SMSTSLog") and If not objFSO.FolderExists("X:\Windows\Temp\SMSTSLog") then Folder1 = false End If If objFSO.FolderExists("C:\Windows\Temp\SMSTSLog") Then Folder1 = "C:\Windows\Temp\SMSTSLog" Set FoldPath1 = objFSO.getFolder(Folder1) Else Folder1 = "X:\windows\Temp\SMSTSLog" Set FoldPath1 = objFSO.getFolder(Folder1) End If 'Folder2 If not objFSO.FolderExists("C:\Windows\System32\CCM\Logs") and If not objFSO.FolderExists("X:\Windows\System32\CCM\Logs") then Folder2 = false End If If objFSO.FolderEXists("C:\Windows\System32\CCM\Logs") Then Folder2 = "C:\Windows\System32\CCM\Logs" Set FoldPath2 = objFSO.getFolder(Folder2) Else Folder2 = "X:\Windows\System32\CCM\Logs" Set FoldPath2 = objFSO.getFolder(Folder2) End If 'Folder3 If not objFSO.FolderExists("C:\Windows\SysWOW64\CCM\Logs") and If not objFSO.FolderExists("X:\Windows\SysWOW64\CCM\Logs") then Folder3 = false End If If objFSO.FolderExists("C:\Windows\SysWOW64\CCM\Logs") Then Folder3 = "C:\Windows\SysWOW64\CCM\Logs" set FolderPath3 =objFSO.getFolder(Folder3) Else Folder3 = "X:\Windows\SysWOW64\CCM\Logs" Set FoldPath3 = objFSO.getFolder(Folder3) End If set objFSO = CreateObject("Scripting.FileSystemObject") objFSO.OpenTextFile(MyTarget, 2, True).Write "PK" & Chr(5) & Chr(6) _ & String(18, Chr(0)) Set ShellApp = CreateObject("Shell.Application") Set zip = ShellApp.NameSpace(MyTarget) 'checks if files are there before trying to copy 'otherwise it will error out If folder1 = True And FoldPath1.files.Count >= 1 Then zip.CopyHere Folder1 End If WScript.Sleep 3000 If folder2 = true And FoldPath2.files.Count >= 1 Then zip.CopyHere Folder2 End If WScript.Sleep 3000 If folder3 = true And FoldPath3.files.Count >= 1 Then zip.CopyHere Folder3 End If WScript.Sleep 5000 set ShellApp = Nothing set ZipFile = Nothing Set Folder1 = Nothing Set Folder2 = Nothing Set Folder3 = Nothing createobject("wscript.shell").popup "Zip File Created Successfully", 3

