Search Results

Search found 6376 results on 256 pages for 'stream wrapper'.

Page 252/256 | < Previous Page | 248 249 250 251 252 253 254 255 256  | Next Page >

  • How to create a SOAP REQUEST using ASP.NET (VB) without using Visual

    - by user311691
    Hi all , I urgently need your help . I am new to consuming a web service using SOAP protocol. I have been given a demo webservice URL which ends in .WSDL and NOT .asml?WSDL. The problem is I cannot add a web reference using Visual studio OR Disco.exe or Wsdl.exe - This webservice has been created on a java platform and for security reasons the only way to make a invoke the webservice is at runtime using SOAP protocol IN asp.net (VB). I I have created some code but cannot seem to send the soap object to the receiving web service. If I could get a solution with step by step instructions on how I can send a SOAP REQUEST. Below is my code and all am trying to do is send a SOAP REQUEST and receive a SOAP RESPONSE which I will display in my browser. <%@ page language="vb" %> <%@ Import Namespace="System.Data"%> <%@ Import Namespace="System.Xml"%> <%@ Import Namespace="System.Net"%> <%@ Import Namespace="System.IO"%> <%@ Import Namespace="System.Text"%> <script runat=server> Private Sub Page_Load() Dim objHTTPReq As HttpWebRequest Dim WebserviceUrl As String = "http://xx.xx.xx:8084/asy/wsdl/asy.wsdl" objHTTPReq = CType(WebRequest.Create(WebserviceUrl), HttpWebRequest) Dim soapXML As String soapXML = "<?xml version='1.0' encoding='utf-8'?>" & _ " <soap:Envelope xmlns:xsi='http://www.w3.org/2001/XMLSchema-instance'" & _ " xmlns:xsd='http://www.w3.org/2001/XMLSchema'"& _ " xmlns:soap='http://schemas.xmlsoap.org/soap/envelope/' >"& _ " <soap:Body> "& _ " <validatePaymentData xmlns='http://asybanks.webservices.asycuda.org'> " & _ " <bankCode>"& bankCode &"</bankCode> " & _ " <PaymentDataType>" & _ " <paymentType>"& payment_type &"</paymentType> " & _ " <amount>"& ass_amount &"</amount> " & _ " <ReferenceType>" & _ " <year>"& year &"</year> " & _ " <customsOfficeCode>"& station &"</customsOfficeCode> " & _ " </ReferenceType>" & _ " <accountNumber>"& zra_account &"</accountNumber> " & _ " </PaymentDataType> " & _ " </validatePaymentData> " & _ " </soap:Body> " & _ " </soap:Envelope> " objHTTPReq.Headers.Add("SOAPAction", "http://asybanks.webservices.asycuda.org") objHTTPReq.ContentType = "text/xml; charset=utf-8" objHTTPReq.ContentLength = soapXML.Length objHTTPReq.Accept = "text/xml" objHTTPReq.Method = "POST" Dim objHTTPRes As HttpWebResponse = CType(objHTTPReq.GetResponse(), HttpWebResponse) Dim dataStream As Stream = objHTTPRes.GetResponseStream() Dim reader As StreamReader = new StreamReader(dataStream) Dim responseFromServer As String = reader.ReadToEnd() OurXml.text = responseFromServer End Sub </script> <html xmlns="http://www.w3.org/1999/xhtml"> <head runat="server"> <title> XML TRANSACTION SIMULATION - N@W@ TJ </title> </head> <body> <form id="form1" runat="server"> <div> <p>ZRA test Feedback:</p> <asp:label id="OurXml" runat="server"/> </div> </form> </body> </html> the demo webservice looks like this: <?xml version="1.0" encoding="UTF-8" ?> - <!-- WEB SERVICE JAVA DEMO --> - <definitions targetNamespace="http://asybanks.webservices.asycuda.org" xmlns="http://schemas.xmlsoap.org/wsdl/" xmlns:apachesoap="http://xml.apache.org/xml-soap" xmlns:soap="http://schemas.xmlsoap.org/wsdl/soap/" xmlns:xs="http://www.w3.org/2001/XMLSchema" xmlns:y="http://asybanks.webservices.asycuda.org"> - <types> - <xs:schema elementFormDefault="qualified" targetNamespace="http://asybanks.webservices.asycuda.org" xmlns="http://www.w3.org/2001/XMLSchema"> SOME OTHER INFORMATION AT THE BOTTOM <soap:address location="http://xx.xx.xx:8084/asy/services/asy" /> </port> </service> </definitions> From the above excerpt of the wsdl url webservice, I am not sure which namespace to use for soapACTION - please advise.... Please if you could comment every stage of a soap request and provide a working demo - I would be most grateful as I would be learning rather than just assuming stuff :)

    Read the article

  • Multiple schema validation in Java

    - by user279554
    Hi, I am trying to do multiple schema validation in Java. I don't understand where I am doing wrong. Any help will be appreciated. abc.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:xn="project-xml-r4j_another.xsd"> <xsd:import namespace="project-xml-r4j_another.xsd"/> <xsd:element name="abc" type="abc"> </xsd:element> <xsd:complexType name="abc"> <xsd:sequence> <xsd:element name="test" type="test" minOccurs="0" maxOccurs="1"> </xsd:element> <!--<xsd:element name="proj" type="xn:proj"/>--> </xsd:sequence> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> <xsd:complexType name="test"> <xsd:attribute name="id" type="xsd:ID" use="required"></xsd:attribute> <xsd:attribute name="value" use="required"> <xsd:simpleType> <xsd:restriction base="xsd:string"> <xsd:maxLength value="100" /> </xsd:restriction> </xsd:simpleType> </xsd:attribute> </xsd:complexType> </xsd:schema> project-xml-r4j_another.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" targetNamespace="project-xml-r4j_another.xsd" xmlns="project-xml-r4j_another.xsd" elementFormDefault="qualified" attributeFormDefault="unqualified"> <xsd:element name="proj" type="proj"> <xsd:annotation> <xsd:documentation> The project is the root tag of a project-xml. </xsd:documentation> </xsd:annotation> </xsd:element> <xsd:complexType name="proj"> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> </xsd:schema> Test case package test; import java.io.File; import java.io.IOException; import javax.xml.XMLConstants; import javax.xml.transform.Source; import javax.xml.transform.stream.StreamSource; import javax.xml.validation.Schema; import javax.xml.validation.SchemaFactory; import javax.xml.validation.Validator; import org.apache.log4j.Logger; import org.junit.Test; import org.xml.sax.SAXException; import org.xml.sax.SAXParseException; import org.xml.sax.helpers.DefaultHandler; import com.ericsson.ccrtool.core.project.projectxml.InvalidProjectXmlException; public class TestSchema { private static final Logger logger = Logger.getLogger(TestSchema.class); static final String W3C_XML_SCHEMA = XMLConstants.W3C_XML_SCHEMA_NS_URI; @Test public void test() { System.out.println("TestSchema.test()"); try { SchemaFactory schemaFactory = SchemaFactory.newInstance(W3C_XML_SCHEMA); // create a grammar object. Source [] source = { new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\abc.xsd")), new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\project-xml-r4j.xsd"))}; Schema schemaGrammar = schemaFactory.newSchema(source); Validator schemaValidator = schemaGrammar.newValidator(); schemaValidator.setErrorHandler(new MessageHandler()); // validate xml instance against the grammar. schemaValidator.validate(new StreamSource("C:\\jaydeep\\Ericsson\\R5B\\project_tmmk17cells_xnaveen_project-xml.xml")); } catch (SAXException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } catch (IOException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } } class MessageHandler extends DefaultHandler { private String errMessage = ""; @Override public void warning(SAXParseException e) { logger.info("Warning Line " + e.getLineNumber() + ": " + e.getMessage()); } @Override public void error(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } @Override public void fatalError(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } } } Thanks, Jaydeep

    Read the article

  • Dealing with external processes

    - by Jesse Aldridge
    I've been working on a gui app that needs to manage external processes. Working with external processes leads to a lot of issues that can make a programmer's life difficult. I feel like maintenence on this app is taking an unacceptably long time. I've been trying to list the things that make working with external processes difficult so that I can come up with ways of mitigating the pain. This kind of turned into a rant which I thought I'd post here in order to get some feedback and to provide some guidance to anybody thinking about sailing into these very murky waters. Here's what I've got so far: Output from the child can get mixed up with output from the parent. This can make both outputs misleading and hard to read. It can be hard to tell what came from where. It becomes harder to figure out what's going on when things are asynchronous. Here's a contrived example: import textwrap, os, time from subprocess import Popen test_path = 'test_file.py' with open(test_path, 'w') as file: file.write(textwrap.dedent(''' import time for i in range(3): print 'Hello %i' % i time.sleep(1)''')) proc = Popen('python -B "%s"' % test_path) for i in range(3): print 'Hello %i' % i time.sleep(1) os.remove(test_path) I guess I could have the child process write its output to a file. But it can be annoying to have to open up a file every time I want to see the result of a print statement. If I have code for the child process I could add a label, something like print 'child: Hello %i', but it can be annoying to do that for every print. And it adds some noise to the output. And of course I can't do it if I don't have access to the code. I could manually manage the process output. But then you open up a huge can of worms with threads and polling and stuff like that. A simple solution is to treat processes like synchronous functions, that is, no further code executes until the process completes. In other words, make the process block. But that doesn't work if you're building a gui app. Which brings me to the next problem... Blocking processes cause the gui to become unresponsive. import textwrap, sys, os from subprocess import Popen from PyQt4.QtGui import * from PyQt4.QtCore import * test_path = 'test_file.py' with open(test_path, 'w') as file: file.write(textwrap.dedent(''' import time for i in range(3): print 'Hello %i' % i time.sleep(1)''')) app = QApplication(sys.argv) button = QPushButton('Launch process') def launch_proc(): # Can't move the window until process completes proc = Popen('python -B "%s"' % test_path) proc.communicate() button.connect(button, SIGNAL('clicked()'), launch_proc) button.show() app.exec_() os.remove(test_path) Qt provides a process wrapper of its own called QProcess which can help with this. You can connect functions to signals to capture output relatively easily. This is what I'm currently using. But I'm finding that all these signals behave suspiciously like goto statements and can lead to spaghetti code. I think I want to get sort-of blocking behavior by having the 'finished' signal from QProcess call a function containing all the code that comes after the process call. I think that should work but I'm still a bit fuzzy on the details... Stack traces get interrupted when you go from the child process back to the parent process. If a normal function screws up, you get a nice complete stack trace with filenames and line numbers. If a subprocess screws up, you'll be lucky if you get any output at all. You end up having to do a lot more detective work everytime something goes wrong. Speaking of which, output has a way of disappearing when dealing external processes. Like if you run something via the windows 'cmd' command, the console will pop up, execute the code, and then disappear before you have a chance to see the output. You have to pass the /k flag to make it stick around. Similar issues seem to crop up all the time. I suppose both problems 3 and 4 have the same root cause: no exception handling. Exception handling is meant to be used with functions, it doesn't work with processes. Maybe there's some way to get something like exception handling for processes? I guess that's what stderr is for? But dealing with two different streams can be annoying in itself. Maybe I should look into this more... Processes can hang and stick around in the background without you realizing it. So you end up yelling at your computer cuz it's going so slow until you finally bring up your task manager and see 30 instances of the same process hanging out in the background. Also, hanging background processes can interefere with other instances of the process in various fun ways, such as causing permissions errors by holding a handle to a file or someting like that. It seems like an easy solution to this would be to have the parent process kill the child process on exit if the child process didn't close itself. But if the parent process crashes, cleanup code might not get called and the child can be left hanging. Also, if the parent waits for the child to complete, and the child is in an infinite loop or something, you can end up with two hanging processes. This problem can tie in to problem 2 for extra fun, causing your gui to stop responding entirely and force you to kill everything with the task manager. F***ing quotes Parameters often need to be passed to processes. This is a headache in itself. Especially if you're dealing with file paths. Say... 'C:/My Documents/whatever/'. If you don't have quotes, the string will often be split at the space and interpreted as two arguments. If you need nested quotes you can use ' and ". But if you need to use more than two layers of quotes, you have to do some nasty escaping, for example: "cmd /k 'python \'path 1\' \'path 2\''". A good solution to this problem is passing parameters as a list rather than as a single string. Subprocess allows you to do this. Can't easily return data from a subprocess. You can use stdout of course. But what if you want to throw a print in there for debugging purposes? That's gonna screw up the parent if it's expecting output formatted a certain way. In functions you can print one string and return another and everything works just fine. Obscure command-line flags and a crappy terminal based help system. These are problems I often run into when using os level apps. Like the /k flag I mentioned, for holding a cmd window open, who's idea was that? Unix apps don't tend to be much friendlier in this regard. Hopefully you can use google or StackOverflow to find the answer you need. But if not, you've got a lot of boring reading and frusterating trial and error to do. External factors. This one's kind of fuzzy. But when you leave the relatively sheltered harbor of your own scripts to deal with external processes you find yourself having to deal with the "outside world" to a much greater extent. And that's a scary place. All sorts of things can go wrong. Just to give a random example: the cwd in which a process is run can modify it's behavior. There are probably other issues, but those are the ones I've written down so far. Any other snags you'd like to add? Any suggestions for dealing with these problems?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • C++ simple logging class with UTF-8 output [code example]

    - by Andrew
    Hello everyone, I was working on one of my academic projects and for the first time I needed pure C++ without GUI. After googling for a while, I did not find any simple and easy to use implementation for logging and created my own. This is a simple implementation with iostreams that logs messages to screen and to the file simultaneously. I was thinking of using templates but then I realized that I do not expect any changes and removed that. It is modified std::wostream with two added modifiers: 1. TimeStamp - prints time-stamp 2. LogMode(LogModes) - switches output: file only, screen only, file+screen. *Boost::utf8_codecvt_facet* is used for UTF-8 output. // ############################################################################ // # Name: MyLog.h # // # Purpose: Logging Class Header # // # Author: Andrew Drach # // # Modified by: <somebody> # // # Created: 03/21/10 # // # SVN-ID: $Id$ # // # Copyright: (c) 2010 Andrew Drach # // # Licence: <license> # // ############################################################################ #ifndef INCLUDED_MYLOG_H #define INCLUDED_MYLOG_H // headers -------------------------------------------------------------------- #include <string> #include <iostream> #include <fstream> #include <exception> #include <boost/program_options/detail/utf8_codecvt_facet.hpp> using namespace std; // definitions ---------------------------------------------------------------- // ---------------------------------------------------------------------------- // DblBuf class // Splits up output stream into two // Inspired by http://wordaligned.org/articles/cpp-streambufs // ---------------------------------------------------------------------------- class DblBuf : public wstreambuf { private: // private member declarations DblBuf(); wstreambuf *bf1; wstreambuf *bf2; virtual int_type overflow(int_type ch) { int_type eof = traits_type::eof(); int_type not_eof = !eof; if ( traits_type::eq_int_type(ch,eof) ) return not_eof; else { char_type ch1 = traits_type::to_char_type(ch); int_type r1( bf1on ? bf1->sputc(ch1) : not_eof ); int_type r2( bf2on ? bf2->sputc(ch1) : not_eof ); return (traits_type::eq_int_type(r1,eof) || traits_type::eq_int_type(r2,eof) ) ? eof : ch; } } virtual int sync() { int r1( bf1on ? bf1->pubsync() : NULL ); int r2( bf2on ? bf2->pubsync() : NULL ); return (r1 == 0 && r2 == 0) ? 0 : -1; } public: // public member declarations explicit DblBuf(wstreambuf *bf1, wstreambuf *bf2) : bf1(bf1), bf2(bf2) { if (bf1) bf1on = true; else bf1on = false; if (bf2) bf2on = true; else bf2on = false; } bool bf1on; bool bf2on; }; // ---------------------------------------------------------------------------- // logstream class // Wrapper for a standard wostream with access to modified buffer // ---------------------------------------------------------------------------- class logstream : public wostream { private: // private member declarations logstream(); public: // public member declarations DblBuf *buf; explicit logstream(wstreambuf *StrBuf, bool isStd = false) : wostream(StrBuf, isStd), buf((DblBuf*)StrBuf) {} }; // ---------------------------------------------------------------------------- // Logging mode Class // ---------------------------------------------------------------------------- enum LogModes{LogToFile=1, LogToScreen, LogToBoth}; class LogMode { private: // private member declarations LogMode(); short mode; public: // public member declarations LogMode(short mode1) : mode(mode1) {} logstream& operator()(logstream &stream1) { switch(mode) { case LogToFile: stream1.buf->bf1on = true; stream1.buf->bf2on = false; break; case LogToScreen: stream1.buf->bf1on = false; stream1.buf->bf2on = true; break; case LogToBoth: stream1.buf->bf1on = true; stream1.buf->bf2on = true; } return stream1; } }; logstream& operator<<(logstream &out, LogMode mode) { return mode(out); } wostream& TimeStamp1(wostream &out1) { time_t time1; struct tm timeinfo; wchar_t timestr[512]; // Get current time and convert it to a string time(&time1); localtime_s (&timeinfo, &time1); wcsftime(timestr, 512,L"[%Y-%b-%d %H:%M:%S %p] ",&timeinfo); return out1 << timestr; } // ---------------------------------------------------------------------------- // MyLog class // Logs events to both file and screen // ---------------------------------------------------------------------------- class MyLog { private: // private member declarations MyLog(); auto_ptr<DblBuf> buf; string mErrorMsg1; string mErrorMsg2; string mErrorMsg3; string mErrorMsg4; public: // public member declarations explicit MyLog(string FileName1, wostream *ScrLog1, locale utf8locale1); ~MyLog(); void NewEvent(wstring str1, bool TimeStamp = true); string FileName; wostream *ScrLog; wofstream File; auto_ptr<logstream> Log; locale utf8locale; }; // ---------------------------------------------------------------------------- // MyLog constructor // ---------------------------------------------------------------------------- MyLog::MyLog(string FileName1, wostream *ScrLog1, locale utf8locale1) : // ctors mErrorMsg1("Failed to open file for application logging! []"), mErrorMsg2("Failed to write BOM! []"), mErrorMsg3("Failed to write to file! []"), mErrorMsg4("Failed to close file! []"), FileName(FileName1), ScrLog(ScrLog1), utf8locale(utf8locale1), File(FileName1.c_str()) { // Adjust error strings mErrorMsg1.insert(mErrorMsg1.length()-1,FileName1); mErrorMsg2.insert(mErrorMsg2.length()-1,FileName1); mErrorMsg3.insert(mErrorMsg3.length()-1,FileName1); mErrorMsg4.insert(mErrorMsg4.length()-1,FileName1); // check for file open errors if ( !File ) throw ofstream::failure(mErrorMsg1); // write UTF-8 BOM File << wchar_t(0xEF) << wchar_t(0xBB) << wchar_t(0xBF); // switch locale to UTF-8 File.imbue(utf8locale); // check for write errors if ( File.bad() ) throw ofstream::failure(mErrorMsg2); buf.reset( new DblBuf(File.rdbuf(),ScrLog->rdbuf()) ); Log.reset( new logstream(&*buf) ); } // ---------------------------------------------------------------------------- // MyLog destructor // ---------------------------------------------------------------------------- MyLog::~MyLog() { *Log << TimeStamp1 << "Log finished." << endl; // clean up objects Log.reset(); buf.reset(); File.close(); // check for file close errors if ( File.bad() ) throw ofstream::failure(mErrorMsg4); } //--------------------------------------------------------------------------- #endif // INCLUDED_MYLOG_H Tested on MSVC 2008, boost 1.42. I do not know if this is the right place to share it. Hope it helps anybody. Feel free to make it better.

    Read the article

  • XML over HTTP with JMS and Spring

    - by Will Sumekar
    I have a legacy HTTP server where I need to send an XML file over HTTP request (POST) using Java (not browser) and the server will respond with another XML in its HTTP response. It is similar to Web Service but there's no WSDL and I have to follow the existing XML structure to construct my XML to be sent. I have done a research and found an example that matches my requirement here. The example uses HttpClient from Apache Commons. (There are also other examples I found but they use java.net networking package (like URLConnection) which is tedious so I don't want to use them). But it's also my requirement to use Spring and JMS. I know from Spring's reference that it's possible to combine HttpClient, JMS and Spring. My question is, how? Note that it's NOT in my requirement to use HttpClient. If you have a better suggestion, I'm welcome. Appreciate it. For your reference, here's the XML-over-HTTP example I've been talking about: /* * $Header: * $Revision$ * $Date$ * ==================================================================== * * Copyright 2002-2004 The Apache Software Foundation * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. * You may obtain a copy of the License at * * http://www.apache.org/licenses/LICENSE-2.0 * * Unless required by applicable law or agreed to in writing, software * distributed under the License is distributed on an "AS IS" BASIS, * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. * See the License for the specific language governing permissions and * limitations under the License. * ==================================================================== * * This software consists of voluntary contributions made by many * individuals on behalf of the Apache Software Foundation. For more * information on the Apache Software Foundation, please see * <http://www.apache.org/>. * * [Additional notices, if required by prior licensing conditions] * */ import java.io.File; import java.io.FileInputStream; import org.apache.commons.httpclient.HttpClient; import org.apache.commons.httpclient.methods.InputStreamRequestEntity; import org.apache.commons.httpclient.methods.PostMethod; /** * * This is a sample application that demonstrates * how to use the Jakarta HttpClient API. * * This application sends an XML document * to a remote web server using HTTP POST * * @author Sean C. Sullivan * @author Ortwin Glück * @author Oleg Kalnichevski */ public class PostXML { /** * * Usage: * java PostXML http://mywebserver:80/ c:\foo.xml * * @param args command line arguments * Argument 0 is a URL to a web server * Argument 1 is a local filename * */ public static void main(String[] args) throws Exception { if (args.length != 2) { System.out.println( "Usage: java -classpath <classpath> [-Dorg.apache.commons."+ "logging.simplelog.defaultlog=<loglevel>]" + " PostXML <url> <filename>]"); System.out.println("<classpath> - must contain the "+ "commons-httpclient.jar and commons-logging.jar"); System.out.println("<loglevel> - one of error, "+ "warn, info, debug, trace"); System.out.println("<url> - the URL to post the file to"); System.out.println("<filename> - file to post to the URL"); System.out.println(); System.exit(1); } // Get target URL String strURL = args[0]; // Get file to be posted String strXMLFilename = args[1]; File input = new File(strXMLFilename); // Prepare HTTP post PostMethod post = new PostMethod(strURL); // Request content will be retrieved directly // from the input stream // Per default, the request content needs to be buffered // in order to determine its length. // Request body buffering can be avoided when // content length is explicitly specified post.setRequestEntity(new InputStreamRequestEntity( new FileInputStream(input), input.length())); // Specify content type and encoding // If content encoding is not explicitly specified // ISO-8859-1 is assumed post.setRequestHeader( "Content-type", "text/xml; charset=ISO-8859-1"); // Get HTTP client HttpClient httpclient = new HttpClient(); // Execute request try { int result = httpclient.executeMethod(post); // Display status code System.out.println("Response status code: " + result); // Display response System.out.println("Response body: "); System.out.println(post.getResponseBodyAsString()); } finally { // Release current connection to the connection pool // once you are done post.releaseConnection(); } } }

    Read the article

  • ASp.Net Mvc 1.0 Dynamic Images Returned from Controller taking 154 seconds+ to display in IE8, firef

    - by julian guppy
    I have a curious problem with IE, IIS 6.0 dynamic PNG files and I am baffled as to how to fix.. Snippet from Helper (this returns the URL to the view for requesting the images from my Controller. string url = LinkBuilder.BuildUrlFromExpression(helper.ViewContext.RequestContext, helper.RouteCollection, c = c.FixHeight(ir.Filename, ir.AltText, "FFFFFF")); url = url.Replace("&", "&"); sb.Append(string.Format("<removed id=\"TheImage\" src=\"{0}\" alt=\"\" /", url)+Environment.NewLine); This produces a piece of html as follows:- img id="TheImage" src="/ImgText/FixHeight?sFile=Images%2FUser%2FJulianGuppy%2FMediums%2Fconservatory.jpg&backgroundColour=FFFFFF" alt="" / brackets missing because i cant post an image... even though I dont want to post an image I jsut want to post the markup... sigh Snippet from Controller ImgTextController /// <summary> /// This function fixes the height of the image /// </summary> /// <param name="sFile"></param> /// <param name="alternateText"></param> /// <param name="backgroundColour"></param> /// <returns></returns> [AcceptVerbs(HttpVerbs.Get)] public ActionResult FixHeight(string sFile, string alternateText, string backgroundColour) { #region File if (string.IsNullOrEmpty(sFile)) { return new ImgTextResult(); } // MVC specific change to prepend the new directory if (sFile.IndexOf("Content") == -1) { sFile = "~/Content/" + sFile; } // open the file System.Drawing.Image img; try { img = System.Drawing.Image.FromFile(Server.MapPath(sFile)); } catch { img = null; } // did we fail? if (img == null) { return new ImgTextResult(); } #endregion File #region Width // Sort out the width from the image passed to me Int32 nWidth = img.Width; #endregion Width #region Height Int32 nHeight = img.Height; #endregion Height // What is the ideal height given a width of 2100 this should be 1400. var nIdealHeight = (int)(nWidth / 1.40920096852); // So is the actual height of the image already greater than the ideal height? Int32 nSplit; if (nIdealHeight < nHeight) { // Yes, do nothing, well i need to return the iamge... nSplit = 0; } else { // rob wants to not show the white at the top or bottom, so if we were to crop the image how would be do it // 1. Calculate what the width should be If we dont adjust the heigt var newIdealWidth = (int)(nHeight * 1.40920096852); // 2. This newIdealWidth should be smaller than the existing width... so work out the split on that Int32 newSplit = (nWidth - newIdealWidth) / 2; // 3. Now recrop the image using 0-nHeight as the height (i.e. full height) // but crop the sides so that its the correct aspect ration var newRect = new Rectangle(newSplit, 0, newIdealWidth, nHeight); img = CropImage(img, newRect); nHeight = img.Height; nWidth = img.Width; nSplit = 0; } // No, so I want to place this image on a larger canvas and we do this by Creating a new image to be the size that we want System.Drawing.Image canvas = new Bitmap(nWidth, nIdealHeight, PixelFormat.Format24bppRgb); Graphics g = Graphics.FromImage(canvas); #region Color // Whilst we can set the background colour we shall default to white if (string.IsNullOrEmpty(backgroundColour)) { backgroundColour = "FFFFFF"; } Color bc = ColorTranslator.FromHtml("#" + backgroundColour); #endregion Color // Filling the background (which gives us our broder) Brush backgroundBrush = new SolidBrush(bc); g.FillRectangle(backgroundBrush, -1, -1, nWidth + 1, nIdealHeight + 1); // draw the image at the position var rect = new Rectangle(0, nSplit, nWidth, nHeight); g.DrawImage(img, rect); return new ImgTextResult { Image = canvas, ImageFormat = ImageFormat.Png }; } My ImgTextResult is a class that returns an Action result for me but embedding the image from a memory stream into the response.outputstream. snippet from my ImageResults /// <summary> /// Execute the result /// </summary> /// <param name="context"></param> public override void ExecuteResult(ControllerContext context) { // output context.HttpContext.Response.Clear(); context.HttpContext.Response.ContentType = "image/png"; try { var memStream = new MemoryStream(); Image.Save(memStream, ImageFormat.Png); context.HttpContext.Response.BinaryWrite(memStream.ToArray()); context.HttpContext.Response.Flush(); context.HttpContext.Response.Close(); memStream.Dispose(); Image.Dispose(); } catch (Exception ex) { string a = ex.Message; } } Now all of this works locally and lovely, and indeed all of this works on my production server BUT Only for Firefox, Safari, Chrome (and other browsers) IE has a fit and decides that it either wont display the image or it does display the image after approx 154seconds of waiting..... I have made sure my HTML is XHTML compliant, I have made sure I am getting no Routing errors or crashes in my event log on the server.... Now obviously I have been a muppet and have done something wrong... but what I cant fathom is why in development all works fine, and in production all non IE browsers also work fine, but IE 8 using IIS 6.0 production server is having some kind of problem in returning this PNG and I dont have an error to trace... so what I am looking for is guidance as to how I can debug this problem.

    Read the article

  • JSON object array to store data of a form in local storage temporary (PhoneGap project)

    - by Nadeesha
    I am building a data aqusition system using PhoneGap. .I am trying to store my form data temporary on local storage using JSON,Data should be visible after I close and reopen the application (after pressing Get Data button),But after I close it only the lastly entered record is visible This is my code <!DOCTYPE html> <html> <head> <title>Household Profile DB storage</title> <meta charset="utf-8"> <meta name="viewport" content="user-scalable=no, initial-scale=1, maximum-scale=1, minimum-scale=1,width=device-width" /> <link rel="stylesheet" href="jquery.mobile-1.4.2/jquery.mobile-1.4.2.min.css"> <link rel="stylesheet" href="css/table.css"> <script type="text/javascript" src="js/jquery-1.9.1.min.js"></script> <script type="text/javascript" src="jquery.mobile-1.4.2/jquery.mobile-1.4.2.min.js"></script> <script type="text/javascript" src="js/iscroll.js"></script> <script type="text/javascript" charset="utf-8"> function onDeviceReady() { persistData(homeId,owner,gramaND,contactNo,address,race); } function saveLocal(form){ if (window.localStorage) { var fhomeId = form.homeId.value, fowner = form.owner.value, fgramaND = form.gramaND.value, fcontactNo= form.contactNo.value, faddress = form.address.value, frace = form.race.value; alert("hi"); var highscores = [{"homeId": fhomeId, "owner":fowner, "gramaND":fgramaND, "contactNo":fcontactNo, "address":faddress, "race":frace}]; localStorage.setItem("highscores",JSON.stringify(highscores)); alert("The data has been stored successfully."); } else { alert("Your Browser does not support LocalStorage."); } } function readLocal(){ if (window.localStorage) { var scores =[]; //Get the highscores object scores = localStorage.getItem("highscores"); scores = JSON.parse(scores); for (i=0;i<scores.length;i++){ var text = "homeId :"+scores[i].homeId +"<br>"+ "owner:"+ scores[i].owner+"<br>"+ "address"+scores[i].address +"<br>"+ "gramaND"+scores[i].gramaND +"<br>"+ "contactNo"+scores[i].contactNo+"<br>" + '<Button value="DELETE" onclick="'+scores.splice(i, 0)+'><>/Button>'; var tbodyx = document.getElementsByTagName("tbody"); var tr=document.createElement("TR"); var td=document.createElement("TD"); td.innerHTML = text; tr.appendChild(td); tbody.appendChild(tr); } } } </script> </head> <body> <div data-role="page" id="page1"> <!--/header--> <div data-role="header" data-position="inline" data-theme="b"> <a href="#" data-icon="back" data-rel="back" title="Go back">Back</a> <h1>Household Profile</h1> <a href="index.html" data-icon="home">Menu</a> </div> <!--/header--> <div id="wrapper"> <form id="userInput" action ="" method="GET"> <div data-role="content"> <div data-role="fieldcontain"> <label > Home ID </label> <input class="inputClass" id="homeId" placeholder="H0001" value="" data-mini="true" type="text"> </div> <div data-role="fieldcontain"> <label > Owner </label> <input class="inputClass" id="owner" placeholder="Aberathne" value="" type="text"> </div> <div data-role="fieldcontain"> <label class="select">GramaNiladhari Division</label> <select class="inputClass" id="gramaND"> <option value="GramaNiladhari Division 1">GramaNiladhari Division 1</option> <option value="GramaNiladhari Division 2">GramaNiladhari Division 2</option> <option value="GramaNiladhari Division 3">GramaNiladhari Division 3</option> <option value="GramaNiladhari Division 4">GramaNiladhari Division 4</option> </select> </div> <div data-role="fieldcontain"> <label > Contact No </label> <input class="inputClass" id="contactNo" placeholder="071-9545-073" value="" type="number"> </div> <div data-role="fieldcontain"> <label >Address:</label> <textarea cols="40" rows="8" class="inputClass" id="address"></textarea> </div> <div class="ui-block-a"><button type="submit" data-theme="d">Location in a Map</button></div> <div data-role="fieldcontain"> <label >Race</label> <select class="inputClass" id="race"> <option value=" Sinhalese"> Sinhalese</option> <option value=" Sri Lanka Tamils"> Sri Lanka Tamils</option> <option value=" Moors"> Moors</option> <option value=" Indian Tamils "> Indian Tamils </option> <option value=" Malays "> Malays </option> <option value=" Burghers "> Burghers </option> </select> </div> <input class="buttonClass" type="button" value="Insert Data" onclick="saveLocal(this.form);"> </div> </form> </div> <input class="buttonClass" type="button" value="get Data" onclick="readLocal();"> <!-- <p id="dhomeId"></p> <p id="downer"></p> <p id="dgramaND"></p> <p id="dcontactNo"></p> <p id="daddress"></p> <p id="drace"></p>--> <table border="1"> <tbody id="tbody"> <tr><td>test1</td></tr> <tr><td>test2</td></tr> </tbody> </table> </div> </body> </html> Also I need to expand my code to edit and delete record from local storage.

    Read the article

  • How do I control the direction of the scroll on my coda slider?

    - by lightingwrist
    Hello, I have a coda slider and am unable to determine the direction of the scroll. I have 3 panels that I want to scroll left to right. Sometimes it scrolls left to right, sometimes up and down, and sometimes horizontally. How do I lock it down to go the direction I want? Here is the HTML: <body> <div id="slider_home" class="round_10px"> <ul class="navigation_home"> <li><a href="#scroll_Parents" class="round_10px">Information For Parents</a></li> <li><a href="#scroll_Materials" class="round_10px">Print Materials</a></li> <li><a href="#scroll_Resources" class="round_10px">Online Resources</a></li> </ul> <div id="scroll_bg_home"> <div class="scroll_home"> <div class="scrollContainer_home"> <div class="panel_home" id="scroll_Parents"> content </div> <div class="panel_home" id="scroll_Materials"> content </div> <div class="panel_home" id="scroll_Resources"> content </div> </div> </div> </div> </div> </body> Here is the CSS: #wrapper {width:550px;margin:0px auto;} #intro {padding-bottom:10px;} h2 {margin:0;margin-bottom:14px;padding:0;} #slider {width:631px;margin:10px auto 0px auto;position:relative;} #scroll_bg{height:360px;width:590px;overflow:hidden;position:relative;clear:left;background:#FFFFFF url(images/) no-repeat; margin:0px auto 0px auto} .scroll{ background:transparent; width:550px; height:370px; padding:0px; margin:0px auto; overflow:hidden; } .scrollContainer div.panel {padding:20px 0px;height:330px; width:550px;margin:0px;float:left;} #shade {background:#EDEDEC url(images/shade.jpg) no-repeat 0 0;height:50px;} ul.navigation {list-style:none;margin:0px 0px 0px 23px;padding:0px;padding-bottom:0px;} ul.navigation li {display:inline; margin-right:5px;} ul.navigation li a { background:#FFFFFF;font-family:Arial, Helvetica, sans-serif; font-size:16px; font-weight:bold; color:#CCCCCC;padding:5px 5px 5px 5px;border:1px #F4F4F4 solid;text-decoration: none;} ul.navigation a:hover { color:#EDEDEC;border:1px #E6E6E6 solid;} ul.navigation a.selected {color:#333333;} ul.navigation a:focus {outline:none;} .scrollButtons {position:absolute;top:150px;cursor:pointer;} .scrollButtons.left {left:-37px;top:20px} .scrollButtons.right {right:-32px;top:20px;} .hide {display:none;} And here is the Jquery includes file: // when the DOM is ready... $(document).ready(function () { var $panels = $('#slider_home .scrollContainer_home > div.panel_home'); var $container = $('#slider_home .scrollContainer_home'); // if true, we'll float all the panels left and fix the width // of the container var horizontal = true; // float the panels left if we're going horizontal if (horizontal) { $panels.css({ 'float' : 'left', 'position' : 'relative' // IE fix to ensure overflow is hidden }); // calculate a new width for the container (so it holds all panels) $container.css('width', $panels[0].offsetWidth * $panels.length); } // collect the scroll object, at the same time apply the hidden overflow // to remove the default scrollbars that will appear var $scroll_bg = $('#scroll_bg_home'); var $scroll = $('#slider_home .scroll_home').css('overflow', 'hidden'); // apply our left + right buttons $scroll_bg .before('<img class="scrollButtons_home left" src="styles/images/BackFlip.jpg" />') .after('<img class="scrollButtons_home right" src="styles/images/flipForward.jpg" />'); // handle nav selection function selectNav() { $(this) .parents('ul:first') .find('a') .removeClass('selected') .end() .end() .addClass('selected'); } $('.navigation_home').find('a').click(selectNav); // go find the navigation link that has this target and select the nav function trigger(data) { var el = $('.navigation_home').find('a[href$="' + data.id + '"]').get(0); selectNav.call(el); } if (window.location.hash) { trigger({ id : window.location.hash.substr(1) }); } else { $('.navigation_home a:first').click(); } // offset is used to move to *exactly* the right place, since I'm using // padding on my example, I need to subtract the amount of padding to // the offset. Try removing this to get a good idea of the effect var offset = parseInt((horizontal ? $container.css('paddingTop') : $container.css('paddingLeft')) || 0) * -1; var scrollOptions = { target: $scroll, // the element that has the overflow // can be a selector which will be relative to the target items: $panels, navigation: '.navigation_home a', // selectors are NOT relative to document, i.e. make sure they're unique prev: 'img.left', next: 'img.right', // allow the scroll effect to run both directions axis: 'xy', onAfter: trigger, // our final callback offset: offset, // duration of the sliding effect duration: 500, // easing - can be used with the easing plugin: // http://gsgd.co.uk/sandbox/jquery/easing/ easing: 'swing' }; // apply serialScroll to the slider - we chose this plugin because it // supports// the indexed next and previous scroll along with hooking // in to our navigation. $('#slider_home').serialScroll(scrollOptions); // now apply localScroll to hook any other arbitrary links to trigger // the effect $.localScroll(scrollOptions); // finally, if the URL has a hash, move the slider in to position, // setting the duration to 1 because I don't want it to scroll in the // very first page load. We don't always need this, but it ensures // the positioning is absolutely spot on when the pages loads. scrollOptions.duration = 1; $.localScroll.hash(scrollOptions); });

    Read the article

  • Saving image from Gallery to db - Coursor IllegalStateException

    - by MyWay
    I want to save to db some strings with image. Image can be taken from gallery or user can set the sample one. In the other activity I have a listview which should present the rows with image and name. I'm facing so long this problem. It occurs when I wanna display listview with the image from gallery, If the sample image is saved in the row everything works ok. My problem is similar to this one: how to save image taken from camera and show it to listview - crashes with "IllegalStateException" but I can't find there the solution for me My table in db looks like this: public static final String KEY_ID = "_id"; public static final String ID_DETAILS = "INTEGER PRIMARY KEY AUTOINCREMENT"; public static final int ID_COLUMN = 0; public static final String KEY_NAME = "name"; public static final String NAME_DETAILS = "TEXT NOT NULL"; public static final int NAME_COLUMN = 1; public static final String KEY_DESCRIPTION = "description"; public static final String DESCRIPTION_DETAILS = "TEXT"; public static final int DESCRIPTION_COLUMN = 2; public static final String KEY_IMAGE ="image" ; public static final String IMAGE_DETAILS = "BLOP"; public static final int IMAGE_COLUMN = 3; //method which create our table private static final String CREATE_PRODUCTLIST_IN_DB = "CREATE TABLE " + DB_TABLE + "( " + KEY_ID + " " + ID_DETAILS + ", " + KEY_NAME + " " + NAME_DETAILS + ", " + KEY_DESCRIPTION + " " + DESCRIPTION_DETAILS + ", " + KEY_IMAGE +" " + IMAGE_DETAILS + ");"; inserting statement: public long insertToProductList(String name, String description, byte[] image) { ContentValues value = new ContentValues(); // get the id of column and value value.put(KEY_NAME, name); value.put(KEY_DESCRIPTION, description); value.put(KEY_IMAGE, image); // put into db return db.insert(DB_TABLE, null, value); } Button which add the picture and onActivityResult method which saves the image and put it into the imageview public void AddPicture(View v) { // creating specified intent which have to get data Intent intent = new Intent(Intent.ACTION_PICK); // From where we want choose our pictures intent.setType("image/*"); startActivityForResult(intent, PICK_IMAGE); } @Override protected void onActivityResult(int requestCode, int resultCode, Intent data) { // TODO Auto-generated method stub super.onActivityResult(requestCode, resultCode, data); // if identification code match to the intent, //if yes we know that is our picture, if(requestCode ==PICK_IMAGE ) { // check if the data comes with intent if(data!= null) { Uri chosenImage = data.getData(); String[] filePathColumn = {MediaStore.Images.Media.DATA}; Cursor cursor = getContentResolver().query(chosenImage, filePathColumn, null, null, null); cursor.moveToFirst(); int columnIndex = cursor.getColumnIndex(filePathColumn[0]); String filePat = cursor.getString(columnIndex); cursor.close(); ImageOfProduct = BitmapFactory.decodeFile(filePat); if(ImageOfProduct!=null) { picture.setImageBitmap(ImageOfProduct); } messageDisplayer("got picture, isn't null " + IdOfPicture); } } } Then the code which converts bitmap to byte[] public byte[] bitmapToByteConvert(Bitmap bit ) { // stream of data getted for compressed bitmap ByteArrayOutputStream gettedData = new ByteArrayOutputStream(); // compressing method bit.compress(CompressFormat.PNG, 0, gettedData); // our byte array return gettedData.toByteArray(); } The method which put data to the row: byte[] image=null; // if the name isn't put to the editView if(name.getText().toString().trim().length()== 0) { messageDisplayer("At least you need to type name of product if you want add it to the DB "); } else{ String desc = description.getText().toString(); if(description.getText().toString().trim().length()==0) { messageDisplayer("the description is set as none"); desc = "none"; } DB.open(); if(ImageOfProduct!= null){ image = bitmapToByteConvert(ImageOfProduct); messageDisplayer("image isn't null"); } else { BitmapDrawable drawable = (BitmapDrawable) picture.getDrawable(); image = bitmapToByteConvert(drawable.getBitmap()); } if(image.length>0 && image!=null) { messageDisplayer(Integer.toString(image.length)); } DB.insertToProductList(name.getText().toString(), desc, image ); DB.close(); messageDisplayer("well done you add the product"); finish(); You can see that I'm checking here the length of array to be sure that I don't send empty one. And here is the place where Error appears imo, this code is from activity which presents the listview with data taken from db private void LoadOurLayoutListWithInfo() { // firstly wee need to open connection with db db= new sqliteDB(getApplicationContext()); db.open(); // creating our custom adaprer, the specification of it will be typed // in our own class (MyArrayAdapter) which will be created below ArrayAdapter<ProductFromTable> customAdapter = new MyArrayAdapter(); //get the info from whole table tablecursor = db.getAllColumns(); if(tablecursor != null) { startManagingCursor(tablecursor); tablecursor.moveToFirst(); } // now we moving all info from tablecursor to ourlist if(tablecursor != null && tablecursor.moveToFirst()) { do{ // taking info from row in table int id = tablecursor.getInt(sqliteDB.ID_COLUMN); String name= tablecursor.getString(sqliteDB.NAME_COLUMN); String description= tablecursor.getString(sqliteDB.DESCRIPTION_COLUMN); byte[] image= tablecursor.getBlob(3); tablefromDB.add(new ProductFromTable(id,name,description,image)); // moving until we didn't find last row }while(tablecursor.moveToNext()); } listView = (ListView) findViewById(R.id.tagwriter_listoftags); //as description says // setAdapter = The ListAdapter which is responsible for maintaining //the data backing this list and for producing a view to represent //an item in that data set. listView.setAdapter(customAdapter); } I put the info from row tho objects which are stored in list. I read tones of question but I can't find any solution for me. Everything works when I put the sample image ( which is stored in app res folder ). Thx for any advice