    Read the article

  • NoMethodError Rails multiple file uploads

    - by Danny McClelland
    Hi Everyone, I am working on getting multiple file uploads working for an model in my application, I have included the code below: delivers_controller.rb # POST /delivers def create @deliver = Deliver.new(params[:deliver]) process_file_uploads(@deliver) if @deliver.save flash[:notice] = 'Task was successfully created.' redirect_to(@deliver) else render :action => "new" end end protected def process_file_uploads(deliver) i = 0 while params[:attachment]['file_'+i.to_s] != "" && !params[:attachment]['file_'+i.to_s].nil? deliver.assets.build(:data => params[:attachment]['file_'+i.to_s]) i += 1 end end deliver.rb has_many :assets, :as => :attachable, :dependent => :destroy validate :validate_attachments Max_Attachments = 5 Max_Attachment_Size = 5.megabyte def validate_attachments errors.add_to_base("Too many attachments - maximum is #{Max_Attachments}") if assets.length > Max_Attachments assets.each {|a| errors.add_to_base("#{a.name} is over #{Max_Attachment_Size/1.megabyte}MB") if a.file_size > Max_Attachment_Size} end assets_controller.rb class AssetsController < ApplicationController def show asset = Asset.find(params[:id]) # do security check here send_file asset.data.path, :type => asset.data_content_type end def destroy asset = Asset.find(params[:id]) @asset_id = asset.id.to_s @allowed = Deliver::Max_Attachments - asset.attachable.assets.count asset.destroy end end asset.rb class Asset < ActiveRecord::Base has_attached_file :data, belongs_to :attachable, :polymorphic => true def url(*args) data.url(*args) end def name data_file_name end def content_type data_content_type end def file_size data_file_size end end Whenever I create a new deliver item and try to attach any files I get the following error: NoMethodError in DeliversController#create You have a nil object when you didn't expect it! You might have expected an instance of ActiveRecord::Base. The error occurred while evaluating nil.[] /Users/danny/Dropbox/SVN/railsapps/macandco/surveymanager/trunk/app/controllers/delivers_controller.rb:60:in `process_file_uploads' /Users/danny/Dropbox/SVN/railsapps/macandco/surveymanager/trunk/app/controllers/delivers_controller.rb:46:in `create' new.html.erb (Deliver view) <% content_for :header do -%> Deliver Repositories <% end -%> <% form_for(@deliver, :html => { :multipart => true }) do |f| %> <%= f.error_messages %> <p> <%= f.label :caseref %><br /> <%= f.text_field :caseref %> </p> <p> <%= f.label :casesubject %><br /> <%= f.text_area :casesubject %> </p> <p> <%= f.label :description %><br /> <%= f.text_area :description %> </p> <p>Pending Attachments: (Max of <%= Deliver::Max_Attachments %> each under <%= Deliver::Max_Attachment_Size/1.megabyte%>MB) <% if @deliver.assets.count >= Deliver::Max_Attachments %> <input id="newfile_data" type="file" disabled /> <% else %> <input id="newfile_data" type="file" /> <% end %> <div id="attachment_list"><ul id="pending_files"></ul></div> </p> <p> <%= f.submit 'Create' %> </p> <% end %> <%= link_to 'Back', delivers_path %> Show.html.erb (Delivers view) <% content_for :header do -%> Deliver Repositories <% end -%> <p> <b>Title:</b> <%=h @deliver.caseref %> </p> <p> <b>Body:</b> <%=h @deliver.casesubject %> </p> <p><b>Attached Files:</b><div id="attachment_list"><%= render :partial => "attachment", :collection => @deliver.assets %></div></p> <%= link_to 'Edit', edit_deliver_path(@deliver) %> | <%= link_to 'Back', deliver_path %> <%- if logged_in? %> <%= link_to 'Edit', edit_deliver_path(@deliver) %> | <%= link_to 'Back', delivers_path %> <% end %> _attachment.html.erb (Delivers view) <% if !attachment.id.nil? %><li id='attachment_<%=attachment.id %>'><a href='<%=attachment.url %>'><%=attachment.name %></a> (<%=attachment.file_size/1.kilobyte %>KB) <%= link_to_remote "Remove", :url => asset_path(:id => attachment), :method => :delete, :html => { :title => "Remove this attachment", :id => "remove" } %></li> <% end %> I have been banging my head against the wall with the error all day, if anyone can shed some light on it, I would be eternally grateful! Thanks, Danny