    Read the article

  • CSS Positioning

    - by Davey
    Trying to mess with this wordpress theme and can't figure out why the sidebar is stacking underneath the content block. Any help would be very appreciated. http://www.buffalostreetbooks.com/events CSS: body { font-family: Arial, Helvetica, Verdana, Sans-serif; font-size: 10pt; background-color: #692022; background-image:url("http://www.buffalostreetbooks.com/wp-content/themes/autumn-leaves/images/repeatflower.png"); } body,h1#blog-title { margin: 0; padding: 0; } a { color: blue; } a:hover { color: #FF8C00; } a img { border: 0 none; } #wrapper { width: 960px; margin: 0 auto; background-color: #F4FBF4; border-left: 1px solid #ccc; border-right: 1px solid #ccc; } #header { background-image:url("http://www.buffalostreetbooks.com/wp-content/themes/autumn-leaves/images/headertime.png"); width:768px; height: 200px; } #inner-header { padding: 125px 1em 0; } h1#blog-title { font-size: 2em; } h1#blog-title a { color: #800000; } .entry-title a { color: #CD853F; } h1#blog-title a, .entry-title a, #footer a { text-decoration: none; } h1#blog-title a:hover, .entry-title a:hover, #footer a:hover { text-decoration: underline; } div.skip-link { display: none; } #menu { border-bottom: 1px solid #ccc; } #menu a { color: #000; } #menu a:hover { text-decoration: underline; } #menu li.current_page_item a, #menu li.current_page_item a:hover { background-color: #DFC28B; text-decoration: none; } #content { padding: 1em; width:600px; } .entry-title { font-size: 1.5em; margin: 1em 0 0 0; } abbr.published { color: #666; border: 0 none; } .entry-meta, .entry-date { color: #666; } #comments-list .avatar { float: left; margin-right: 1em; } #comments-list .n { font-weight: bold; } .entry-meta, .comment-meta { font-style: italic; } #comments-list p { clear: left; } #primary { padding-left: 1em; font-size: 0.9em; border-left: 1px solid #ccc; border-bottom: 1px solid #ccc; background-color: #FFFACD; } #footer { text-align: center; font-size: 0.8em; border-top: 1px solid #ccc; border-bottom: 1px solid #ccc; margin-bottom: 1em; } #inner-footer { padding: 1em 0; } .entry-meta, .entry-meta a, .comment-meta, .comment-meta a, .sidebar, .sidebar a, #footer, #footer a { color: #666; } /* LAYOUT: Two-Column (Right) DESCRIPTION: Two-column fluid layout with one sidebars right of content */ div#container { margin:0 0 0 0; width:960px; height:100%; } div#content { margin:0 0 0 0; } div.sidebar { overflow:hidden; width:280px; min-height:500px; clear:both; } div#secondary { clear:right; } div#footer { clear:both; width:100%; } /* Just some example content */ div#menu { height:2em; width:100%; } div#menu ul,div#menu ul ul { line-height:2em; list-style:none; margin:0; padding:0; } div#menu ul a { display:block; margin-right:1em; padding:0 0.5em; text-decoration:none; } div#menu ul ul ul a { font-style:italic; } div#menu ul li ul { left:-999em; position:absolute; } div#menu ul li:hover ul { left:auto; } .entry-title,.entry-meta { clear:both; } div#primary { } form#commentform .form-label { margin:1em 0 0; } form#commentform span.required { background:#fff; color:#c30; } form#commentform,form#commentform p { padding:0; } input#author,input#email,input#url,textarea#comme nt { padding:0.2em; } div.comments ol li { margin:0 0 3.5em; } textarea#comment { height:13em; margin:0 0 0.5em; overflow:auto; width:66%; } .alignright,img.alignright{ float:right; margin:1em 0 0 1em; } .alignleft,img.alignleft{ float:left; margin:1em 1em 0 0; } .aligncenter,img.aligncenter{ display:block; margin:1em auto; text-align:center; } div.gallery { clear:both; height:180px; margin:1em 0; width:100%; } p.wp-caption-text{ font-style:italic; } div.gallery dl{ margin:1em auto; overflow:hidden; text-align:center; } div.gallery dl.gallery-columns-1 { width:100%; } div.gallery dl.gallery-columns-2 { width:49%; } div.gallery dl.gallery-columns-3 { width:33%; } div.gallery dl.gallery-columns-4 { width:24%; } div.gallery dl.gallery-columns-5 { width:19%; } div#nav-above { margin-bottom:1em; } div#nav-below { margin-top:1em; } div#nav-images { height:150px; margin:1em 0; } div.navigation { height:1.25em; } div.navigation div.nav-next { float:right; text-align:right; } div.sidebar h3 { font-size:1.2em; } div.sidebar input#s { width:7em; } div.sidebar li { list-style:none; margin:0 0 2em; } div.sidebar li form { margin:0.2em 0 0; padding:0; } div.sidebar ul ul { margin:0 0 0 2em; } div.sidebar ul ul li { list-style:disc; margin:0; } div.sidebar ul ul ul { margin:0 0 0 0.5em; } div.sidebar ul ul ul li { list-style:circle; } div#menu ul li,div.gallery dl,div.navigation div.nav-previous { float:left; } input#author,input#email,input#url,div.navigation div { width:50%; } div.gallery *,div.sidebar div,div.sidebar h3,div.sidebar ul { margin:0; padding:0; }

    Read the article

  • c windows connect() fails. error 10049

    - by Joshua Moore
    The following two pieces of code compile, but I get a connect() failed error on the client side. (compiled with MinGW). Client Code: // thanks to cs.baylor.edu/~donahoo/practical/CSockets/code/TCPEchoClientWS.c #include <stdio.h> #include <winsock.h> #include <stdlib.h> #define RCVBUFSIZE 32 // size of receive buffer void DieWithError(char *errorMessage); int main(int argc, char* argv[]) { int sock; struct sockaddr_in echoServAddr; unsigned short echoServPort; char *servIP; char *echoString; char echoBuffer[RCVBUFSIZE]; int echoStringLen; int bytesRcvd, totalBytesRcvd; WSAData wsaData; if((argc < 3) || (argc > 4)){ fprintf(stderr, "Usage: %s <Sever IP> <Echo Word> [<Echo Port>]\n", argv[0]); exit(1); } if (argc==4) echoServPort = atoi(argv[3]); // use given port if any else echoServPort = 7; // echo is well-known port for echo service if(WSAStartup(MAKEWORD(2, 0), &wsaData) != 0){ // load winsock 2.0 dll fprintf(stderr, "WSAStartup() failed"); exit(1); } // create reliable, stream socket using tcp if((sock=socket(PF_INET, SOCK_STREAM, IPPROTO_TCP)) < 0) DieWithError("socket() failed"); // construct the server address structure memset(&echoServAddr, 0, sizeof(echoServAddr)); echoServAddr.sin_family = AF_INET; echoServAddr.sin_addr.s_addr = inet_addr(servIP); // server IP address echoServAddr.sin_port = htons(echoServPort); // establish connection to the echo server if(connect(sock, (struct sockaddr*)&echoServAddr, sizeof(echoServAddr)) < 0) DieWithError("connect() failed"); echoStringLen = strlen(echoString); // determine input length // send the string, includeing the null terminator to the server if(send(sock, echoString, echoStringLen, 0)!= echoStringLen) DieWithError("send() sent a different number of bytes than expected"); totalBytesRcvd = 0; printf("Received: "); // setup to print the echoed string while(totalBytesRcvd < echoStringLen){ // receive up to the buffer size (minus 1 to leave space for a null terminator) bytes from the sender if(bytesRcvd = recv(sock, echoBuffer, RCVBUFSIZE-1, 0) <= 0) DieWithError("recv() failed or connection closed prematurely"); totalBytesRcvd += bytesRcvd; // keep tally of total bytes echoBuffer[bytesRcvd] = '\0'; printf("%s", echoBuffer); // print the echo buffer } printf("\n"); closesocket(sock); WSACleanup(); exit(0); } void DieWithError(char *errorMessage) { fprintf(stderr, "%s: %d\n", errorMessage, WSAGetLastError()); exit(1); } Server Code: // thanks cs.baylor.edu/~donahoo/practical/CSockets/code/TCPEchoServerWS.c #include <stdio.h> #include <winsock.h> #include <stdlib.h> #define MAXPENDING 5 // maximum outstanding connection requests #define RCVBUFSIZE 1000 void DieWithError(char *errorMessage); void HandleTCPClient(int clntSocket); // tcp client handling function int main(int argc, char **argv) { int serverSock; int clientSock; struct sockaddr_in echoServerAddr; struct sockaddr_in echoClientAddr; unsigned short echoServerPort; int clientLen; // length of client address data structure WSAData wsaData; if (argc!=2){ fprintf(stderr, "Usage: %s <Server Port>\n", argv[0]); exit(1); } echoServerPort = atoi(argv[1]); if(WSAStartup(MAKEWORD(2, 0), &wsaData)!=0){ fprintf(stderr, "WSAStartup() failed"); exit(1); } // create socket for incoming connections if((serverSock=socket(PF_INET, SOCK_STREAM, IPPROTO_TCP))<0) DieWithError("socket() failed"); // construct local address structure memset(&echoServerAddr, 0, sizeof(echoServerAddr)); echoServerAddr.sin_family = AF_INET; echoServerAddr.sin_addr.s_addr = htonl(INADDR_ANY); // any incoming interface echoServerAddr.sin_port = htons(echoServerPort); // local port // bind to the local address if(bind(serverSock, (struct sockaddr*)&echoServerAddr, sizeof(echoServerAddr) )<0) DieWithError("bind() failed"); // mark the socket so it will listen for incoming connections if(listen(serverSock, MAXPENDING)<0) DieWithError("listen() failed"); for (;;){ // run forever // set the size of the in-out parameter clientLen = sizeof(echoClientAddr); // wait for a client to connect if((clientSock = accept(serverSock, (struct sockaddr*)&echoClientAddr, &clientLen)) < 0) DieWithError("accept() failed"); // clientSock is connected to a client printf("Handling client %s\n", inet_ntoa(echoClientAddr.sin_addr)); HandleTCPClient(clientSock); } // NOT REACHED } void DieWithError(char *errorMessage) { fprintf(stderr, "%s: %d\n", errorMessage, WSAGetLastError()); exit(1); } void HandleTCPClient(int clientSocket) { char echoBuffer[RCVBUFSIZE]; // buffer for echostring int recvMsgSize; // size of received message // receive message from client if((recvMsgSize = recv(clientSocket, echoBuffer, RCVBUFSIZE, 0) <0)) DieWithError("recv() failed"); // send received string and receive again until end of transmission while(recvMsgSize > 0){ // echo message back to client if(send(clientSocket, echoBuffer, recvMsgSize, 0)!=recvMsgSize) DieWithError("send() failed"); // see if there's more data to receive if((recvMsgSize = recv(clientSocket, echoBuffer, RCVBUFSIZE, 0)) <0) DieWithError("recv() failed"); } closesocket(clientSocket); // close client socket } How can I fix this?

    Read the article

  • Using C# to detect whether a filename character is considered international

    - by Morten Mertner
    I've written a small console application (source below) to locate and optionally rename files containing international characters, as they are a source of constant pain with most source control systems (some background on this below). The code I'm using has a simple dictionary with characters to look for and replace (and nukes every other character that uses more than one byte of storage), but it feels very hackish. What's the right way to (a) find out whether a character is international? and (b) what the best ASCII substitution character would be? Let me provide some background information on why this is needed. It so happens that the danish Å character has two different encodings in UTF-8, both representing the same symbol. These are known as NFC and NFD encodings. Windows and Linux will create NFC encoding by default but respect whatever encoding it is given. Mac will convert all names (when saving to a HFS+ partition) to NFD and therefore returns a different byte stream for the name of a file created on Windows. This effectively breaks Subversion, Git and lots of other utilities that don't care to properly handle this scenario. I'm currently evaluating Mercurial, which turns out to be even worse at handling international characters.. being fairly tired of these problems, either source control or the international character would have to go, and so here we are. My current implementation: public class Checker { private Dictionary<char, string> internationals = new Dictionary<char, string>(); private List<char> keep = new List<char>(); private List<char> seen = new List<char>(); public Checker() { internationals.Add( 'æ', "ae" ); internationals.Add( 'ø', "oe" ); internationals.Add( 'å', "aa" ); internationals.Add( 'Æ', "Ae" ); internationals.Add( 'Ø', "Oe" ); internationals.Add( 'Å', "Aa" ); internationals.Add( 'ö', "o" ); internationals.Add( 'ü', "u" ); internationals.Add( 'ä', "a" ); internationals.Add( 'é', "e" ); internationals.Add( 'è', "e" ); internationals.Add( 'ê', "e" ); internationals.Add( '¦', "" ); internationals.Add( 'Ã', "" ); internationals.Add( '©', "" ); internationals.Add( ' ', "" ); internationals.Add( '§', "" ); internationals.Add( '¡', "" ); internationals.Add( '³', "" ); internationals.Add( '­', "" ); internationals.Add( 'º', "" ); internationals.Add( '«', "-" ); internationals.Add( '»', "-" ); internationals.Add( '´', "'" ); internationals.Add( '`', "'" ); internationals.Add( '"', "'" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 147 } )[ 0 ], "-" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 148 } )[ 0 ], "-" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 153 } )[ 0 ], "'" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 166 } )[ 0 ], "." ); keep.Add( '-' ); keep.Add( '=' ); keep.Add( '\'' ); keep.Add( '.' ); } public bool IsInternationalCharacter( char c ) { var s = c.ToString(); byte[] bytes = Encoding.UTF8.GetBytes( s ); if( bytes.Length > 1 && ! internationals.ContainsKey( c ) && ! seen.Contains( c ) ) { Console.WriteLine( "X '{0}' ({1})", c, string.Join( ",", bytes ) ); seen.Add( c ); if( ! keep.Contains( c ) ) { internationals[ c ] = ""; } } return internationals.ContainsKey( c ); } public bool HasInternationalCharactersInName( string name, out string safeName ) { StringBuilder sb = new StringBuilder(); Array.ForEach( name.ToCharArray(), c => sb.Append( IsInternationalCharacter( c ) ? internationals[ c ] : c.ToString() ) ); int length = sb.Length; sb.Replace( " ", " " ); while( sb.Length != length ) { sb.Replace( " ", " " ); } safeName = sb.ToString().Trim(); string namePart = Path.GetFileNameWithoutExtension( safeName ); if( namePart.EndsWith( "." ) ) safeName = namePart.Substring( 0, namePart.Length - 1 ) + Path.GetExtension( safeName ); return name != safeName; } } And this would be invoked like this: FileInfo file = new File( "Århus.txt" ); string safeName; if( checker.HasInternationalCharactersInName( file.Name, out safeName ) ) { // rename file }

    Read the article

  • how can we generate the bit greater than 60000?