    Read the article

  • How to publish multiple jar files to maven on a clean install

    - by Abhijit Hukkeri
    I have a used the maven assembly plugin to create multiple jar from one jar now the problem is that I have to publish these jar to the local repo, just like other maven jars publish by them self when they are built maven clean install how will I be able to do this here is my pom file <project> <parent> <groupId>parent.common.bundles</groupId> <version>1.0</version> <artifactId>child-bundle</artifactId> </parent> <modelVersion>4.0.0</modelVersion> <groupId>common.dataobject</groupId> <artifactId>common-dataobject</artifactId> <packaging>jar</packaging> <name>common-dataobject</name> <version>1.0</version> <dependencies> </dependencies> <build> <plugins> <plugin> <groupId>org.jibx</groupId> <artifactId>maven-jibx-plugin</artifactId> <version>1.2.1</version> <configuration> <directory>src/main/resources/jibx_mapping</directory> <includes> <includes>binding.xml</includes> </includes> <verbose>false</verbose> </configuration> <executions> <execution> <goals> <goal>bind</goal> </goals> </execution> </executions> </plugin> <plugin> <artifactId>maven-assembly-plugin</artifactId> <executions> <execution> <id>make-business-assembly</id> <phase>package</phase> <goals> <goal>single</goal> </goals> <configuration> <appendAssemblyId>false</appendAssemblyId> <finalName>flight-dto</finalName> <descriptors> <descriptor>src/main/assembly/car-assembly.xml</descriptor> </descriptors> <attach>true</attach> </configuration> </execution> <execution> <id>make-gui-assembly</id> <phase>package</phase> <goals> <goal>single</goal> </goals> <configuration> <appendAssemblyId>false</appendAssemblyId> <finalName>app_gui</finalName> <descriptors> <descriptor>src/main/assembly/bike-assembly.xml</descriptor> </descriptors> <attach>true</attach> </configuration> </execution> </executions> </plugin> </plugins> </build> </project> Here is my assembly file <assembly> <id>app_business</id> <formats> <format>jar</format> </formats> <baseDirectory>target</baseDirectory> <includeBaseDirectory>false</includeBaseDirectory> <fileSets> <fileSet> <directory>${project.build.outputDirectory}</directory> <outputDirectory></outputDirectory> <includes> <include>com/dataobjects/**</include> </includes> </fileSet> </fileSets> </assembly>

    Read the article

  • Select list auto update on any kind of change?

    - by Tom Irons
    I have a jQuery that when you click on a select option it will show the next one, but you have to click, you cant just use the down arrow or "tab" to the next option. I am wondering what options do I have to make this work? Here is my jQuery: function typefunction() { var itemTypes = jQuery('#type'); var select = this.value; itemTypes.change(function () { if ($(this).val() == '1-Hand') { $('.1-Hand').show(); $('.2-Hand').hide(); $('.off').hide(); $('.Armor').hide(); } else $('.1-Hand').hide(); if ($(this).val() == '2-Hand') { $('.2-Hand').show(); $('.1-Hand').hide(); $('.off').hide(); $('.Armor').hide(); } else $('.2-Hand').hide(); if ($(this).val() == 