    - by thinthinyu
    we can now generate about 50000bits. my code cannot generate more than 60000 bit..please help me............m_B is member variable and type is CString. // LFSR_ECDlg.cpp : implementation file // #include "stdafx.h" #include "myecc.h" #include "LFSR_ECDlg.h" #include "MyClass.h" #ifdef _DEBUG #define new DEBUG_NEW #undef THIS_FILE static char THIS_FILE[] = __FILE__; #endif extern MyClass mycrv; ///////////////////////////////////////////////////////////////////////////// // LFSR_ECDlg dialog LFSR_ECDlg::LFSR_ECDlg(CWnd* pParent /*=NULL*/) : CDialog(LFSR_ECDlg::IDD, pParent) { //{{AFX_DATA_INIT(LFSR_ECDlg) m_C1 = 0; m_C2 = 0; m_B = _T(""); m_p = _T(""); m_Qty = 0; m_time = _T(""); //}}AFX_DATA_INIT } void LFSR_ECDlg::DoDataExchange(CDataExchange* pDX) { CDialog::DoDataExchange(pDX); //{{AFX_DATA_MAP(LFSR_ECDlg) DDX_Text(pDX, IDC_C1, m_C1); DDX_Text(pDX, IDC_C2, m_C2); DDX_Text(pDX, IDC_Sequence, m_B); DDX_Text(pDX, IDC_Sequence2, m_p); DDX_Text(pDX, IDC_QTY, m_Qty); DDV_MinMaxLong(pDX, m_Qty, 0, 2147483647); DDX_Text(pDX, IDC_time, m_time); //}}AFX_DATA_MAP } BEGIN_MESSAGE_MAP(LFSR_ECDlg, CDialog) //{{AFX_MSG_MAP(LFSR_ECDlg) ON_WM_SETCURSOR() ON_EN_CHANGE(IDC_Sequence, OnGeneratorLFSR) ON_MESSAGE(WM_MYPAINTMESSAGE,PaintMyCaption)//by ttyu ON_BN_CLICKED(IDC_save, Onsave) //}}AFX_MSG_MAP END_MESSAGE_MAP() ///////////////////////////////////////////////////////////////////////////// // LFSR_ECDlg message handlers bool LFSR_ECDlg::CheckDataEntry() { //if((m_Px>=mycrv.p)|(m_Py>=mycrv.p)) {AfxMessageBox("Seed [P] is invalid!");return false;}//by ttyu if((m_C1<=0) | (m_C1>mycrv.n)) {AfxMessageBox("Constant c1 is not valid!");return false;} if((m_C2<=0 )| (m_C2>mycrv.n)) {AfxMessageBox("Constant c2 is not valid!");return false;} return true; } void LFSR_ECDlg::OnOK() { UpdateData(true); static int stime,etime,dtime; CString txt; m_time=""; CTime t(CTime::GetCurrentTime()); CString txt1; txt1=""; //ms = t.GetDay(); // TODO: Add extra validation here stime=t.GetTime(); txt1.Format("%d",stime); AfxMessageBox (txt1); txt=""; if (CheckDataEntry()) OnGeneratorLFSR(); etime=t.GetTime(); CString txt2; txt2=""; txt2.Format("%d",etime); AfxMessageBox (txt2); dtime=etime-stime; txt.Format("%f",dtime); m_time+=txt; // UpdateData(false); //rtime.Format("%s, %s %d, %d.",day,month,dd,yy); //CDialog::OnOK(); } void LFSR_ECDlg::OnCancel() { // TODO: Add extra cleanup here CDialog::OnCancel(); } void LFSR_ECDlg::OnGeneratorLFSR() { // TODO: If this is a RICHEDIT control, the control will not // send this notification unless you override the CDialog::OnInitDialog() // function and call CRichEditCtrl().SetEventMask() // with the ENM_CHANGE flag ORed into the mask. // TODO: Add your control notification handler code here point P0,P1,P2; P0 = mycrv.G; P1 = mycrv.MulPoint(P0,2); int C1=m_C1, C2=m_C2, n=m_Qty, k=0; int q= (mycrv.p-1) / 2; m_p = ""; m_B = ""; CString txt; for(int i=0;i<n;i++) { txt=""; if(P0==mycrv.O) txt.Format("O"); else txt.Format("(%d, %d)",P0.x,P0.y); m_p +=txt; m_p += 13; m_p += 10; if((P0.y >= 0)&&(P0.y <= q)) m_B += "0"; else if(P0 == mycrv.O) m_B += "0"; else m_B += "1"; //m_B += 13;//by ttyu // m_B += 10;//by ttyu P2 = mycrv.AddPoints(mycrv.MulPoint(P1,C2), mycrv.MulPoint(P0,C1)); P0 = P1; P1 = P2; } } BOOL LFSR_ECDlg::OnInitDialog() { CDialog::OnInitDialog(); // TODO: Add extra initialization here //code for dlg bar CString str="LFSR_EC"; m_cap.SetCaption (str); m_cap.Install (this,WM_MYPAINTMESSAGE); ////////////////////////////// return TRUE; // return TRUE unless you set the focus to a control // EXCEPTION: OCX Property Pages should return FALSE } LRESULT LFSR_ECDlg::PaintMyCaption(WPARAM wp, LPARAM lp) { m_cap.PaintCaption(wp,lp); return 0; } BOOL LFSR_ECDlg::OnSetCursor(CWnd* pWnd, UINT nHitTest, UINT message) { // TODO: Add your message handler code here and/or call default return CDialog::OnSetCursor(pWnd, nHitTest, message); } void LFSR_ECDlg::Onsave() { this->UpdateData(); CFile bitstream; char strFilter[] = { "Stream Records (*.mpl)|*.mpl| (*.pis)|*.pis|All Files (*.*)|*.*||" }; CFileDialog FileDlg(FALSE, ".mpl", NULL, 0, strFilter); //insertion//by TTT CFile cf_object; if( FileDlg.DoModal() == IDOK ){ cf_object.Open( FileDlg.GetFileName(), CFile::modeCreate|CFile::modeWrite); //char szText[100]; //strcpy(szText, "File Write Test"); CString txt; txt=""; txt.Format("%s",m_B);//by ANO AfxMessageBox (txt);//by ANO int mB_size=m_B.GetLength(); cf_object.Write (m_B,mB_size); //insertion end /* if( FileDlg.DoModal() == IDOK ) { if( bitstream.Open(FileDlg.GetFileName(), CFile::modeCreate | CFile::modeWrite) == FALSE ) return; CArchive ar(&bitstream, CArchive::store); CString txt; txt=""; txt.Format("%s",m_B);//by ANO AfxMessageBox (txt);//by ANO //txt=m_B;//by ANO ar <<txt;//by ANO ar.Close(); } else return; bitstream.Close(); */ // TODO: Add your control notification handler code here } }

    Read the article

  • C++ Program performs better when piped

    - by ET1 Nerd
    I haven't done any programming in a decade. I wanted to get back into it, so I made this little pointless program as practice. The easiest way to describe what it does is with output of my --help codeblock: ./prng_bench --help ./prng_bench: usage: ./prng_bench $N $B [$T] This program will generate an N digit base(B) random number until all N digits are the same. Once a repeating N digit base(B) number is found, the following statistics are displayed: -Decimal value of all N digits. -Time & number of tries taken to randomly find. Optionally, this process is repeated T times. When running multiple repititions, averages for all N digit base(B) numbers are displayed at the end, as well as total time and total tries. My "problem" is that when the problem is "easy", say a 3 digit base 10 number, and I have it do a large number of passes the "total time" is less when piped to grep. ie: command ; command |grep took : ./prng_bench 3 10 999999 ; ./prng_bench 3 10 999999|grep took .... Pass# 999999: All 3 base(10) digits = 3 base(10). Time: 0.00005 secs. Tries: 23 It took 191.86701 secs & 99947208 tries to find 999999 repeating 3 digit base(10) numbers. An average of 0.00019 secs & 99 tries was needed to find each one. It took 159.32355 secs & 99947208 tries to find 999999 repeating 3 digit base(10) numbers. If I run the same command many times w/o grep time is always VERY close. I'm using srand(1234) for now, to test. The code between my calls to clock_gettime() for start and stop do not involve any stream manipulation, which would obviously affect time. I realize this is an exercise in futility, but I'd like to know why it behaves this way. Below is heart of the program. Here's a link to the full source on DB if anybody wants to compile and test. https://www.dropbox.com/s/6olqnnjf3unkm2m/prng_bench.cpp clock_gettime() requires -lrt. for (int pass_num=1; pass_num<=passes; pass_num++) { //Executes $passes # of times. clock_gettime(CLOCK_PROCESS_CPUTIME_ID, &temp_time); //get time start_time = timetodouble(temp_time); //convert time to double, store as start_time for(i=1, tries=0; i!=0; tries++) { //loops until 'comparison for' fully completes. counts reps as 'tries'. <------------ for (i=0; i<Ndigits; i++) //Move forward through array. | results[i]=(rand()%base); //assign random num of base to element (digit). | /*for (i=0; i<Ndigits; i++) //---Debug Lines--------------- | std::cout<<" "<<results[i]; //---a LOT of output.---------- | std::cout << "\n"; //---Comment/decoment to disable/enable.*/ // | for (i=Ndigits-1; i>0 && results[i]==results[0]; i--); //Move through array, != element breaks & i!=0, new digits drawn. -| } //If all are equal i will be 0, nested for condition satisfied. -| clock_gettime(CLOCK_PROCESS_CPUTIME_ID, &temp_time); //get time draw_time = (timetodouble(temp_time) - start_time); //convert time to dbl, subtract start_time, set draw_time to diff. total_time += draw_time; //add time for this pass to total. total_tries += tries; //add tries for this pass to total. /*Formated output for each pass: Pass# ---: All -- base(--) digits = -- base(10) Time: ----.---- secs. Tries: ----- (LINE) */ std::cout<<"Pass# "<<std::setw(width_pass)<<pass_num<<": All "<<Ndigits<<" base("<<base<<") digits = " <<std::setw(width_base)<<results[0]<<" base(10). Time: "<<std::setw(width_time)<<draw_time <<" secs. Tries: "<<tries<<"\n"; } if(passes==1) return 0; //No need for totals and averages of 1 pass. /* It took ----.---- secs & ------ tries to find --- repeating -- digit base(--) numbers. (LINE) An average of ---.---- secs & ---- tries was needed to find each one. (LINE)(LINE) */ std::cout<<"It took "<<total_time<<" secs & "<<total_tries<<" tries to find " <<passes<<" repeating "<<Ndigits<<" digit base("<<base<<") numbers.\n" <<"An average of "<<total_time/passes<<" secs & "<<total_tries/passes <<" tries was needed to find each one. \n\n"; return 0;

    Read the article

  • ActiveMQ - "Cannot send, channel has already failed" every 2 seconds?

    - by quanta
    ActiveMQ 5.7.0 In the activemq.log, I'm seeing this exception every 2 seconds: 2013-11-05 13:00:52,374 | DEBUG | Transport Connection to: tcp://127.0.0.1:37501 failed: org.apache.activemq.transport.InactivityIOException: Cannot send, channel has already failed: tcp://127.0.0.1:37501 | org.apache.activemq.broker.TransportConnection.Transport | Async Exception Handler org.apache.activemq.transport.InactivityIOException: Cannot send, channel has already failed: tcp://127.0.0.1:37501 at org.apache.activemq.transport.AbstractInactivityMonitor.doOnewaySend(AbstractInactivityMonitor.java:282) at org.apache.activemq.transport.AbstractInactivityMonitor.oneway(AbstractInactivityMonitor.java:271) at org.apache.activemq.transport.TransportFilter.oneway(TransportFilter.java:85) at org.apache.activemq.transport.WireFormatNegotiator.oneway(WireFormatNegotiator.java:104) at org.apache.activemq.transport.MutexTransport.oneway(MutexTransport.java:68) at org.apache.activemq.broker.TransportConnection.dispatch(TransportConnection.java:1312) at org.apache.activemq.broker.TransportConnection.processDispatch(TransportConnection.java:838) at org.apache.activemq.broker.TransportConnection.iterate(TransportConnection.java:873) at org.apache.activemq.thread.PooledTaskRunner.runTask(PooledTaskRunner.java:129) at org.apache.activemq.thread.PooledTaskRunner$1.run(PooledTaskRunner.java:47) at java.util.concurrent.ThreadPoolExecutor$Worker.runTask(ThreadPoolExecutor.java:886) at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:908) at java.lang.Thread.run(Thread.java:662) Due to this keyword InactivityIOException, the first thing comes to my mind is InactivityMonitor, but the strange thing is MaxInactivityDuration=30000: 2013-11-05 13:11:02,672 | DEBUG | Sending: WireFormatInfo { version=9, properties={MaxFrameSize=9223372036854775807, CacheSize=1024, CacheEnabled=true, SizePrefixDisabled=false, MaxInactivityDurationInitalDelay=10000, TcpNoDelayEnabled=true, MaxInactivityDuration=30000, TightEncodingEnabled=true, StackTraceEnabled=true}, magic=[A,c,t,i,v,e,M,Q]} | org.apache.activemq.transport.WireFormatNegotiator | ActiveMQ BrokerService[localhost] Task-2 Moreover, I also didn't see something like this: No message received since last read check for ... or: Channel was inactive for too (30000) long Do a netstat, I see these connections in TIME_WAIT state: tcp 0 0 127.0.0.1:38545 127.0.0.1:61616 TIME_WAIT - tcp 0 0 127.0.0.1:38544 127.0.0.1:61616 TIME_WAIT - tcp 0 0 127.0.0.1:38522 127.0.0.1:61616 TIME_WAIT - Here're the output when running tcpdump: Internet Protocol Version 4, Src: 127.0.0.1 (127.0.0.1), Dst: 127.0.0.1 (127.0.0.1) Version: 4 Header length: 20 bytes Differentiated Services Field: 0x00 (DSCP 0x00: Default; ECN: 0x00: Not-ECT (Not ECN-Capable Transport)) 0000 00.. = Differentiated Services Codepoint: Default (0x00) .... ..00 = Explicit Congestion Notification: Not-ECT (Not ECN-Capable Transport) (0x00) Total Length: 296 Identification: 0x7b6a (31594) Flags: 0x02 (Don't Fragment) 0... .... = Reserved bit: Not set .1.. .... = Don't fragment: Set ..0. .... = More fragments: Not set Fragment offset: 0 Time to live: 64 Protocol: TCP (6) Header checksum: 0xc063 [correct] [Good: True] [Bad: False] Source: 127.0.0.1 (127.0.0.1) Destination: 127.0.0.1 (127.0.0.1) Transmission Control Protocol, Src Port: 61616 (61616), Dst Port: 54669 (54669), Seq: 1, Ack: 2, Len: 244 Source port: 61616 (61616) Destination port: 54669 (54669) [Stream index: 11] Sequence number: 1 (relative sequence number) [Next sequence number: 245 (relative sequence number)] Acknowledgement number: 2 (relative ack number) Header length: 32 bytes Flags: 0x018 (PSH, ACK) 000. .... .... = Reserved: Not set ...0 .... .... = Nonce: Not set .... 0... .... = Congestion Window Reduced (CWR): Not set .... .0.. .... = ECN-Echo: Not set .... ..0. .... = Urgent: Not set .... ...1 .... = Acknowledgement: Set .... .... 1... = Push: Set .... .... .0.. = Reset: Not set .... .... ..0. = Syn: Not set .... .... ...0 = Fin: Not set Window size value: 256 [Calculated window size: 32768] [Window size scaling factor: 128] Checksum: 0xff1c [validation disabled] [Good Checksum: False] [Bad Checksum: False] Options: (12 bytes) No-Operation (NOP) No-Operation (NOP) Timestamps: TSval 2304161892, TSecr 2304161891 Kind: Timestamp (8) Length: 10 Timestamp value: 2304161892 Timestamp echo reply: 2304161891 [SEQ/ACK analysis] [Bytes in flight: 244] Constrained Application Protocol, TID: 240, Length: 244 00.. .... = Version: 0 ..00 .... = Type: Confirmable (0) .... 0000 = Option Count: 0 Code: Unknown (0) Transaction ID: 240 Payload Content-Type: text/plain (default), Length: 240, offset: 4 Line-based text data: text/plain [truncated] \001ActiveMQ\000\000\000\t\001\000\000\000<DE>\000\000\000\t\000\fMaxFrameSize\006\177<FF><FF><FF><FF> <FF><FF><FF>\000\tCacheSize\005\000\000\004\000\000\fCacheEnabled\001\001\000\022SizePrefixDisabled\001\000\000 MaxInactivityDurationInitalDelay\006\ It is very likely a tcp port check. This is what I see when trying telnet from another host: 2013-11-05 16:12:41,071 | DEBUG | Transport Connection to: tcp://10.8.20.9:46775 failed: java.io.EOFException | org.apache.activemq.broker.TransportConnection.Transport | ActiveMQ Transport: tcp:///10.8.20.9:46775@61616 java.io.EOFException at java.io.DataInputStream.readInt(DataInputStream.java:375) at org.apache.activemq.openwire.OpenWireFormat.unmarshal(OpenWireFormat.java:275) at org.apache.activemq.transport.tcp.TcpTransport.readCommand(TcpTransport.java:229) at org.apache.activemq.transport.tcp.TcpTransport.doRun(TcpTransport.java:221) at org.apache.activemq.transport.tcp.TcpTransport.run(TcpTransport.java:204) at java.lang.Thread.run(Thread.java:662) 2013-11-05 16:12:41,071 | DEBUG | Transport Connection to: tcp://10.8.20.9:46775 failed: org.apache.activemq.transport.InactivityIOException: Cannot send, channel has already failed: tcp://10.8.20.9:46775 | org.apache.activemq.broker.TransportConnection.Transport | Async Exception Handler org.apache.activemq.transport.InactivityIOException: Cannot send, channel has already failed: tcp://10.8.20.9:46775 at org.apache.activemq.transport.AbstractInactivityMonitor.doOnewaySend(AbstractInactivityMonitor.java:282) at org.apache.activemq.transport.AbstractInactivityMonitor.oneway(AbstractInactivityMonitor.java:271) at org.apache.activemq.transport.TransportFilter.oneway(TransportFilter.java:85) at org.apache.activemq.transport.WireFormatNegotiator.oneway(WireFormatNegotiator.java:104) at org.apache.activemq.transport.MutexTransport.oneway(MutexTransport.java:68) at org.apache.activemq.broker.TransportConnection.dispatch(TransportConnection.java:1312) at org.apache.activemq.broker.TransportConnection.processDispatch(TransportConnection.java:838) at org.apache.activemq.broker.TransportConnection.iterate(TransportConnection.java:873) at org.apache.activemq.thread.PooledTaskRunner.runTask(PooledTaskRunner.java:129) at org.apache.activemq.thread.PooledTaskRunner$1.run(PooledTaskRunner.java:47) at java.util.concurrent.ThreadPoolExecutor$Worker.runTask(ThreadPoolExecutor.java:886) at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:908) at java.lang.Thread.run(Thread.java:662) 2013-11-05 16:12:41,071 | DEBUG | Unregistering MBean org.apache.activemq:BrokerName=localhost,Type=Connection,ConnectorName=ope nwire,ViewType=address,Name=tcp_//10.8.20.9_46775 | org.apache.activemq.broker.jmx.ManagementContext | ActiveMQ Transport: tcp:/ //10.8.20.9:46775@61616 2013-11-05 16:12:41,073 | DEBUG | Stopping connection: tcp://10.8.20.9:46775 | org.apache.activemq.broker.TransportConnection | ActiveMQ BrokerService[localhost] Task-5 2013-11-05 16:12:41,073 | DEBUG | Stopping transport tcp:///10.8.20.9:46775@61616 | org.apache.activemq.transport.tcp.TcpTranspo rt | ActiveMQ BrokerService[localhost] Task-5 2013-11-05 16:12:41,073 | DEBUG | Initialized TaskRunnerFactory[ActiveMQ Task] using ExecutorService: java.util.concurrent.Threa dPoolExecutor@23cc2a28 | org.apache.activemq.thread.TaskRunnerFactory | ActiveMQ BrokerService[localhost] Task-5 2013-11-05 16:12:41,074 | DEBUG | Closed socket Socket[addr=/10.8.20.9,port=46775,localport=61616] | org.apache.activemq.transpo rt.tcp.TcpTransport | ActiveMQ Task-1 2013-11-05 16:12:41,074 | DEBUG | Forcing shutdown of ExecutorService: java.util.concurrent.ThreadPoolExecutor@23cc2a28 | org.apache.activemq.util.ThreadPoolUtils | ActiveMQ BrokerService[localhost] Task-5 2013-11-05 16:12:41,074 | DEBUG | Stopped transport: tcp://10.8.20.9:46775 | org.apache.activemq.broker.TransportConnection | ActiveMQ BrokerService[localhost] Task-5 2013-11-05 16:12:41,074 | DEBUG | Connection Stopped: tcp://10.8.20.9:46775 | org.apache.activemq.broker.TransportConnection | ActiveMQ BrokerService[localhost] Task-5 2013-11-05 16:12:41,902 | DEBUG | Sending: WireFormatInfo { version=9, properties={MaxFrameSize=9223372036854775807, CacheSize=1024, CacheEnabled=true, SizePrefixDisabled=false, MaxInactivityDurationInitalDelay=10000, TcpNoDelayEnabled=true, MaxInactivityDuration=30000, TightEncodingEnabled=true, StackTraceEnabled=true}, magic=[A,c,t,i,v,e,M,Q]} | org.apache.activemq.transport.WireFormatNegotiator | ActiveMQ BrokerService[localhost] Task-5 So the question is: how can I find out the process that is trying to connect to my ActiveMQ (from localhost) every 2 seconds?

    Read the article

  • mysql: Bind on unix socket: Permission denied

    - by Alex
    Can't start mysql with: sudo /usr/bin/mysqld_safe --datadir=/srv/mysql/myDB --log-error=/srv/mysql/logs/mysqld-myDB.log --pid-file=/srv/mysql/pids/mysqld-myDB.pid --user=mysql --socket=/srv/mysql/sockets/mysql-myDB.sock --port=3700 120222 13:40:48 mysqld_safe Starting mysqld daemon with databases from /srv/mysql/myDB 120222 13:40:54 mysqld_safe mysqld from pid file /srv/mysql/pids/mysqld-myDB.pid ended /srv/mysql/logs/mysqld-myDB.log: 120222 13:43:53 mysqld_safe Starting mysqld daemon with databases from /srv/mysql/myDB 120222 13:43:53 [Note] Plugin 'FEDERATED' is disabled. /usr/sbin/mysqld: Table 'plugin' is read only 120222 13:43:53 [ERROR] Can't open the mysql.plugin table. Please run mysql_upgrade to create it. 120222 13:43:53 InnoDB: Completed initialization of buffer pool 120222 13:43:53 InnoDB: Started; log sequence number 32 4232720908 120222 13:43:53 [ERROR] Can't start server : Bind on unix socket: Permission denied 120222 13:43:53 [ERROR] Do you already have another mysqld server running on socket: /srv/mysql/sockets/mysql-myDB.sock ? 120222 13:43:53 [ERROR] Aborting 120222 13:43:53 InnoDB: Starting shutdown... One instance mysqld is running: $ ps aux | grep mysql mysql 1093 0.0 0.2 169972 18700 ? Ssl 11:50 0:02 /usr/sbin/mysqld $ Port 3700 is available: $ netstat -a | grep 3700 $ Directory with sockets is empty: $ ls /srv/mysql/sockets/ $ There are all permissions: $ ls -l /srv/mysql/ total 20 drwxrwxrwx 2 mysql mysql 4096 2012-02-22 13:28 logs drwxrwxrwx 13 mysql mysql 4096 2012-02-22 13:44 myDB drwxrwxrwx 2 mysql mysql 4096 2012-02-22 12:55 pids drwxrwxrwx 2 mysql mysql 4096 2012-02-22 12:55 sockets drwxrwxrwx 2 mysql mysql 4096 2012-02-22 13:25 version Apparmor config: $cat /etc/apparmor.d/usr.sbin.mysqld # vim:syntax=apparmor # Last Modified: Tue Jun 19 17:37:30 2007 #include <tunables/global> /usr/sbin/mysqld flags=(complain) { #include <abstractions/base> #include <abstractions/nameservice> #include <abstractions/user-tmp> #include <abstractions/mysql> #include <abstractions/winbind> capability dac_override, capability sys_resource, capability setgid, capability setuid, network tcp, /etc/hosts.allow r, /etc/hosts.deny r, /etc/mysql/*.pem r, /etc/mysql/conf.d/ r, /etc/mysql/conf.d/* r, /etc/mysql/*.cnf r, /usr/lib/mysql/plugin/ r, /usr/lib/mysql/plugin/*.so* mr, /usr/sbin/mysqld mr, /usr/share/mysql/** r, /var/log/mysql.log rw, /var/log/mysql.err rw, /var/lib/mysql/ r, /var/lib/mysql/** rwk, /var/log/mysql/ r, /var/log/mysql/* rw, /{,var/}run/mysqld/mysqld.pid w, /{,var/}run/mysqld/mysqld.sock w, /srv/mysql/ r, /srv/mysql/** rwk, /sys/devices/system/cpu/ r, # Site-specific additions and overrides. See local/README for details. #include <local/usr.sbin.mysqld> } Any suggestions? UPD1: $ touch /srv/mysql/sockets/mysql-myDB.sock $ sudo chown mysql:mysql /srv/mysql/sockets/mysql-myDB.sock $ ls -l /srv/mysql/sockets/mysql-myDB.sock -rw-rw-r-- 1 mysql mysql 0 2012-02-22 14:29 /srv/mysql/sockets/mysql-myDB.sock $ sudo /usr/bin/mysqld_safe --datadir=/srv/mysql/myDB --log-error=/srv/mysql/logs/mysqld-myDB.log --pid-file=/srv/mysql/pids/mysqld-myDB.pid --user=mysql --socket=/srv/mysql/sockets/mysql-myDB.sock --port=3700 120222 14:30:18 mysqld_safe Can't log to error log and syslog at the same time. Remove all --log-error configuration options for --syslog to take effect. 120222 14:30:18 mysqld_safe Logging to '/srv/mysql/logs/mysqld-myDB.log'. 120222 14:30:18 mysqld_safe Starting mysqld daemon with databases from /srv/mysqlmyDB 120222 14:30:24 mysqld_safe mysqld from pid file /srv/mysql/pids/mysqld-myDB.pid ended $ ls -l /srv/mysql/sockets/mysql-myDB.sock ls: cannot access /srv/mysql/sockets/mysql-myDB.sock: No such file or directory $ UPD2: $ sudo netstat -lnp | grep mysql tcp 0 0 0.0.0.0:3306 0.0.0.0:* LISTEN 1093/mysqld unix 2 [ ACC ] STREAM LISTENING 5912 1093/mysqld /var/run/mysqld/mysqld.sock $ sudo lsof | grep /srv/mysql/sockets/mysql-myDB.sock lsof: WARNING: can't stat() fuse.gvfs-fuse-daemon file system /home/sears/.gvfs Output information may be incomplete. UPD3: $ cat /etc/mysql/my.cnf # # The MySQL database server configuration file. # # You can copy this to one of: # - "/etc/mysql/my.cnf" to set global options, # - "~/.my.cnf" to set user-specific options. # # One can use all long options that the program supports. # Run program with --help to get a list of available options and with # --print-defaults to see which it would actually understand and use. # # For explanations see # http://dev.mysql.com/doc/mysql/en/server-system-variables.html # This will be passed to all mysql clients # It has been reported that passwords should be enclosed with ticks/quotes # escpecially if they contain "#" chars... # Remember to edit /etc/mysql/debian.cnf when changing the socket location. [client] port = 3306 socket = /var/run/mysqld/mysqld.sock # Here is entries for some specific programs # The following values assume you have at least 32M ram # This was formally known as [safe_mysqld]. Both versions are currently parsed. [mysqld_safe] socket = /var/run/mysqld/mysqld.sock nice = 0 [mysqld] # # * Basic Settings # # # * IMPORTANT # If you make changes to these settings and your system uses apparmor, you may # also need to also adjust /etc/apparmor.d/usr.sbin.mysqld. # user = mysql socket = /var/run/mysqld/mysqld.sock port = 3306 basedir = /usr datadir = /var/lib/mysql tmpdir = /tmp skip-external-locking # # Instead of skip-networking the default is now to listen only on # localhost which is more compatible and is not less secure. #bind-address = 127.0.0.1 # # * Fine Tuning # key_buffer = 16M max_allowed_packet = 16M thread_stack = 192K thread_cache_size = 8 # This replaces the startup script and checks MyISAM tables if needed # the first time they are touched myisam-recover = BACKUP #max_connections = 100 #table_cache = 64 #thread_concurrency = 10 # # * Query Cache Configuration # query_cache_limit = 1M query_cache_size = 16M # # * Logging and Replication # # Both location gets rotated by the cronjob. # Be aware that this log type is a performance killer. # As of 5.1 you can enable the log at runtime! #general_log_file = /var/log/mysql/mysql.log #general_log = 1 log_error = /var/log/mysql/error.log # Here you can see queries with especially long duration #log_slow_queries = /var/log/mysql/mysql-slow.log #long_query_time = 2 #log-queries-not-using-indexes # # The following can be used as easy to replay backup logs or for replication. # note: if you are setting up a replication slave, see README.Debian about # other settings you may need to change. #server-id = 1 #log_bin = /var/log/mysql/mysql-bin.log expire_logs_days = 10 max_binlog_size = 100M #binlog_do_db = include_database_name #binlog_ignore_db = include_database_name # # * InnoDB # # InnoDB is enabled by default with a 10MB datafile in /var/lib/mysql/. # Read the manual for more InnoDB related options. There are many! # # * Security Features # # Read the manual, too, if you want chroot! # chroot = /var/lib/mysql/ # # For generating SSL certificates I recommend the OpenSSL GUI "tinyca". # # ssl-ca=/etc/mysql/cacert.pem # ssl-cert=/etc/mysql/server-cert.pem # ssl-key=/etc/mysql/server-key.pem [mysqldump] quick quote-names max_allowed_packet = 16M [mysql] #no-auto-rehash # faster start of mysql but no tab completition [isamchk] key_buffer = 16M # # * IMPORTANT: Additional settings that can override those from this file! # The files must end with '.cnf', otherwise they'll be ignored. # !includedir /etc/mysql/conf.d/

    Read the article

  • Fedora error log file

    - by user111196
    I am running a java application using this wrapper service yajsw. The problem it just stopped without any error in its logs file. So I was wondering will there be any system log file which will indicate the cause of it going down? Partial of the log file. Apr 6 00:12:20 localhost kernel: imklog 3.22.1, log source = /proc/kmsg started. Apr 6 00:12:20 localhost rsyslogd: [origin software="rsyslogd" swVersion="3.22.1" x-pid="2234" x-info="http://www.rsyslog.com"] (re)start Apr 6 00:12:20 localhost kernel: Initializing cgroup subsys cpuset Apr 6 00:12:20 localhost kernel: Initializing cgroup subsys cpu Apr 6 00:12:20 localhost kernel: Linux version 2.6.27.41-170.2.117.fc10.x86_64 ([email protected]) (gcc version 4.3.2 20081105 (Red Hat 4.3.2-7) (GCC) ) #1 SMP Thu Dec 10 10:36:29 EST 2009 Apr 6 00:12:20 localhost kernel: Command line: ro root=UUID=722ebf87-437f-4634-9c68-a82d157fa948 rhgb quiet Apr 6 00:12:20 localhost kernel: KERNEL supported cpus: Apr 6 00:12:20 localhost kernel: Intel GenuineIntel Apr 6 00:12:20 localhost kernel: AMD AuthenticAMD Apr 6 00:12:20 localhost kernel: Centaur CentaurHauls Apr 6 00:12:20 localhost kernel: BIOS-provided physical RAM map: Apr 6 00:12:20 localhost kernel: BIOS-e820: 0000000000000000 - 00000000000a0000 (usable) Apr 6 00:12:20 localhost kernel: BIOS-e820: 0000000000100000 - 00000000cfb50000 (usable) Apr 6 00:12:20 localhost kernel: BIOS-e820: 00000000cfb50000 - 00000000cfb66000 (reserved) Apr 6 00:12:20 localhost kernel: BIOS-e820: 00000000cfb66000 - 00000000cfb85c00 (ACPI data) Apr 6 00:12:20 localhost kernel: BIOS-e820: 00000000cfb85c00 - 00000000d0000000 (reserved) Apr 6 00:12:20 localhost kernel: BIOS-e820: 00000000e0000000 - 00000000f0000000 (reserved) Apr 6 00:12:20 localhost kernel: BIOS-e820: 00000000fe000000 - 0000000100000000 (reserved) Apr 6 00:12:20 localhost kernel: BIOS-e820: 0000000100000000 - 0000000330000000 (usable) Apr 6 00:12:20 localhost kernel: DMI 2.5 present. Apr 6 00:12:20 localhost kernel: last_pfn = 0x330000 max_arch_pfn = 0x3ffffffff Apr 6 00:12:20 localhost kernel: x86 PAT enabled: cpu 0, old 0x7040600070406, new 0x7010600070106 Apr 6 00:12:20 localhost kernel: last_pfn = 0xcfb50 max_arch_pfn = 0x3ffffffff Apr 6 00:12:20 localhost kernel: init_memory_mapping Apr 6 00:12:20 localhost kernel: last_map_addr: cfb50000 end: cfb50000 Apr 6 00:12:20 localhost kernel: init_memory_mapping Apr 6 00:12:20 localhost kernel: last_map_addr: 330000000 end: 330000000 Apr 6 00:12:20 localhost kernel: RAMDISK: 37bfc000 - 37fef6c8 Apr 6 00:12:20 localhost kernel: ACPI: RSDP 000F21B0, 0024 (r2 DELL ) Apr 6 00:12:20 localhost kernel: ACPI: XSDT 000F224C, 0084 (r1 DELL PE_SC3 1 DELL 1) Apr 6 00:12:20 localhost kernel: ACPI: FACP CFB83524, 00F4 (r3 DELL PE_SC3 1 DELL 1) Apr 6 00:12:20 localhost kernel: ACPI: DSDT CFB66000, 4974 (r1 DELL PE_SC3 1 INTL 20050624) Apr 6 00:12:20 localhost kernel: ACPI: FACS CFB85C00, 0040 Apr 6 00:12:20 localhost kernel: ACPI: APIC CFB83078, 00B6 (r1 DELL PE_SC3 1 DELL 1) Apr 6 00:12:20 localhost kernel: ACPI: SPCR CFB83130, 0050 (r1 DELL PE_SC3 1 DELL 1) Apr 6 00:12:20 localhost kernel: ACPI: HPET CFB83184, 0038 (r1 DELL PE_SC3 1 DELL 1) Apr 6 00:12:20 localhost kernel: ACPI: MCFG CFB831C0, 003C (r1 DELL PE_SC3 1 DELL 1) Apr 6 00:12:20 localhost kernel: ACPI: WD__ CFB83200, 0134 (r1 DELL PE_SC3 1 DELL 1) Apr 6 00:12:20 localhost kernel: ACPI: SLIC CFB83338, 0176 (r1 DELL PE_SC3 1 DELL 1) Apr 6 00:12:20 localhost kernel: ACPI: ERST CFB6AAF4, 0210 (r1 DELL PE_SC3 1 DELL 1) Apr 6 00:12:20 localhost kernel: ACPI: HEST CFB6AD04, 027C (r1 DELL PE_SC3 1 DELL 1) Apr 6 00:12:20 localhost kernel: ACPI: BERT CFB6A974, 0030 (r1 DELL PE_SC3 1 DELL 1) Apr 6 00:12:20 localhost kernel: ACPI: EINJ CFB6A9A4, 0150 (r1 DELL PE_SC3 1 DELL 1) Apr 6 00:12:20 localhost kernel: ACPI: TCPA CFB834BC, 0064 (r1 DELL PE_SC3 1 DELL 1) Apr 6 00:12:20 localhost kernel: No NUMA configuration found Apr 6 00:12:20 localhost kernel: Faking a node at 0000000000000000-0000000330000000 Apr 6 00:12:20 localhost kernel: Bootmem setup node 0 0000000000000000-0000000330000000 Apr 6 00:12:20 localhost kernel: NODE_DATA [0000000000015000 - 0000000000029fff] Apr 6 00:12:20 localhost kernel: bootmap [000000000002a000 - 000000000008ffff] pages 66 Apr 6 00:12:20 localhost kernel: (7 early reservations) ==> bootmem [0000000000 - 0330000000] Apr 6 00:12:20 localhost kernel: #0 [0000000000 - 0000001000] BIOS data page ==> [0000000000 - 0000001000] Apr 6 00:12:20 localhost kernel: #1 [0000006000 - 0000008000] TRAMPOLINE ==> [0000006000 - 0000008000] Apr 6 00:12:20 localhost kernel: #2 [0000200000 - 0000a310cc] TEXT DATA BSS ==> [0000200000 - 0000a310cc] Apr 6 00:12:20 localhost kernel: #3 [0037bfc000 - 0037fef6c8] RAMDISK ==> [0037bfc000 - 0037fef6c8] Apr 6 00:12:20 localhost kernel: #4 [000009f000 - 0000100000] BIOS reserved ==> [000009f000 - 0000100000] Apr 6 00:12:20 localhost kernel: #5 [0000008000 - 000000c000] PGTABLE ==> [0000008000 - 000000c000] Apr 6 00:12:20 localhost kernel: #6 [000000c000 - 0000015000] PGTABLE ==> [000000c000 - 0000015000] Apr 6 00:12:20 localhost kernel: found SMP MP-table at [ffff8800000fe710] 000fe710 Apr 6 00:12:20 localhost kernel: Zone PFN ranges: Apr 6 00:12:20 localhost kernel: DMA 0x00000000 -> 0x00001000 Apr 6 00:12:20 localhost kernel: DMA32 0x00001000 -> 0x00100000 Apr 6 00:12:20 localhost kernel: Normal 0x00100000 -> 0x00330000 Apr 6 00:12:20 localhost kernel: Movable zone start PFN for each node Apr 6 00:12:20 localhost kernel: early_node_map[3] active PFN ranges Apr 6 00:12:20 localhost kernel: 0: 0x00000000 -> 0x000000a0 Apr 6 00:12:20 localhost kernel: 0: 0x00000100 -> 0x000cfb50 Apr 6 00:12:20 localhost kernel: 0: 0x00100000 -> 0x00330000 Apr 6 00:12:20 localhost kernel: ACPI: PM-Timer IO Port: 0x808 Apr 6 00:12:20 localhost kernel: ACPI: LAPIC (acpi_id[0x01] lapic_id[0x00] enabled) Apr 6 00:12:20 localhost kernel: ACPI: LAPIC (acpi_id[0x02] lapic_id[0x04] enabled) Apr 6 00:12:20 localhost kernel: ACPI: LAPIC (acpi_id[0x03] lapic_id[0x02] enabled) Apr 6 00:12:20 localhost kernel: ACPI: LAPIC (acpi_id[0x04] lapic_id[0x06] enabled) Apr 6 00:12:20 localhost kernel: ACPI: LAPIC (acpi_id[0x05] lapic_id[0x01] enabled) Apr 6 00:12:20 localhost kernel: ACPI: LAPIC (acpi_id[0x06] lapic_id[0x05] enabled) Apr 6 00:12:20 localhost kernel: ACPI: LAPIC (acpi_id[0x07] lapic_id[0x03] enabled) Apr 6 00:12:20 localhost kernel: ACPI: LAPIC (acpi_id[0x08] lapic_id[0x07] enabled) Apr 6 00:12:20 localhost kernel: ACPI: LAPIC_NMI (acpi_id[0xff] high edge lint[0x1]) Apr 6 00:12:20 localhost kernel: ACPI: IOAPIC (id[0x08] address[0xfec00000] gsi_base[0]) Apr 6 00:12:20 localhost kernel: IOAPIC[0]: apic_id 8, version 0, address 0xfec00000, GSI 0-23 Apr 6 00:12:20 localhost kernel: ACPI: IOAPIC (id[0x09] address[0xfec81000] gsi_base[64]) Apr 6 00:12:20 localhost kernel: IOAPIC[1]: apic_id 9, version 0, address 0xfec81000, GSI 64-87 Apr 6 00:12:20 localhost kernel: ACPI: IOAPIC (id[0x0a] address[0xfec84000] gsi_base[160]) Apr 6 00:12:20 localhost kernel: IOAPIC[2]: apic_id 10, version 0, address 0xfec84000, GSI 160-183 Apr 6 00:12:20 localhost kernel: ACPI: IOAPIC (id[0x0b] address[0xfec84800] gsi_base[224]) Apr 6 00:12:20 localhost kernel: IOAPIC[3]: apic_id 11, version 0, address 0xfec84800, GSI 224-247 Apr 6 00:12:20 localhost kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 0 global_irq 2 dfl dfl) Apr 6 00:12:20 localhost kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 9 global_irq 9 high level) Apr 6 00:12:20 localhost kernel: Setting APIC routing to flat Apr 6 00:12:20 localhost kernel: ACPI: HPET id: 0x8086a201 base: 0xfed00000 Apr 6 00:12:20 localhost kernel: Using ACPI (MADT) for SMP configuration information Apr 6 00:12:20 localhost kernel: SMP: Allowing 8 CPUs, 0 hotplug CPUs Apr 6 00:12:20 localhost kernel: PM: Registered nosave memory: 00000000000a0000 - 0000000000100000 Apr 6 00:12:20 localhost kernel: PM: Registered nosave memory: 00000000cfb50000 - 00000000cfb66000 Apr 6 00:12:20 localhost kernel: PM: Registered nosave memory: 00000000cfb66000 - 00000000cfb85000 Apr 6 00:12:20 localhost kernel: PM: Registered nosave memory: 00000000cfb85000 - 00000000cfb86000 Apr 6 00:12:20 localhost kernel: PM: Registered nosave memory: 00000000cfb86000 - 00000000d0000000 Apr 6 00:12:20 localhost kernel: PM: Registered nosave memory: 00000000d0000000 - 00000000e0000000 Apr 6 00:12:20 localhost kernel: PM: Registered nosave memory: 00000000e0000000 - 00000000f0000000 Apr 6 00:12:20 localhost kernel: PM: Registered nosave memory: 00000000f0000000 - 00000000fe000000 Apr 6 00:12:20 localhost kernel: PM: Registered nosave memory: 00000000fe000000 - 0000000100000000 Apr 6 00:12:20 localhost kernel: Allocating PCI resources starting at d1000000 (gap: d0000000:10000000) Apr 6 00:12:20 localhost kernel: PERCPU: Allocating 65184 bytes of per cpu data Apr 6 00:12:20 localhost kernel: Built 1 zonelists in Zone order, mobility grouping on. Total pages: 3096524 Apr 6 00:12:20 localhost kernel: Policy zone: Normal Apr 6 00:12:20 localhost kernel: Kernel command line: ro root=UUID=722ebf87-437f-4634-9c68-a82d157fa948 rhgb quiet Apr 6 00:12:20 localhost kernel: Initializing CPU#0 Apr 6 00:12:20 localhost kernel: PID hash table entries: 4096 (order: 12, 32768 bytes) Apr 6 00:12:20 localhost kernel: Extended CMOS year: 2000 Apr 6 00:12:20 localhost kernel: TSC: PIT calibration confirmed by PMTIMER. Apr 6 00:12:20 localhost kernel: TSC: using PMTIMER calibration value Apr 6 00:12:20 localhost kernel: Detected 1994.992 MHz processor. Apr 6 00:12:20 localhost kernel: Console: colour VGA+ 80x25 Apr 6 00:12:20 localhost kernel: console [tty0] enabled Apr 6 00:12:20 localhost kernel: Checking aperture... Apr 6 00:12:20 localhost kernel: No AGP bridge found Apr 6 00:12:20 localhost kernel: PCI-DMA: Using software bounce buffering for IO (SWIOTLB) Apr 6 00:12:20 localhost kernel: Placing software IO TLB between 0x20000000 - 0x24000000 Apr 6 00:12:20 localhost kernel: Memory: 12324244k/13369344k available (3311k kernel code, 253484k reserved, 1844k data, 1296k init) Apr 6 00:12:20 localhost kernel: SLUB: Genslabs=13, HWalign=64, Order=0-3, MinObjects=0, CPUs=8, Nodes=1 Apr 6 00:12:20 localhost kernel: Calibrating delay loop (skipped), value calculated using timer frequency.. 3989.98 BogoMIPS (lpj=1994992) Apr 6 00:12:20 localhost kernel: Security Framework initialized Apr 6 00:12:20 localhost kernel: SELinux: Initializing. Apr 6 00:12:20 localhost kernel: Dentry cache hash table entries: 2097152 (order: 12, 16777216 bytes) Apr 6 00:12:20 localhost kernel: Inode-cache hash table entries: 1048576 (order: 11, 8388608 bytes) Apr 6 00:12:20 localhost kernel: Mount-cache hash table entries: 256 Apr 6 00:12:20 localhost kernel: Initializing cgroup subsys ns Apr 6 00:12:20 localhost kernel: Initializing cgroup subsys cpuacct Apr 6 00:12:20 localhost kernel: Initializing cgroup subsys devices Apr 6 00:12:20 localhost kernel: CPU: L1 I cache: 32K, L1 D cache: 32K Apr 6 00:12:20 localhost kernel: CPU: L2 cache: 4096K Apr 6 00:12:20 localhost kernel: CPU 0/0 -> Node 0 Apr 6 00:12:20 localhost kernel: CPU: Physical Processor ID: 0 Apr 6 00:12:20 localhost kernel: CPU: Processor Core ID: 0 Apr 6 00:12:20 localhost kernel: CPU0: Thermal monitoring enabled (TM1) Apr 6 00:12:20 localhost kernel: using mwait in idle threads. Apr 6 00:12:20 localhost kernel: ACPI: Core revision 20080609 Apr 6 00:12:20 localhost kernel: ..TIMER: vector=0x30 apic1=0 pin1=2 apic2=-1 pin2=-1 Apr 6 00:12:20 localhost kernel: CPU0: Intel(R) Xeon(R) CPU E5335 @ 2.00GHz stepping 07 Apr 6 00:12:20 localhost kernel: Using local APIC timer interrupts. Apr 6 00:12:20 localhost kernel: Detected 20.781 MHz APIC timer. Apr 6 00:12:20 localhost kernel: Booting processor 1/4 ip 6000 Apr 6 00:12:20 localhost kernel: Initializing CPU#1 Apr 6 00:12:20 localhost kernel: Calibrating delay using timer specific routine.. 3990.05 BogoMIPS (lpj=1995026) Apr 6 00:12:20 localhost kernel: CPU: L1 I cache: 32K, L1 D cache: 32K Apr 6 00:12:20 localhost kernel: CPU: L2 cache: 4096K Apr 6 00:12:20 localhost kernel: CPU 1/4 -> Node 0 Apr 6 00:12:20 localhost kernel: CPU: Physical Processor ID: 1 Apr 6 00:12:20 localhost kernel: CPU: Processor Core ID: 0 Apr 6 00:12:20 localhost kernel: CPU1: Thermal monitoring enabled (TM2) Apr 6 00:12:20 localhost kernel: x86 PAT enabled: cpu 1, old 0x7040600070406, new 0x7010600070106 Apr 6 00:12:20 localhost kernel: CPU1: Intel(R) Xeon(R) CPU E5335 @ 2.00GHz stepping 07 Apr 6 00:12:20 localhost kernel: checking TSC synchronization [CPU#0 -> CPU#1]: passed. Apr 6 00:12:20 localhost kernel: Booting processor 2/2 ip 6000 Apr 6 00:12:20 localhost kernel: Initializing CPU#2 Apr 6 00:12:20 localhost kernel: Calibrating delay using timer specific routine.. 3990.05 BogoMIPS (lpj=1995029)