'Armor') { $('.Armor').show(); $('.2-Hand').hide(); $('.off').hide(); $('.1-Hand').hide(); } else $('.Armor').hide(); if ($(this).val() == 'Off-Hand') { $('.Off').show(); $('.2-Hand').hide(); $('.1-Hand').hide(); $('.Armor').hide(); } else $('.Off').hide(); if ($(this).val() == '1-Hand') { $('.one-hand-dps').show(); $('.item-armor').hide(); $('.two-hand-dps').hide(); } else $('.one-hand-dps').hide(); if ($(this).val() == '2-Hand') { $('.two-hand-dps').show(); $('.one-hand-dps').hide(); $('.item-armor').hide(); } else $('.two-hand-dps').hide(); if ($(this).val() == 'Armor') { $('.item-armor').show(); $('.one-hand-dps').hide(); $('.two-hand-dps').hide(); } else $('.item-armor').hide(); }); } And the HTML: <div class="input-group item"> <span class="input-group-addon">Type</span> <select id="type" name="type" class="form-control" onclick="typefunction(); itemstats(); Armor(); OffHand(); TwoHand();"> <option value="Any Type">Any Type</option> <option value="1-Hand">1-Hand</option> <option value="2-Hand">2-Hand</option> <option value="Armor">Armor</option> <option value="Off-Hand">Off-Hand</option> </select> </div> <div class="input-group item"> <span class="1-Hand input-group-addon" style="display: none;">Sub-Type</span> <select class="1-Hand form-control" name="sub[1]" style="display: none;"> <option value="All 1-Hand Item Types">All 1-Hand Item Types</option> <option>Axe</option> <option>Ceremonial Knife</option> <option>Hand Crossbow</option> <option>Dagger</option> <option>Fist Weapon</option> <option>Mace</option> <option>Mighty Weapon</option> <option>Spear</option> <option>Sword</option> <option>Wand</option> </select> </div> <div class="input-group"> <span class="2-Hand input-group-addon" style="display: none; ">Sub-Type</span> <select class="2-Hand form-control" name="sub[2]" style="display: none;"> <option>All 2-Hand Item Types</option> <option>Two-Handed Axe</option> <option>Bow</option> <option>Diabo</option> <option>Crossbow</option> <option>Two-Handed Mace</option> <option>Two-Handed Mighty Weapon</option> <option>Polearm</option> <option>Staff</option> <option>Two-Handed Sword</option> </select> </div> <div class="input-group"> <span class="Armor input-group-addon" style="display: none;">Sub-Type</span> <select class="Armor form-control" name="sub[3]" style="display:none;"> <option>All Armor Item Types</option> <option>Amulet</option> <option>Belt</option> <option>Boots</option> <option>Bracers</option> <option>Chest Armor</option> <option>Cloak</option> <option>Gloves</option> <option>Helm</option> <option>Pants</option> <option>Mighty Belt</option> <option>Ring</option> <option>Shoulders</option> <option>Spirit Stone</option> <option>Voodoo Mask</option> <option>Wizard Hat</option> </select> </div> <div class="input-group"> <span class="Off input-group-addon" style="display: none;">Sub-Type</span> <select class="Off form-control" name="sub[4]" style="display:none;"> <option>All Off-Hand Item Types</option> <option>Mojo</option> <option>Source</option> <option>Quiver</option> <option>Shield</option> </select> </div>

    Read the article

  • Multiple schema validation in Java

    - by user279554
    Hi, I am trying to do multiple schema validation in Java. I don't understand where I am doing wrong. Any help will be appreciated. abc.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:xn="project-xml-r4j_another.xsd"> <xsd:import namespace="project-xml-r4j_another.xsd"/> <xsd:element name="abc" type="abc"> </xsd:element> <xsd:complexType name="abc"> <xsd:sequence> <xsd:element name="test" type="test" minOccurs="0" maxOccurs="1"> </xsd:element> <!--<xsd:element name="proj" type="xn:proj"/>--> </xsd:sequence> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> <xsd:complexType name="test"> <xsd:attribute name="id" type="xsd:ID" use="required"></xsd:attribute> <xsd:attribute name="value" use="required"> <xsd:simpleType> <xsd:restriction base="xsd:string"> <xsd:maxLength value="100" /> </xsd:restriction> </xsd:simpleType> </xsd:attribute> </xsd:complexType> </xsd:schema> project-xml-r4j_another.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" targetNamespace="project-xml-r4j_another.xsd" xmlns="project-xml-r4j_another.xsd" elementFormDefault="qualified" attributeFormDefault="unqualified"> <xsd:element name="proj" type="proj"> <xsd:annotation> <xsd:documentation> The project is the root tag of a project-xml. </xsd:documentation> </xsd:annotation> </xsd:element> <xsd:complexType name="proj"> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> </xsd:schema> Test case package test; import java.io.File; import java.io.IOException; import javax.xml.XMLConstants; import javax.xml.transform.Source; import javax.xml.transform.stream.StreamSource; import javax.xml.validation.Schema; import javax.xml.validation.SchemaFactory; import javax.xml.validation.Validator; import org.apache.log4j.Logger; import org.junit.Test; import org.xml.sax.SAXException; import org.xml.sax.SAXParseException; import org.xml.sax.helpers.DefaultHandler; import com.ericsson.ccrtool.core.project.projectxml.InvalidProjectXmlException; public class TestSchema { private static final Logger logger = Logger.getLogger(TestSchema.class); static final String W3C_XML_SCHEMA = XMLConstants.W3C_XML_SCHEMA_NS_URI; @Test public void test() { System.out.println("TestSchema.test()"); try { SchemaFactory schemaFactory = SchemaFactory.newInstance(W3C_XML_SCHEMA); // create a grammar object. Source [] source = { new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\abc.xsd")), new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\project-xml-r4j.xsd"))}; Schema schemaGrammar = schemaFactory.newSchema(source); Validator schemaValidator = schemaGrammar.newValidator(); schemaValidator.setErrorHandler(new MessageHandler()); // validate xml instance against the grammar. schemaValidator.validate(new StreamSource("C:\\jaydeep\\Ericsson\\R5B\\project_tmmk17cells_xnaveen_project-xml.xml")); } catch (SAXException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } catch (IOException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } } class MessageHandler extends DefaultHandler { private String errMessage = ""; @Override public void warning(SAXParseException e) { logger.info("Warning Line " + e.getLineNumber() + ": " + e.getMessage()); } @Override public void error(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } @Override public void fatalError(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } } } Thanks, Jaydeep