    Read the article

  • Compat Wireless Drivers Centrino N-2230

    - by user2699451
    So I am using linux and am having trouble installing the Compat Wireless drivers Hardware: Intel Centrino N-2230 OS: Linux Mint 64bit (kernel 13.08-generic) I followed this link http://www.mathyvanhoef.com/2012/09/compat-wireless-injection-patch-for.html Output: apt-get install linux-headers-$(uname -r) Reading package lists... Done Building dependency tree Reading state information... Done linux-headers-3.8.0-19-generic is already the newest version. 0 upgraded, 0 newly installed, 0 to remove and 19 not upgraded. charles-W55xEU compat-wireless-2010-10-16 # cd ~ charles-W55xEU ~ # dir adt-bundle-linux-x86_64-20130917.zip Desktop known_hosts_backup charles-W55xEU ~ # wget http://www.orbit-lab.org/kernel/compat-wireless-3-stable/v3.6/compat-wireless-3.6.2-1-snp.tar.bz2 --2013-10-29 10:28:23-- http://www.orbit-lab.org/kernel/compat-wireless-3-stable/v3.6/compat-wireless-3.6.2-1-snp.tar.bz2 Resolving www.orbit-lab.org (www.orbit-lab.org)... 128.6.192.131 Connecting to www.orbit-lab.org (www.orbit-lab.org)|128.6.192.131|:80... connected. HTTP request sent, awaiting response... 200 OK Length: 4443700 (4,2M) [application/x-bzip2] Saving to: ‘compat-wireless-3.6.2-1-snp.tar.bz2’ 100%[======================================>] 4 443 700 13,5KB/s in 11m 3s 2013-10-29 10:39:27 (6,55 KB/s) - ‘compat-wireless-3.6.2-1-snp.tar.bz2’ saved [4443700/4443700] charles-W55xEU ~ # tar -xf compat-wireless-3.6.2-1-snp.tar.bz2 charles-W55xEU ~ # cd compat-wireless-3.6-rc6-1 bash: cd: compat-wireless-3.6-rc6-1: No such file or directory charles-W55xEU ~ # dir adt-bundle-linux-x86_64-20130917.zip Desktop compat-wireless-3.6.2-1-snp known_hosts_backup compat-wireless-3.6.2-1-snp.tar.bz2 charles-W55xEU ~ # cd compat-wireless-3.6.2-1-snp/ charles-W55xEU compat-wireless-3.6.2-1-snp # dir code-metrics.txt defconfigs linux-next-pending pending-stable compat drivers MAINTAINERS README config.mk enable-older-kernels Makefile scripts COPYRIGHT include net udev crap linux-next-cherry-picks patches charles-W55xEU compat-wireless-3.6.2-1-snp # wget http://patches.aircrack-ng.org/mac80211.compat08082009.wl_frag+ack_v1.patch --2013-10-29 10:40:52-- http://patches.aircrack-ng.org/mac80211.compat08082009.wl_frag+ack_v1.patch Resolving patches.aircrack-ng.org (patches.aircrack-ng.org)... 213.186.33.2, 2001:41d0:1:1b00:213:186:33:2 Connecting to patches.aircrack-ng.org (patches.aircrack-ng.org)|213.186.33.2|:80... connected. HTTP request sent, awaiting response... 200 OK Length: 1049 (1,0K) [text/plain] Saving to: ‘mac80211.compat08082009.wl_frag+ack_v1.patch’ 100%[======================================>] 1 049 --.-K/s in 0s 2013-10-29 10:40:56 (180 MB/s) - ‘mac80211.compat08082009.wl_frag+ack_v1.patch’ saved [1049/1049] charles-W55xEU compat-wireless-3.6.2-1-snp # patch -p1 < mac80211.compat08082009.wl_frag+ack_v1.patch patching file net/mac80211/tx.c Hunk #1 succeeded at 792 (offset 115 lines). charles-W55xEU compat-wireless-3.6.2-1-snp # wget -Ocompatwireless_chan_qos_frag.patch http://pastie.textmate.org/pastes/4882675/download --2013-10-29 10:43:18-- http://pastie.textmate.org/pastes/4882675/download Resolving pastie.textmate.org (pastie.textmate.org)... 178.79.137.125 Connecting to pastie.textmate.org (pastie.textmate.org)|178.79.137.125|:80... connected. HTTP request sent, awaiting response... 301 Moved Permanently Location: http://pastie.org/pastes/4882675/download [following] --2013-10-29 10:43:20-- http://pastie.org/pastes/4882675/download Resolving pastie.org (pastie.org)... 96.126.119.119 Connecting to pastie.org (pastie.org)|96.126.119.119|:80... connected. HTTP request sent, awaiting response... 200 OK Length: 2036 (2,0K) [application/octet-stream] Saving to: ‘compatwireless_chan_qos_frag.patch’ 100%[======================================>] 2 036 --.-K/s in 0,001s 2013-10-29 10:43:21 (3,35 MB/s) - ‘compatwireless_chan_qos_frag.patch’ saved [2036/2036] charles-W55xEU compat-wireless-3.6.2-1-snp # patch -p1 < compatwireless_chan_qos_frag.patch patching file drivers/net/wireless/rtl818x/rtl8187/dev.c patching file net/mac80211/tx.c Hunk #1 succeeded at 1495 (offset 8 lines). patching file net/wireless/chan.c charles-W55xEU compat-wireless-3.6.2-1-snp # make ./scripts/gen-compat-autoconf.sh /root/compat-wireless-3.6.2-1-snp/.config /root/compat-wireless-3.6.2-1-snp/config.mk > include/linux/compat_autoconf.h make -C /lib/modules/3.8.0-19-generic/build M=/root/compat-wireless-3.6.2-1-snp modules make[1]: Entering directory `/usr/src/linux-headers-3.8.0-19-generic' CC [M] /root/compat-wireless-3.6.2-1-snp/compat/main.o LD [M] /root/compat-wireless-3.6.2-1-snp/compat/compat.o CC [M] /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.o In file included from /root/compat-wireless-3.6.2-1-snp/include/linux/bcma/bcma.h:8:0, from /root/compat-wireless-3.6.2-1-snp/drivers/bcma/bcma_private.h:8, from /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:8: /root/compat-wireless-3.6.2-1-snp/include/linux/bcma/bcma_driver_pci.h:217:23: error: expected ‘=’, ‘,’, ‘;’, ‘asm’ or ‘__attribute__’ before ‘bcma_core_pci_init’ In file included from /root/compat-wireless-3.6.2-1-snp/include/linux/bcma/bcma.h:10:0, from /root/compat-wireless-3.6.2-1-snp/drivers/bcma/bcma_private.h:8, from /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:8: /root/compat-wireless-3.6.2-1-snp/include/linux/bcma/bcma_driver_gmac_cmn.h:95:23: error: expected ‘=’, ‘,’, ‘;’, ‘asm’ or ‘__attribute__’ before ‘bcma_core_gmac_cmn_init’ In file included from /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:8:0: /root/compat-wireless-3.6.2-1-snp/drivers/bcma/bcma_private.h:25:15: error: expected ‘=’, ‘,’, ‘;’, ‘asm’ or ‘__attribute__’ before ‘bcma_bus_register’ /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:152:15: error: expected ‘=’, ‘,’, ‘;’, ‘asm’ or ‘__attribute__’ before ‘bcma_bus_register’ /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:17:21: warning: ‘bcma_bus_next_num’ defined but not used [-Wunused-variable] /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:93:12: warning: ‘bcma_register_cores’ defined but not used [-Wunused-function] make[3]: *** [/root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.o] Error 1 make[2]: *** [/root/compat-wireless-3.6.2-1-snp/drivers/bcma] Error 2 make[1]: *** [_module_/root/compat-wireless-3.6.2-1-snp] Error 2 make[1]: Leaving directory `/usr/src/linux-headers-3.8.0-19-generic' make: *** [modules] Error 2 charles-W55xEU compat-wireless-3.6.2-1-snp # make install Warning: You may or may not need to update your initframfs, you should if any of the modules installed are part of your initramfs. To add support for your distribution to do this automatically send a patch against ./scripts/update-initramfs. If your distribution does not require this send a patch against the '/usr/bin/lsb_release -i -s': LinuxMint tag for your distribution to avoid this warning. make -C /lib/modules/3.8.0-19-generic/build M=/root/compat-wireless-3.6.2-1-snp modules make[1]: Entering directory `/usr/src/linux-headers-3.8.0-19-generic' CC [M] /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.o In file included from /root/compat-wireless-3.6.2-1-snp/include/linux/bcma/bcma.h:8:0, from /root/compat-wireless-3.6.2-1-snp/drivers/bcma/bcma_private.h:8, from /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:8: /root/compat-wireless-3.6.2-1-snp/include/linux/bcma/bcma_driver_pci.h:217:23: error: expected ‘=’, ‘,’, ‘;’, ‘asm’ or ‘__attribute__’ before ‘bcma_core_pci_init’ In file included from /root/compat-wireless-3.6.2-1-snp/include/linux/bcma/bcma.h:10:0, from /root/compat-wireless-3.6.2-1-snp/drivers/bcma/bcma_private.h:8, from /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:8: /root/compat-wireless-3.6.2-1-snp/include/linux/bcma/bcma_driver_gmac_cmn.h:95:23: error: expected ‘=’, ‘,’, ‘;’, ‘asm’ or ‘__attribute__’ before ‘bcma_core_gmac_cmn_init’ In file included from /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:8:0: /root/compat-wireless-3.6.2-1-snp/drivers/bcma/bcma_private.h:25:15: error: expected ‘=’, ‘,’, ‘;’, ‘asm’ or ‘__attribute__’ before ‘bcma_bus_register’ /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:152:15: error: expected ‘=’, ‘,’, ‘;’, ‘asm’ or ‘__attribute__’ before ‘bcma_bus_register’ /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:17:21: warning: ‘bcma_bus_next_num’ defined but not used [-Wunused-variable] /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:93:12: warning: ‘bcma_register_cores’ defined but not used [-Wunused-function] make[3]: *** [/root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.o] Error 1 make[2]: *** [/root/compat-wireless-3.6.2-1-snp/drivers/bcma] Error 2 make[1]: *** [_module_/root/compat-wireless-3.6.2-1-snp] Error 2 make[1]: Leaving directory `/usr/src/linux-headers-3.8.0-19-generic' make: *** [modules] Error 2 charles-W55xEU compat-wireless-3.6.2-1-snp # It keeps giving errors, same with other sites, I get the same errors??? I am lost, help needed

    Read the article

  • Rails + Nginx + Unicorn multiple apps

    - by Mikhail Nikalyukin
    I get the server where is currently installed two apps and i need to add another one, here is my configs. nginx.conf user www-data www-data; worker_processes 4; pid /var/run/nginx.pid; events { worker_connections 768; # multi_accept on; } http { sendfile on; tcp_nopush on; tcp_nodelay on; keepalive_timeout 65; types_hash_max_size 2048; include /etc/nginx/mime.types; default_type application/octet-stream; ## # Logging Settings ## access_log /var/log/nginx/access.log; error_log /var/log/nginx/error.log; ## # Disable unknown domains ## server { listen 80 default; server_name _; return 444; } ## # Virtual Host Configs ## include /home/ruby/apps/*/shared/config/nginx.conf; } unicorn.rb deploy_to = "/home/ruby/apps/staging.domain.com" rails_root = "#{deploy_to}/current" pid_file = "#{deploy_to}/shared/pids/unicorn.pid" socket_file= "#{deploy_to}/shared/sockets/.sock" log_file = "#{rails_root}/log/unicorn.log" err_log = "#{rails_root}/log/unicorn_error.log" old_pid = pid_file + '.oldbin' timeout 30 worker_processes 10 # ????? ???? ? ??????????? ?? ????????, ???????? ??????? ? ??????? ???? ???? listen socket_file, :backlog => 1024 pid pid_file stderr_path err_log stdout_path log_file preload_app true GC.copy_on_write_friendly = true if GC.respond_to?(:copy_on_write_friendly=) before_exec do |server| ENV["BUNDLE_GEMFILE"] = "#{rails_root}/Gemfile" end before_fork do |server, worker| defined?(ActiveRecord::Base) and ActiveRecord::Base.connection.disconnect! if File.exists?(old_pid) && server.pid != old_pid begin Process.kill("QUIT", File.read(old_pid).to_i) rescue Errno::ENOENT, Errno::ESRCH end end end after_fork do |server, worker| defined?(ActiveRecord::Base) and ActiveRecord::Base.establish_connection end Also im added capistrano to the project deploy.rb # encoding: utf-8 require 'capistrano/ext/multistage' require 'rvm/capistrano' require 'bundler/capistrano' set :stages, %w(staging production) set :default_stage, "staging" default_run_options[:pty] = true ssh_options[:paranoid] = false ssh_options[:forward_agent] = true set :scm, "git" set :user, "ruby" set :runner, "ruby" set :use_sudo, false set :deploy_via, :remote_cache set :rvm_ruby_string, '1.9.2' # Create uploads directory and link task :configure, :roles => :app do run "cp #{shared_path}/config/database.yml #{release_path}/config/database.yml" # run "ln -s #{shared_path}/db/sphinx #{release_path}/db/sphinx" # run "ln -s #{shared_path}/config/unicorn.rb #{release_path}/config/unicorn.rb" end namespace :deploy do task :restart do run "if [ -f #{unicorn_pid} ] && [ -e /proc/$(cat #{unicorn_pid}) ]; then kill -s USR2 `cat #{unicorn_pid}`; else cd #{deploy_to}/current && bundle exec unicorn_rails -c #{unicorn_conf} -E #{rails_env} -D; fi" end task :start do run "cd #{deploy_to}/current && bundle exec unicorn_rails -c #{unicorn_conf} -E #{rails_env} -D" end task :stop do run "if [ -f #{unicorn_pid} ] && [ -e /proc/$(cat #{unicorn_pid}) ]; then kill -QUIT `cat #{unicorn_pid}`; fi" end end before 'deploy:finalize_update', 'configure' after "deploy:update", "deploy:migrate", "deploy:cleanup" require './config/boot' nginx.conf in app shared path upstream staging_whotracker { server unix:/home/ruby/apps/staging.whotracker.com/shared/sockets/.sock; } server { listen 209.105.242.45; server_name beta.whotracker.com; rewrite ^/(.*) http://www.beta.whotracker.com/$1 permanent; } server { listen 209.105.242.45; server_name www.beta.hotracker.com; root /home/ruby/apps/staging.whotracker.com/current/public; location ~ ^/sitemaps/ { root /home/ruby/apps/staging.whotracker.com/current/system; if (!-f $request_filename) { break; } if (-f $request_filename) { expires -1; break; } } # cache static files :P location ~ ^/(images|javascripts|stylesheets)/ { root /home/ruby/apps/staging.whotracker.com/current/public; if ($query_string ~* "^[0-9a-zA-Z]{40}$") { expires max; break; } if (!-f $request_filename) { break; } } if ( -f /home/ruby/apps/staging.whotracker.com/shared/offline ) { return 503; } location /blog { index index.php index.html index.htm; try_files $uri $uri/ /blog/index.php?q=$uri; } location ~ \.php$ { try_files $uri =404; include /etc/nginx/fastcgi_params; fastcgi_pass unix:/var/run/php-fastcgi/php-fastcgi.socket; fastcgi_index index.php; fastcgi_param SCRIPT_FILENAME $document_root$fastcgi_script_name; } location / { proxy_set_header HTTP_REFERER $http_referer; proxy_set_header X-Real-IP $remote_addr; proxy_set_header X-Forwarded-For $proxy_add_x_forwarded_for; proxy_set_header Host $http_host; proxy_redirect off; proxy_max_temp_file_size 0; # If the file exists as a static file serve it directly without # running all the other rewite tests on it if (-f $request_filename) { break; } if (!-f $request_filename) { proxy_pass http://staging_whotracker; break; } } error_page 502 =503 @maintenance; error_page 500 504 /500.html; error_page 503 @maintenance; location @maintenance { rewrite ^(.*)$ /503.html break; } } unicorn.log executing ["/home/ruby/apps/staging.whotracker.com/shared/bundle/ruby/1.9.1/bin/unicorn_rails", "-c", "/home/ruby/apps/staging.whotracker.com/current/config/unicorn.rb", "-E", "staging", "-D", {5=>#<Kgio::UNIXServer:/home/ruby/apps/staging.whotracker.com/shared/sockets/.sock>}] (in /home/ruby/apps/staging.whotracker.com/releases/20120517114413) I, [2012-05-17T06:43:48.111717 #14636] INFO -- : inherited addr=/home/ruby/apps/staging.whotracker.com/shared/sockets/.sock fd=5 I, [2012-05-17T06:43:48.111938 #14636] INFO -- : Refreshing Gem list worker=0 ready ... master process ready ... reaped #<Process::Status: pid 2590 exit 0> worker=6 ... master complete Deploy goes successfully, but when i try to access beta.whotracker.com or ip-address i get SERVER NOT FOUND error, while others app works great. Nothing shows up in error logs. Can you please point me where is my fault?