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Android Multiple objects in SimpleAdapter

    - by Adam Sherratt
    I have a need (unless you can think of a better way) of passing multiple objects to a custom list adapter. I know that I'm barking up the wrong tree here, and would appreciate someone setting me on the right course! Thanks playlistadapter = new MyPlaylistAdapter(MyApplication.getAppContext(), songsList, retained_songsList, folderMode, R.layout.file_view, new String[] { "songTitle","songAlbum", "songPath" }, new int[] { R.id.checkTextView, R.id.text2, R.id.text3 }); And my adapter class: public class MyPlaylistAdapter extends SimpleAdapter{ private ArrayList <Song> songsList = new ArrayList<Song>(); private ArrayList <Song> retained_songsList = new ArrayList<Song>(); private ArrayList<Song> playlistcheck = new ArrayList<Song>(); private String folderMode; private String TAG = "AndroidMediaCenter"; public MyPlaylistAdapter(Context context,List<Song> SongsList, List<Song> Retained_songsList, String FolderMode,int resource, String[] from, int[] to) { super(context, null, resource, from, to); songsList.clear(); songsList.addAll(SongsList); Log.i(TAG, "MyPlayListAdapter Songslist = " + songsList.size()); retained_songsList.clear(); retained_songsList.addAll(Retained_songsList); folderMode = FolderMode; } public View getView(int position, View convertView, ViewGroup parent) { //PlayListViewHolder holder; CheckedTextView checkTextView; TextView text2; TextView text3; if (convertView == null) { LayoutInflater inflater = (LayoutInflater) MyApplication.getAppContext().getSystemService(Context.LAYOUT_INFLATER_SERVICE); //LayoutInflater inflater=getLayoutInflater(); convertView=inflater.inflate(R.layout.file_view, parent, false); //convertView.setBackgroundColor(0xFF00FF00 ); //holder = new PlayListViewHolder(); checkTextView = (CheckedTextView) convertView.findViewById(R.id.checkTextView); text2 = (TextView) convertView.findViewById(R.id.text2); text3 = (TextView) convertView.findViewById(R.id.text3); //convertView.setTag(holder); } else { //holder = (PlayListViewHolder) convertView.getTag(); } //put something into textviews String tracks = null; String tracks_Details = null; String trackspath = null; tracks = songsList.get(position).getSongTitle(); tracks_Details = songsList.get(position).getAlbum() + " (" + songsList.get(position).getArtist() + ")"; trackspath = songsList.get(position).getSongPath(); checkTextView = (CheckedTextView) convertView.findViewById(R.id.checkTextView); text2 = (TextView) convertView.findViewById(R.id.text2); text3 = (TextView) convertView.findViewById(R.id.text3); checkTextView.setText(tracks); if(folderMode.equals("Playlists")){ checkTextView.setBackgroundColor(Color.GREEN); checkTextView.setChecked(false); try { int listsize_rs = retained_songsList.size(); for (int j = 0; j<listsize_rs;j++){ if((retained_songsList.get(j).getSongPath()).equals(songsList.get(position).getSongPath())){ checkTextView.setBackgroundColor(Color.TRANSPARENT); //Need to check here whether the checkedtextview is ticked or not checkTextView.setChecked(true); playlistcheck.add(songsList.get(position)); break; } } } catch (Exception e) { e.printStackTrace(); } }else { //Need to check here whether the checkedtextview is ticked or not try { if (songsList.get(position).getSongCheckedStatus()==true){ checkTextView.setChecked(true); }else{ checkTextView.setChecked(false); } } catch (Exception e) { e.printStackTrace(); } } text2.setText(tracks_Details); text3.setText(trackspath); Log.i(TAG, "MyPlayListAdapter Songslist = " + songsList.size()); return convertView; } } However, this doesn't inflate, throwing the following errors: 10-26 23:11:09.464: E/AndroidRuntime(2826): FATAL EXCEPTION: main 10-26 23:11:09.464: E/AndroidRuntime(2826): java.lang.RuntimeException: Error receiving broadcast Intent { act=android.intent.action.GetMusicComplete flg=0x10 } in com.Nmidia.AMC.MusicActivity$18@414c5770 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.app.LoadedApk$ReceiverDispatcher$Args.run(LoadedApk.java:765) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.os.Handler.handleCallback(Handler.java:615) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.os.Handler.dispatchMessage(Handler.java:92) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.os.Looper.loop(Looper.java:137) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.app.ActivityThread.main(ActivityThread.java:4745) 10-26 23:11:09.464: E/AndroidRuntime(2826): at java.lang.reflect.Method.invokeNative(Native Method) 10-26 23:11:09.464: E/AndroidRuntime(2826): at java.lang.reflect.Method.invoke(Method.java:511) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:786) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:553) 10-26 23:11:09.464: E/AndroidRuntime(2826): at dalvik.system.NativeStart.main(Native Method) 10-26 23:11:09.464: E/AndroidRuntime(2826): Caused by: java.lang.NullPointerException 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.widget.SimpleAdapter.getCount(SimpleAdapter.java:93) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.widget.ListView.setAdapter(ListView.java:460) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.Nmidia.AMC.MusicActivity.setFilterMusic(MusicActivity.java:1230) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.Nmidia.AMC.MusicActivity$18.onReceive(MusicActivity.java:996) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.app.LoadedApk$ReceiverDispatcher$Args.run(LoadedApk.java:755) 10-26 23:11:09.464: E/AndroidRuntime(2826): ... 9 more

    Read the article

  • How can I use curl to login multiple users from one php script

    - by kamal
    Here is the scenario: I have configured multiple users with login names aa1, aa2 .. zz99 , all with the same password, now i want to login to a php based server with these login ID's. I have a working script that logs in one user with a username and password, and using curl, browses to a target page: // Assume php , since somehow the php encapsulation quotes were giving me trouble $sHost = $argv[2]; $sStart = $argv[3]; $sReqId = $argv[4]; $sPage = $argv[5]; $sReqLogFile = $argv[6]; $sRespLogFile = $argv[7]; $sUserName = $argv[8]; $sPassword = $argv[9]; $sExecDelay = $argv[10]; //optional args: if($argc 11) { $sCommonSID = $argv[11]; } //$sXhprofLogFile = ""; $sSysStatsLogFile= ""; $sBaseUrl = 'https://'.$sHost.'/'; $nExecTime = 0; $sCookieFileName = 'cookiejar/'.genRandomString().'.txt'; touch($sCookieFileName); // Set the execution delay: $sStart += $sExecDelay; // Get the PHP Session Id: if(isset($sCommonSID)) { $sSID = $sCommonSID; }else{ $sSID = getSID($sHost,$sBaseUrl, $sUserName, $sPassword); } // Sleep for 100us intervals until we reach the stated execution time: do { usleep(100); }while(getFullMicrotime()$sPage, "pageUrl"=$sBaseUrl, "execStart" =$nExecStart, "execEnd"=$nExecEnd, "respTime"=$nExecTime, "xhprofToken"=$sXhpToken, "xhprofLink"=$sXhpLink, "fiveMinLoad"=$nFiveMinLoad); }else{ $nExecStart = 0; $sUrl = "***ERROR***"; $aReturn = null; } writeReqLog($sReqId, $nExecStart, $sSID, $sUrl, $sReqLogFile); return $aReturn; } function getFullMicrotime() { $fMtime = microtime(true); if(strpos($fMtime, ' ') !== false) { list($nUsec, $nSec) = explode(' ', $fMtime); return $nSec + $nUsec; } return $fMtime; } function writeRespLog($nReqId, $sHost, $sPage, $sSID = "***ERROR***", $nExecStart = 0, $nExecEnd = 0, $nRespTime = 0, $sXhpToken = "", $sXhpLink = "", $nFiveMinLoad = 0, $sRespLogFile) { $sMsg = $nReqId; $sMsg .= "\t".$sHost; $sMsg .= "/".$sPage; $sMsg .= "\t".$sSID; $sMsg .= "\t".$nExecStart; $sMsg .= "\t".$nExecEnd; $sMsg .= "\t".$nRespTime; $sMsg .= "\t".$sXhpToken; $sMsg .= "\t".$nFiveMinLoad; error_log($sMsg."\n",3,$sRespLogFile); } function writeReqLog($nReqId, $nExecStart, $sSID, $sUrl, $sReqLogFile) { $sMsg = $nReqId; $sMsg .= "\t".$sUrl; $sMsg .= "\t".$sSID; $sMsg .= "\t".$nExecStart; error_log($sMsg."\n",3,$sReqLogFile); } function parseSIDValue($sText) { $sSID = ""; preg_match('/SID:(.*)/',$sText, $aSID); if (count($aSID)) { $sSID = $aSID[1]; } return $sSID; } function parseFiveMinLoad($sText) { $nLoad = 0; $aMatch = array(); preg_match('/--5-MIN-LOAD:(.*)--/',$sText, $aMatch); if (count($aMatch)) { $nLoad = $aMatch[1]; } return $nLoad; } function curlRequest($sUrl, $sSID="") { global $sCookieFileName; $ch = curl_init(); curl_setopt($ch, CURLOPT_URL, $sUrl); curl_setopt($ch, CURLOPT_SSL_VERIFYPEER, FALSE); curl_setopt($ch, CURLOPT_SSL_VERIFYHOST, 2); curl_setopt($ch, CURLOPT_HEADER, 1); curl_setopt($ch, CURLOPT_USERAGENT, "Mozilla/4.0 (compatible; MSIE 6.0; Windows NT 5.0)"); curl_setopt($ch, CURLOPT_RETURNTRANSFER,1); if($sSID == "") { curl_setopt($ch, CURLOPT_COOKIEJAR, $sCookieFileName); } else { curl_setopt($ch, CURLOPT_COOKIEFILE, $sCookieFileName); } $result =curl_exec ($ch); curl_close ($ch); return $result; } function parseXHProfToken($sPageContent) { //https://ktest.server.net/xhprof/xhprof_html/index.php?run=4d004b280a990&source=mybox $sToken = ""; $sRelLink = ""; $aMatch = array(); $aResp = array(); preg_match('/$sToken, "relLink"=$sRelLink); return $aResp; } function genRandomString() { $length = 10; $characters = '0123456789abcdefghijklmnopqrstuvwxyz'; $string = ''; for ($p = 0; $p

    Read the article

< Previous Page | 248 249 250 251 252 253 254 255 256 257 258 259  | Next Page >