    Read the article

  • Ubuntu server has slow performance

    - by Rich
    I have a custom built Ubuntu 11.04 server with a 6 disk software RAID 10 primary drive. On it I'm primarily running a PostgreSQL and a few other utilities that stream data from the web. I often find after a few hours of uptime the server starts to lag with all kinds of processes. For example, it may take 10-15 seconds after log-in to get a shell prompt. It might take 5-10 seconds for top to come up. An ls might take a second or two. When I look at top there is almost no CPU usage. There's a fair amount of memory used by the PostgreSQL server but not enough to bleed into swap. I have no idea where to go from here, other than to suspect the RAID10 (I've only ever had software RAID 1's before). Edit: Output from top: top - 11:56:03 up 1:46, 3 users, load average: 0.89, 0.73, 0.72 Tasks: 119 total, 1 running, 118 sleeping, 0 stopped, 0 zombie Cpu(s): 0.2%us, 0.0%sy, 0.0%ni, 93.5%id, 6.2%wa, 0.0%hi, 0.0%si, 0.0%st Mem: 16325596k total, 3478248k used, 12847348k free, 20880k buffers Swap: 19534176k total, 0k used, 19534176k free, 3041992k cached PID USER PR NI VIRT RES SHR S %CPU %MEM TIME+ COMMAND 1747 woodsp 20 0 109m 10m 4888 S 1 0.1 0:42.70 python 357 root 20 0 0 0 0 S 0 0.0 0:00.40 jbd2/sda3-8 1 root 20 0 24324 2284 1344 S 0 0.0 0:00.84 init 2 root 20 0 0 0 0 S 0 0.0 0:00.00 kthreadd 3 root 20 0 0 0 0 S 0 0.0 0:00.24 ksoftirqd/0 6 root RT 0 0 0 0 S 0 0.0 0:00.00 migration/0 7 root RT 0 0 0 0 S 0 0.0 0:00.01 watchdog/0 8 root RT 0 0 0 0 S 0 0.0 0:00.00 migration/1 10 root 20 0 0 0 0 S 0 0.0 0:00.02 ksoftirqd/1 12 root RT 0 0 0 0 S 0 0.0 0:00.01 watchdog/1 13 root RT 0 0 0 0 S 0 0.0 0:00.00 migration/2 14 root 20 0 0 0 0 S 0 0.0 0:00.00 kworker/2:0 15 root 20 0 0 0 0 S 0 0.0 0:00.00 ksoftirqd/2 16 root RT 0 0 0 0 S 0 0.0 0:00.01 watchdog/2 17 root RT 0 0 0 0 S 0 0.0 0:00.00 migration/3 18 root 20 0 0 0 0 S 0 0.0 0:00.00 kworker/3:0 19 root 20 0 0 0 0 S 0 0.0 0:00.02 ksoftirqd/3 20 root RT 0 0 0 0 S 0 0.0 0:00.01 watchdog/3 21 root 0 -20 0 0 0 S 0 0.0 0:00.00 cpuset 22 root 0 -20 0 0 0 S 0 0.0 0:00.00 khelper 23 root 20 0 0 0 0 S 0 0.0 0:00.00 kdevtmpfs 24 root 0 -20 0 0 0 S 0 0.0 0:00.00 netns 26 root 20 0 0 0 0 S 0 0.0 0:00.00 sync_supers df -h rpsharp@ncp-skookum:~$ df -h Filesystem Size Used Avail Use% Mounted on /dev/sda3 1.8T 549G 1.2T 32% / udev 7.8G 4.0K 7.8G 1% /dev tmpfs 3.2G 492K 3.2G 1% /run none 5.0M 0 5.0M 0% /run/lock none 7.8G 0 7.8G 0% /run/shm /dev/sda2 952M 128K 952M 1% /boot/efi /dev/md0 5.5T 562G 4.7T 11% /usr/local free -m psharp@ncp-skookum:~$ free -m total used free shared buffers cached Mem: 15942 3409 12533 0 20 2983 -/+ buffers/cache: 405 15537 Swap: 19076 0 19076 tail -50 /var/log/syslog Jul 3 06:31:32 ncp-skookum rsyslogd: [origin software="rsyslogd" swVersion="5.8.6" x-pid="1070" x-info="http://www.rsyslog.com"] rsyslogd was HUPed Jul 3 06:39:01 ncp-skookum CRON[14211]: (root) CMD ( [ -x /usr/lib/php5/maxlifetime ] && [ -d /var/lib/php5 ] && find /var/lib/php5/ -depth -mindepth 1 -maxdepth 1 -type f -cmin +$(/usr/lib/php5/maxlifetime) ! -execdir fuser -s {} 2>/dev/null \; -delete) Jul 3 06:40:01 ncp-skookum CRON[14223]: (smmsp) CMD (test -x /etc/init.d/sendmail && /usr/share/sendmail/sendmail cron-msp) Jul 3 07:00:01 ncp-skookum CRON[14328]: (woodsp) CMD (/home/woodsp/bin/mail_tweetupdate # email an update) Jul 3 07:00:01 ncp-skookum CRON[14327]: (smmsp) CMD (test -x /etc/init.d/sendmail && /usr/share/sendmail/sendmail cron-msp) Jul 3 07:00:28 ncp-skookum sendmail[14356]: q63E0SoZ014356: from=woodsp, size=2328, class=0, nrcpts=2, msgid=<[email protected]>, relay=woodsp@localhost Jul 3 07:00:29 ncp-skookum sm-mta[14357]: q63E0Si6014357: from=<[email protected]>, size=2569, class=0, nrcpts=2, msgid=<[email protected]>, proto=ESMTP, daemon=MTA-v4, relay=localhost [127.0.0.1] Jul 3 07:00:29 ncp-skookum sendmail[14356]: q63E0SoZ014356: to=Spencer Wood <[email protected]>,Martin Lacayo <[email protected]>, ctladdr=woodsp (1004/1005), delay=00:00:01, xdelay=00:00:01, mailer=relay, pri=62328, relay=[127.0.0.1] [127.0.0.1], dsn=2.0.0, stat=Sent (q63E0Si6014357 Message accepted for delivery) Jul 3 07:00:29 ncp-skookum sm-mta[14359]: STARTTLS=client, relay=mx3.stanford.edu., version=TLSv1/SSLv3, verify=FAIL, cipher=DHE-RSA-AES256-SHA, bits=256/256 Jul 3 07:00:29 ncp-skookum sm-mta[14359]: q63E0Si6014357: to=<[email protected]>,<[email protected]>, ctladdr=<[email protected]> (1004/1005), delay=00:00:01, xdelay=00:00:00, mailer=esmtp, pri=152569, relay=mx3.stanford.edu. [171.67.219.73], dsn=2.0.0, stat=Sent (Ok: queued as 8F3505802AC) Jul 3 07:09:08 ncp-skookum CRON[14396]: (root) CMD ( [ -x /usr/lib/php5/maxlifetime ] && [ -d /var/lib/php5 ] && find /var/lib/php5/ -depth -mindepth 1 -maxdepth 1 -type f -cmin +$(/usr/lib/php5/maxlifetime) ! -execdir fuser -s {} 2>/dev/null \; -delete) Jul 3 07:17:01 ncp-skookum CRON[14438]: (root) CMD ( cd / && run-parts --report /etc/cron.hourly) Jul 3 07:20:01 ncp-skookum CRON[14453]: (smmsp) CMD (test -x /etc/init.d/sendmail && /usr/share/sendmail/sendmail cron-msp) Jul 3 07:39:01 ncp-skookum CRON[14551]: (root) CMD ( [ -x /usr/lib/php5/maxlifetime ] && [ -d /var/lib/php5 ] && find /var/lib/php5/ -depth -mindepth 1 -maxdepth 1 -type f -cmin +$(/usr/lib/php5/maxlifetime) ! -execdir fuser -s {} 2>/dev/null \; -delete) Jul 3 07:40:01 ncp-skookum CRON[14562]: (smmsp) CMD (test -x /etc/init.d/sendmail && /usr/share/sendmail/sendmail cron-msp) Jul 3 08:00:01 ncp-skookum CRON[14668]: (smmsp) CMD (test -x /etc/init.d/sendmail && /usr/share/sendmail/sendmail cron-msp) Jul 3 08:09:01 ncp-skookum CRON[14724]: (root) CMD ( [ -x /usr/lib/php5/maxlifetime ] && [ -d /var/lib/php5 ] && find /var/lib/php5/ -depth -mindepth 1 -maxdepth 1 -type f -cmin +$(/usr/lib/php5/maxlifetime) ! -execdir fuser -s {} 2>/dev/null \; -delete) Jul 3 08:17:01 ncp-skookum CRON[14766]: (root) CMD ( cd / && run-parts --report /etc/cron.hourly) Jul 3 08:20:01 ncp-skookum CRON[14781]: (smmsp) CMD (test -x /etc/init.d/sendmail && /usr/share/sendmail/sendmail cron-msp) Jul 3 08:39:01 ncp-skookum CRON[14881]: (root) CMD ( [ -x /usr/lib/php5/maxlifetime ] && [ -d /var/lib/php5 ] && find /var/lib/php5/ -depth -mindepth 1 -maxdepth 1 -type f -cmin +$(/usr/lib/php5/maxlifetime) ! -execdir fuser -s {} 2>/dev/null \; -delete) Jul 3 08:40:01 ncp-skookum CRON[14892]: (smmsp) CMD (test -x /etc/init.d/sendmail && /usr/share/sendmail/sendmail cron-msp) Output of hdparm -t /dev/sd{a,b,c,d,e,f} This looks suspicious? /dev/sda: Timing buffered disk reads: 2 MB in 4.84 seconds = 423.39 kB/sec /dev/sdb: Timing buffered disk reads: 420 MB in 3.01 seconds = 139.74 MB/sec /dev/sdc: Timing buffered disk reads: 390 MB in 3.00 seconds = 129.87 MB/sec /dev/sdd: Timing buffered disk reads: 416 MB in 3.00 seconds = 138.51 MB/sec /dev/sde: Timing buffered disk reads: 422 MB in 3.00 seconds = 140.50 MB/sec /dev/sdf: Timing buffered disk reads: 416 MB in 3.01 seconds = 138.26 MB/sec

    Read the article

  • pasenger does not start puppet master under nginx

    - by Anadi Misra
    On the server [root@bangvmpllDA02 logs]# ruby -v ruby 1.8.7 (2011-06-30 patchlevel 352) [x86_64-linux] [root@bangvmpllDA02 logs]# puppet --version 3.0.1 and [root@bangvmpllDA02 logs]# service nginx configtest nginx: the configuration file /apps/nginx/nginx.conf syntax is ok nginx: configuration file /apps/nginx/nginx.conf test is successful [root@bangvmpllDA02 logs]# service nginx status nginx (pid 25923 25921 25920 25917 25908) is running... [root@bangvmpllDA02 logs]# however none of my agents are able to connect to the master, they all fail with errors like so [amisr1@blramisr195602 ~]$ puppet agent --test --verbose --server bangvmpllda02.XXX.com Info: Creating a new SSL certificate request for blramisr195602.XXX.com Info: Certificate Request fingerprint (SHA256): 26:EB:08:1F:82:32:E4:03:7A:64:8E:30:A3:99:93:26:E6:66:B9:B0:49:B6:08:F9:67:CA:1B:0C:00:B9:1D:41 Error: Could not request certificate: Error 405 on SERVER: <html> <head><title>405 Not Allowed</title></head> <body bgcolor="white"> <center><h1>405 Not Allowed</h1></center> <hr><center>nginx</center> </body> </html> Exiting; failed to retrieve certificate and waitforcert is disabled when I check logs on puppet master [root@bangvmpllDA02 logs]# tail puppet_access.log [05/Dec/2012:17:45:18 +0530] "GET /production/certificate/ca? HTTP/1.1" 404 162 "-" "Ruby" [05/Dec/2012:18:32:23 +0530] "PUT /production/certificate_request/sl63anadi.XXX.com HTTP/1.1" 405 166 "-" "-" [05/Dec/2012:18:33:33 +0530] "GET /production/certificate/sl63anadi.XXX.com? HTTP/1.1" 404 162 "-" "-" [05/Dec/2012:18:33:33 +0530] "GET /production/certificate_request/sl63anadi.XXX.com? HTTP/1.1" 404 162 "-" "-" [05/Dec/2012:18:33:33 +0530] "PUT /production/certificate_request/sl63anadi.XXX.com HTTP/1.1" 405 166 "-" "-" and the error logs show that nginx is not really able to process the request well 2012/12/05 18:33:33 [error] 25920#0: *23 open() "/etc/puppet/rack/public/production/certificate/sl63anadi.XXX.com" failed (2: No such file or directory), client: 10.209.47.26, server: , request: "GET /production/certificate/sl63anadi.XXX.com? HTTP/1.1", host: "bangvmpllda02.XXX.com:8140" 2012/12/05 18:33:33 [error] 25920#0: *24 open() "/etc/puppet/rack/public/production/certificate_request/sl63anadi.XXX.com" failed (2: No such file or directory), client: 10.209.47.26, server: , request: "GET /production/certificate_request/sl63anadi.XXX.com? HTTP/1.1", host: "bangvmpllda02.XXX.com:8140" 2012/12/05 18:47:56 [error] 25923#0: *27 open() "/etc/puppet/rack/public/production/certificate/ca" failed (2: No such file or directory), client: 10.209.47.31, server: , request: "GET /production/certificate/ca? HTTP/1.1", host: "bangvmpllda02.XXX.com:8140" 2012/12/05 18:47:56 [error] 25923#0: *28 open() "/etc/puppet/rack/public/production/certificate_request/blramisr195602.XXX.com" failed (2: No such file or directory), client: 10.209.47.31, server: , request: "GET /production/certificate_request/blramisr195602.XXX.com? HTTP/1.1", host: "bangvmpllda02.XXX.com:8140" Passenger does not show any application groups either [root@bangvmpllDA02 nginx]# passenger-status ----------- General information ----------- max = 15 count = 0 active = 0 inactive = 0 Waiting on global queue: 0 ----------- Application groups ----------- [root@bangvmpllDA02 nginx]# here's my nginx configuration [root@bangvmpllDA02 logs]# cat ../nginx.conf user puppet; worker_processes 4; #error_log logs/error.log; #error_log logs/error.log notice; error_log logs/error.log info; #pid logs/nginx.pid; events { use epoll; worker_connections 1024; } http { include mime.types; default_type application/octet-stream; log_format main '$remote_addr - $remote_user [$time_local] "$request" ' '$status $body_bytes_sent "$http_referer" ' '"$http_user_agent" "$http_x_forwarded_for"'; access_log logs/access.log main; sendfile on; #tcp_nopush on; server_tokens off; #keepalive_timeout 0; keepalive_timeout 120; gzip on; gzip_http_version 1.1; gzip_disable "msie6"; gzip_vary on; gzip_min_length 1100; gzip_buffers 64 8k; gzip_comp_level 3; gzip_proxied any; gzip_types text/plain text/css application/x-javascript text/xml application/xml; server { listen 80; server_name bangvmpllda02.XXXX.com; charset utf-8; #access_log logs/http.access.log main; location / { root html; index index.html index.htm index.php; } #error_page 404 /404.html; # redirect server error pages to the static page /50x.html # error_page 500 502 503 504 /50x.html; location = /50x.html { root html; } # proxy the PHP scripts to Apache listening on 127.0.0.1:80 # #location ~ \.php$ { # proxy_pass http://127.0.0.1; #} # pass the PHP scripts to FastCGI server listening on 127.0.0.1:9000 # location ~ \.php$ { root html; fastcgi_pass unix:/var/run/php-fpm/php-fpm.sock; fastcgi_index index.php; fastcgi_param SCRIPT_FILENAME $document_root$fastcgi_script_name; fastcgi_param SCRIPT_NAME $fastcgi_script_name; include fastcgi_params; } # deny access to .htaccess files, if Apache's document root # concurs with nginx's one # location ~ /\.ht { access_log off; log_not_found off; deny all; } location ~* \.(jpg|jpeg|gif|png|css|js|ico|xml)$ { access_log off; log_not_found off; expires 2d; } } # Passenger needed for puppet passenger_root /usr/lib/ruby/gems/1.8/gems/passenger-3.0.18; passenger_ruby /usr/bin/ruby; passenger_max_pool_size 15; server { ssl on; listen 8140 default ssl; server_name bangvmpllda02.XXXX.com; passenger_enabled on; passenger_set_cgi_param HTTP_X_CLIENT_DN $ssl_client_s_dn; passenger_set_cgi_param HTTP_X_CLIENT_VERIFY $ssl_client_verify; passenger_min_instances 5; access_log logs/puppet_access.log; error_log logs/puppet_error.log; root /etc/puppet/rack/public; ssl_certificate /var/lib/puppet/ssl/certs/bangvmpllda02.XXX.com.pem; ssl_certificate_key /var/lib/puppet/ssl/private_keys/bangvmpllda02.XXX.com.pem; ssl_crl /var/lib/puppet/ssl/ca/ca_crl.pem; ssl_client_certificate /var/lib/puppet/ssl/certs/ca.pem; ssl_ciphers SSLv2:-LOW:-EXPORT:RC4+RSA; ssl_prefer_server_ciphers on; ssl_verify_client optional; ssl_verify_depth 1; ssl_session_cache shared:SSL:128m; ssl_session_timeout 5m; } } and the puppet.conf [main] # The Puppet log directory. # The default value is '$vardir/log'. logdir = /var/log/puppet # Where Puppet PID files are kept. # The default value is '$vardir/run'. rundir = /var/run/puppet dns_alt_names = devops.XXXX.com,devops confdir = /etc/puppet vardir = /var/lib/puppet storeconfigs = true storeconfigs_backend = puppetdb thin_storeconfigs = false async_storeconfigs = false ssl_client_header = SSL_CLIENT_S_D ssl_client_verify_header = SSL_CLIENT_VERIFY # Where SSL certificates are kept. # The default value is '$confdir/ssl'. ssldir = $vardir/ssl any ideas where am I going wrong? I checkthe directory permissions; /usr/share/puppet, /etc/puppet and /var/lib/puppet (and files inside them) are owned by puppet user.

    Read the article

  • solved: passenger(mod_rails) fails to start puppet master under nginx

    - by Anadi Misra
    On the server [root@bangvmpllDA02 logs]# ruby -v ruby 1.8.7 (2011-06-30 patchlevel 352) [x86_64-linux] [root@bangvmpllDA02 logs]# puppet --version 3.0.1 and [root@bangvmpllDA02 logs]# service nginx configtest nginx: the configuration file /apps/nginx/nginx.conf syntax is ok nginx: configuration file /apps/nginx/nginx.conf test is successful [root@bangvmpllDA02 logs]# service nginx status nginx (pid 25923 25921 25920 25917 25908) is running... [root@bangvmpllDA02 logs]# however none of my agents are able to connect to the master, they all fail with errors like so [amisr1@blramisr195602 ~]$ puppet agent --test --verbose --server bangvmpllda02.XXX.com Info: Creating a new SSL certificate request for blramisr195602.XXX.com Info: Certificate Request fingerprint (SHA256): 26:EB:08:1F:82:32:E4:03:7A:64:8E:30:A3:99:93:26:E6:66:B9:B0:49:B6:08:F9:67:CA:1B:0C:00:B9:1D:41 Error: Could not request certificate: Error 405 on SERVER: <html> <head><title>405 Not Allowed</title></head> <body bgcolor="white"> <center><h1>405 Not Allowed</h1></center> <hr><center>nginx</center> </body> </html> Exiting; failed to retrieve certificate and waitforcert is disabled when I check logs on puppet master [root@bangvmpllDA02 logs]# tail puppet_access.log [05/Dec/2012:17:45:18 +0530] "GET /production/certificate/ca? HTTP/1.1" 404 162 "-" "Ruby" [05/Dec/2012:18:32:23 +0530] "PUT /production/certificate_request/sl63anadi.XXX.com HTTP/1.1" 405 166 "-" "-" [05/Dec/2012:18:33:33 +0530] "GET /production/certificate/sl63anadi.XXX.com? HTTP/1.1" 404 162 "-" "-" [05/Dec/2012:18:33:33 +0530] "GET /production/certificate_request/sl63anadi.XXX.com? HTTP/1.1" 404 162 "-" "-" [05/Dec/2012:18:33:33 +0530] "PUT /production/certificate_request/sl63anadi.XXX.com HTTP/1.1" 405 166 "-" "-" and the error logs show that nginx is not really able to process the request well 2012/12/05 18:33:33 [error] 25920#0: *23 open() "/etc/puppet/rack/public/production/certificate/sl63anadi.XXX.com" failed (2: No such file or directory), client: 10.209.47.26, server: , request: "GET /production/certificate/sl63anadi.XXX.com? HTTP/1.1", host: "bangvmpllda02.XXX.com:8140" 2012/12/05 18:33:33 [error] 25920#0: *24 open() "/etc/puppet/rack/public/production/certificate_request/sl63anadi.XXX.com" failed (2: No such file or directory), client: 10.209.47.26, server: , request: "GET /production/certificate_request/sl63anadi.XXX.com? HTTP/1.1", host: "bangvmpllda02.XXX.com:8140" 2012/12/05 18:47:56 [error] 25923#0: *27 open() "/etc/puppet/rack/public/production/certificate/ca" failed (2: No such file or directory), client: 10.209.47.31, server: , request: "GET /production/certificate/ca? HTTP/1.1", host: "bangvmpllda02.XXX.com:8140" 2012/12/05 18:47:56 [error] 25923#0: *28 open() "/etc/puppet/rack/public/production/certificate_request/blramisr195602.XXX.com" failed (2: No such file or directory), client: 10.209.47.31, server: , request: "GET /production/certificate_request/blramisr195602.XXX.com? HTTP/1.1", host: "bangvmpllda02.XXX.com:8140" Passenger does not show any application groups either [root@bangvmpllDA02 nginx]# passenger-status ----------- General information ----------- max = 15 count = 0 active = 0 inactive = 0 Waiting on global queue: 0 ----------- Application groups ----------- [root@bangvmpllDA02 nginx]# here's my nginx configuration [root@bangvmpllDA02 logs]# cat ../nginx.conf user puppet; worker_processes 4; #error_log logs/error.log; #error_log logs/error.log notice; error_log logs/error.log info; #pid logs/nginx.pid; events { use epoll; worker_connections 1024; } http { include mime.types; default_type application/octet-stream; log_format main '$remote_addr - $remote_user [$time_local] "$request" ' '$status $body_bytes_sent "$http_referer" ' '"$http_user_agent" "$http_x_forwarded_for"'; access_log logs/access.log main; sendfile on; #tcp_nopush on; server_tokens off; #keepalive_timeout 0; keepalive_timeout 120; gzip on; gzip_http_version 1.1; gzip_disable "msie6"; gzip_vary on; gzip_min_length 1100; gzip_buffers 64 8k; gzip_comp_level 3; gzip_proxied any; gzip_types text/plain text/css application/x-javascript text/xml application/xml; server { listen 80; server_name bangvmpllda02.XXXX.com; charset utf-8; #access_log logs/http.access.log main; location / { root html; index index.html index.htm index.php; } #error_page 404 /404.html; # redirect server error pages to the static page /50x.html # error_page 500 502 503 504 /50x.html; location = /50x.html { root html; } # proxy the PHP scripts to Apache listening on 127.0.0.1:80 # #location ~ \.php$ { # proxy_pass http://127.0.0.1; #} # pass the PHP scripts to FastCGI server listening on 127.0.0.1:9000 # location ~ \.php$ { root html; fastcgi_pass unix:/var/run/php-fpm/php-fpm.sock; fastcgi_index index.php; fastcgi_param SCRIPT_FILENAME $document_root$fastcgi_script_name; fastcgi_param SCRIPT_NAME $fastcgi_script_name; include fastcgi_params; } # deny access to .htaccess files, if Apache's document root # concurs with nginx's one # location ~ /\.ht { access_log off; log_not_found off; deny all; } location ~* \.(jpg|jpeg|gif|png|css|js|ico|xml)$ { access_log off; log_not_found off; expires 2d; } } # Passenger needed for puppet passenger_root /usr/lib/ruby/gems/1.8/gems/passenger-3.0.18; passenger_ruby /usr/bin/ruby; passenger_max_pool_size 15; server { ssl on; listen 8140 default ssl; server_name bangvmpllda02.XXXX.com; passenger_enabled on; passenger_set_cgi_param HTTP_X_CLIENT_DN $ssl_client_s_dn; passenger_set_cgi_param HTTP_X_CLIENT_VERIFY $ssl_client_verify; passenger_min_instances 5; access_log logs/puppet_access.log; error_log logs/puppet_error.log; root /etc/puppet/rack/public; ssl_certificate /var/lib/puppet/ssl/certs/bangvmpllda02.XXX.com.pem; ssl_certificate_key /var/lib/puppet/ssl/private_keys/bangvmpllda02.XXX.com.pem; ssl_crl /var/lib/puppet/ssl/ca/ca_crl.pem; ssl_client_certificate /var/lib/puppet/ssl/certs/ca.pem; ssl_ciphers SSLv2:-LOW:-EXPORT:RC4+RSA; ssl_prefer_server_ciphers on; ssl_verify_client optional; ssl_verify_depth 1; ssl_session_cache shared:SSL:128m; ssl_session_timeout 5m; } } and the puppet.conf [main] # The Puppet log directory. # The default value is '$vardir/log'. logdir = /var/log/puppet # Where Puppet PID files are kept. # The default value is '$vardir/run'. rundir = /var/run/puppet dns_alt_names = devops.XXXX.com,devops confdir = /etc/puppet vardir = /var/lib/puppet storeconfigs = true storeconfigs_backend = puppetdb thin_storeconfigs = false async_storeconfigs = false ssl_client_header = SSL_CLIENT_S_D ssl_client_verify_header = SSL_CLIENT_VERIFY # Where SSL certificates are kept. # The default value is '$confdir/ssl'. ssldir = $vardir/ssl any ideas where am I going wrong? I checkthe directory permissions; /usr/share/puppet, /etc/puppet and /var/lib/puppet (and files inside them) are owned by puppet user. Solved The simple solution to my complicated problem was that I had placed the config.ru in wrong place moved it to /etc/puppet/rack , it was in /etc/puppet/rack/public Well!!! :-/

    Read the article

  • Lighttpd not cleanly restarting (address already in use)

    - by NilObject
    When doing a dist-upgrade recently, my lighttpd-1.4.19 install on Ubuntu 8.0.4 has begun failing to restart or reload properly with the /etc/init.d/lighttpd restart command. ~$ sudo /etc/init.d/lighttpd restart * Stopping web server lighttpd ...done. * Starting web server lighttpd 2009-06-13 04:06:36: (network.c.300) can't bind to port: 80 Address already in use ...fail! The same error occurs when I do a reload. The way I get around it is to kill lighttpd and then issue the start command, but it seems like I shouldn't have to do that :) I've looked at my config files, and can't spot any immediate errors. Does anyone have any ideas what can be causing this error? This seems to be the latest version as of writing this question that is available via the apt-get route. My config file is: # Debian lighttpd configuration file # ############ Options you really have to take care of #################### ## modules to load # mod_access, mod_accesslog and mod_alias are loaded by default # all other module should only be loaded if neccesary # - saves some time # - saves memory server.modules = ( "mod_access", "mod_alias", "mod_accesslog", "mod_compress", "mod_fastcgi", "mod_rewrite", "mod_redirect", ) ## a static document-root, for virtual-hosting take look at the ## server.virtual-* options server.document-root = "/var/www/" ## where to send error-messages to server.errorlog = "/var/log/lighttpd/error.log" fastcgi.server = (".php" => (( "bin-path" => "/usr/bin/php5-cgi", "socket" => "/tmp/php.socket" ))) ## files to check for if .../ is requested index-file.names = ( "index.php", "index.html", "index.htm", "default.htm", "index.lighttpd.html" ) ## Use the "Content-Type" extended attribute to obtain mime type if possible # mimetype.use-xattr = "enable" #### accesslog module accesslog.filename = "/var/log/lighttpd/access.log" ## deny access the file-extensions # # ~ is for backupfiles from vi, emacs, joe, ... # .inc is often used for code includes which should in general not be part # of the document-root url.access-deny = ( "~", ".inc" ) ## # which extensions should not be handle via static-file transfer # # .php, .pl, .fcgi are most often handled by mod_fastcgi or mod_cgi static-file.exclude-extensions = ( ".php", ".pl", ".fcgi" ) mimetype.assign = ( ".pdf" => "application/pdf", ".sig" => "application/pgp-signature", ".spl" => "application/futuresplash", ".class" => "application/octet-stream", ".ps" => "application/postscript", ".torrent" => "application/x-bittorrent", ".dvi" => "application/x-dvi", ".gz" => "application/x-gzip", ".pac" => "application/x-ns-proxy-autoconfig", ".swf" => "application/x-shockwave-flash", ".tar.gz" => "application/x-tgz", ".tgz" => "application/x-tgz", ".tar" => "application/x-tar", ".zip" => "application/zip", ".mp3" => "audio/mpeg", ".m3u" => "audio/x-mpegurl", ".wma" => "audio/x-ms-wma", ".wax" => "audio/x-ms-wax", ".ogg" => "audio/x-wav", ".wav" => "audio/x-wav", ".gif" => "image/gif", ".jpg" => "image/jpeg", ".jpeg" => "image/jpeg", ".png" => "image/png", ".xbm" => "image/x-xbitmap", ".xpm" => "image/x-xpixmap", ".xwd" => "image/x-xwindowdump", ".css" => "text/css", ".html" => "text/html", ".htm" => "text/html", ".js" => "text/javascript", ".asc" => "text/plain", ".c" => "text/plain", ".conf" => "text/plain", ".text" => "text/plain", ".txt" => "text/plain", ".dtd" => "text/xml", ".xml" => "text/xml", ".rss" => "application/rss+xml", ".mpeg" => "video/mpeg", ".mpg" => "video/mpeg", ".mov" => "video/quicktime", ".qt" => "video/quicktime", ".avi" => "video/x-msvideo", ".asf" => "video/x-ms-asf", ".asx" => "video/x-ms-asf", ".wmv" => "video/x-ms-wmv", ".bz2" => "application/x-bzip", ".tbz" => "application/x-bzip-compressed-tar", ".tar.bz2" => "application/x-bzip-compressed-tar" ) include_shell "/usr/share/lighttpd/include-conf-enabled.pl" My /etc/init.d/lighttpd script is (untouched from installation): #!/bin/sh ### BEGIN INIT INFO # Provides: lighttpd # Required-Start: networking # Required-Stop: networking # Default-Start: 2 3 4 5 # Default-Stop: 0 1 6 # Short-Description: Start the lighttpd web server. ### END INIT INFO PATH=/sbin:/bin:/usr/sbin:/usr/bin DAEMON=/usr/sbin/lighttpd NAME=lighttpd DESC="web server" PIDFILE=/var/run/$NAME.pid SCRIPTNAME=/etc/init.d/$NAME ENV="env -i LANG=C PATH=/usr/local/bin:/usr/bin:/bin" SSD="/sbin/start-stop-daemon" DAEMON_OPTS="-f /etc/lighttpd/lighttpd.conf" test -x $DAEMON || exit 0 set -e # be sure there is a /var/run/lighttpd, even with tmpfs mkdir -p /var/run/lighttpd > /dev/null 2> /dev/null chown www-data:www-data /var/run/lighttpd chmod 0750 /var/run/lighttpd . /lib/lsb/init-functions case "$1" in start) log_daemon_msg "Starting $DESC" $NAME if ! $ENV $SSD --start --quiet\ --pidfile $PIDFILE --exec $DAEMON -- $DAEMON_OPTS ; then log_end_msg 1 else log_end_msg 0 fi ;; stop) log_daemon_msg "Stopping $DESC" $NAME if $SSD --quiet --stop --oknodo --retry 30\ --pidfile $PIDFILE --exec $DAEMON; then rm -f $PIDFILE log_end_msg 0 else log_end_msg 1 fi ;; reload) log_daemon_msg "Reloading $DESC configuration" $NAME if $SSD --stop --signal 2 --oknodo --retry 30\ --quiet --pidfile $PIDFILE --exec $DAEMON; then if $ENV $SSD --start --quiet \ --pidfile $PIDFILE --exec $DAEMON -- $DAEMON_OPTS ; then log_end_msg 0 else log_end_msg 1 fi else log_end_msg 1 fi ;; restart|force-reload) $0 stop [ -r $PIDFILE ] && while pidof lighttpd |\ grep -q `cat $PIDFILE 2>/dev/null` 2>/dev/null ; do sleep 1; done $0 start ;; *) echo "Usage: $SCRIPTNAME {start|stop|restart|reload|force-reload}" >&2 exit 1 ;; esac exit 0

    Read the article

  • nginx reverse proxy cannot access apache virtual hosts

    - by Sc0rian
    I am setting up nginx as a reverse proxy. The server runs on directadmin and lamp stack. I have nginx running on port 81. I can access all my sites (including virtual ips) on the port 81. However when I forward the traffic from port 80 to 81, the virtual ips have a message saying "Apache is running normally". Server IPs are fine, and I can still access virtual IP's on 81. [root@~]# netstat -an | grep LISTEN | egrep ":80|:81" tcp 0 0 <virtual ip>:81 0.0.0.0:* LISTEN tcp 0 0 <virtual ip>:81 0.0.0.0:* LISTEN tcp 0 0 <serverip>:81 0.0.0.0:* LISTEN tcp 0 0 :::80 :::* LISTEN apache 24090 0.6 1.3 29252 13612 ? S 18:34 0:00 /usr/sbin/httpd -k start -DSSL apache 24092 0.9 2.1 39584 22056 ? S 18:34 0:00 /usr/sbin/httpd -k start -DSSL apache 24096 0.2 1.9 35892 20256 ? S 18:34 0:00 /usr/sbin/httpd -k start -DSSL apache 24120 0.3 1.7 35752 17840 ? S 18:34 0:00 /usr/sbin/httpd -k start -DSSL apache 24495 0.0 1.4 30892 14756 ? S 18:35 0:00 /usr/sbin/httpd -k start -DSSL apache 24496 1.0 2.1 39892 22164 ? S 18:35 0:00 /usr/sbin/httpd -k start -DSSL apache 24516 1.5 3.6 55496 38040 ? S 18:35 0:00 /usr/sbin/httpd -k start -DSSL apache 24519 0.1 1.2 28996 13224 ? S 18:35 0:00 /usr/sbin/httpd -k start -DSSL apache 24521 2.7 4.0 58244 41984 ? S 18:35 0:00 /usr/sbin/httpd -k start -DSSL apache 24522 0.0 1.2 29124 12672 ? S 18:35 0:00 /usr/sbin/httpd -k start -DSSL apache 24524 0.0 1.1 28740 12364 ? S 18:35 0:00 /usr/sbin/httpd -k start -DSSL apache 24535 1.1 1.7 36008 17876 ? S 18:35 0:00 /usr/sbin/httpd -k start -DSSL apache 24536 0.0 1.1 28592 12084 ? S 18:35 0:00 /usr/sbin/httpd -k start -DSSL apache 24537 0.0 1.1 28592 12112 ? S 18:35 0:00 /usr/sbin/httpd -k start -DSSL apache 24539 0.0 0.0 0 0 ? Z 18:35 0:00 [httpd] <defunct> apache 24540 0.0 1.1 28592 11540 ? S 18:35 0:00 /usr/sbin/httpd -k start -DSSL apache 24541 0.0 1.1 28592 11548 ? S 18:35 0:00 /usr/sbin/httpd -k start -DSSL root 24548 0.0 0.0 4132 752 pts/0 R+ 18:35 0:00 egrep apache|nginx root 28238 0.0 0.0 19576 284 ? Ss May29 0:00 nginx: master process /usr/local/nginx/sbin/nginx -c /usr/local/nginx/conf/nginx.conf apache 28239 0.0 0.0 19888 804 ? S May29 0:00 nginx: worker process apache 28240 0.0 0.0 19888 548 ? S May29 0:00 nginx: worker process apache 28241 0.0 0.0 19736 484 ? S May29 0:00 nginx: cache manager process here is my nginx conf: cat /usr/local/nginx/conf/nginx.conf user apache apache; worker_processes 2; # Set it according to what your CPU have. 4 Cores = 4 worker_rlimit_nofile 8192; pid /var/run/nginx.pid; events { worker_connections 1024; } http { include mime.types; default_type application/octet-stream; log_format main '$remote_addr - $remote_user [$time_local] ' '"$request" $status $body_bytes_sent "$http_referer" ' '"$http_user_agent" "$http_x_forwarded_for"'; server_tokens off; access_log /var/log/nginx_access.log main; error_log /var/log/nginx_error.log debug; server_names_hash_bucket_size 64; sendfile on; tcp_nopush on; tcp_nodelay off; keepalive_timeout 30; gzip on; gzip_comp_level 9; gzip_proxied any; proxy_buffering on; proxy_cache_path /usr/local/nginx/proxy_temp levels=1:2 keys_zone=one:15m inactive=7d max_size=1000m; proxy_buffer_size 16k; proxy_buffers 100 8k; proxy_connect_timeout 60; proxy_send_timeout 60; proxy_read_timeout 60; server { listen <server ip>:81 default rcvbuf=8192 sndbuf=16384 backlog=32000; # Real IP here server_name <server host name> _; # "_" is for handle all hosts that are not described by server_name charset off; access_log /var/log/nginx_host_general.access.log main; location / { proxy_set_header Host $host; proxy_set_header X-Real-IP $remote_addr; proxy_set_header X-Forwarded-For $proxy_add_x_forwarded_for; proxy_pass http://<server ip>; # Real IP here client_max_body_size 16m; client_body_buffer_size 128k; proxy_buffering on; proxy_connect_timeout 90; proxy_send_timeout 90; proxy_read_timeout 120; proxy_buffer_size 16k; proxy_buffers 32 32k; proxy_busy_buffers_size 64k; proxy_temp_file_write_size 64k; } location /nginx_status { stub_status on; access_log off; allow 127.0.0.1; deny all; } } include /usr/local/nginx/vhosts/*.conf; } here is my vhost conf: # cat /usr/local/nginx/vhosts/1.conf server { listen <virt ip>:81 default rcvbuf=8192 sndbuf=16384 backlog=32000; # Real IP here server_name <virt domain name>.com ; # "_" is for handle all hosts that are not described by server_name charset off; access_log /var/log/nginx_host_general.access.log main; location / { proxy_set_header Host $host; proxy_set_header X-Real-IP $remote_addr; proxy_set_header X-Forwarded-For $proxy_add_x_forwarded_for; proxy_pass http://<virt ip>; # Real IP here client_max_body_size 16m; client_body_buffer_size 128k; proxy_buffering on; proxy_connect_timeout 90; proxy_send_timeout 90; proxy_read_timeout 120; proxy_buffer_size 16k; proxy_buffers 32 32k; proxy_busy_buffers_size 64k; proxy_temp_file_write_size 64k; } } Apache config: <VirtualHost xxxxxx:80 > ServerName www.<domain>.com ServerAlias www.<domain>.com <domain>.com ServerAdmin webmaster@<domain>.com DocumentRoot /home/<domain>/domains/<domain>.com/public_html ScriptAlias /cgi-bin/ /home/<domain>/domains/<domain>.com/public_html/cgi-bin/ UseCanonicalName OFF <IfModule !mod_ruid2.c> SuexecUserGroup <domain> <domain> </IfModule> <IfModule mod_ruid2.c> RMode config RUidGid <domain> <domain> RGroups apache access </IfModule> CustomLog /var/log/httpd/domains/<domain>.com.bytes bytes CustomLog /var/log/httpd/domains/<domain>.com.log combined ErrorLog /var/log/httpd/domains/<domain>.com.error.log <Directory /home/<domain>/domains/<domain>.com/public_html> Options +Includes -Indexes php_admin_flag engine ON php_admin_value sendmail_path '/usr/sbin/sendmail -t -i -f <domain>@<domain>.com' </Directory> <virtual ip address>:80 is a NameVirtualHost default server www.xx.com (/usr/local/directadmin/data/users/xx/httpd.conf:16) port 80 namevhost www.xx.com (/usr/local/directadmin/data/users/xx/httpd.conf:16) port 80 namevhost www.xx.co.uk (/usr/local/directadmin/data/users/xx/httpd.conf:107) port 80 namevhost www.xx.co.uk (/usr/local/directadmin/data/users/xx/httpd.conf:151) port 80 namevhost www.xx.co.uk (/usr/local/directadmin/data/users/xx/httpd.conf:195) <virtual ip address>:443 is a NameVirtualHost default server www.xx.com (/usr/local/directadmin/data/users/xx/httpd.conf:61) port 443 namevhost www.xx.com (/usr/local/directadmin/data/users/xx/httpd.conf:61) <server ip>:80 is a NameVirtualHost default server localhost (/etc/httpd/conf/extra/httpd-vhosts.conf:29) port 80 namevhost localhost (/etc/httpd/conf/extra/httpd-vhosts.conf:29) port 80 namevhost www.xx.co.uk (/usr/local/directadmin/data/users/admin/httpd.conf:16)

    Read the article

< Previous Page | 248 249 250 251 252 253 254 255 256  | Next Page >