Search Results

Search found 21336 results on 854 pages for 'db api'.

Page 255/854 | < Previous Page | 251 252 253 254 255 256 257 258 259 260 261 262  | Next Page >

  • Trouble installing php memcache extension

    - by user35346
    I'm trying to install memcache on MAMP but I get the warning below, and when I continue it seems to complete properly. I add the line extension=memcache.so to the php.ini and restart MAMP but phpinfo() doesn't list the memcache extension. $ ./pecl install memcache downloading memcache-2.2.5.tgz ... Starting to download memcache-2.2.5.tgz (35,981 bytes) ..........done: 35,981 bytes 11 source files, building WARNING: php_bin /Applications/MAMP/bin/php5/bin/php appears to have a suffix 5/bin/php, but config variable php_suffix does not match running: phpize Configuring for: PHP Api Version: 20041225 Zend Module Api No: 20060613 Zend Extension Api No: 220060519 Enable memcache session handler support? [yes] : yes ... Build process completed successfully Installing '/Applications/MAMP/bin/php5/lib/php/extensions/no-debug-non-zts-20060613/memcache.so' install ok: channel://pecl.php.net/memcache-2.2.5 configuration option "php_ini" is not set to php.ini location You should add "extension=memcache.so" to php.ini

    Read the article

  • Database OR Array

    - by rezoner
    What is the exact point of using external database system if I have simple relations (95% querries are dependant on ID). I am storing users and their stats. Why would I use external database if I can have neat constructions like: db.users[32] = something Array of 500K users is not that big effort for RAM Pros are: no problematic asynchronity (instant results) easy export/import dealing with database like with a native object LITERALLY ps. and considerations: Would it be faster or slower to do collection[3] than db.query("select ... I am going to store it as a file/s There is only ONE application/process accessing this data, and the code is executed line by line - please don't elaborate about locking. Please don't answer with database propositions but why to use external DB over native array/object - I have experience in a few databases - that's not the case. What I am building is a client/gateway/server(s) game. Gateway deals with all users data, processing, authenticating, writing statistics e.t.c No other part of software needs to access directly to this data/database.

    Read the article

  • How to use Binary Log file for Auditing and Replicating in MySQL?

    - by Pranav
    How to use Binary Log file for Auditing in MySQL? I want to track the change in a DB using Binary Log so that I can replicate these changes to other DB please do not give me hyperlinks for MySQL website. please direct me to find the solution EDIT I have looked for auditing options and created a script using Triggers for that, but due toi the Joomla DB structure it did'nt worked for me, hence I have to move on to Binary Log file concept now i am stucked in initiating the concept as I am not getting the concept of making the server master/slave, so can any body guide me how to actually initiate it via PHP?

    Read the article

  • Set up Glassfish connection pool to talk to a database on a Ubuntu VPS

    - by Harry Pham
    On my Ubuntu VPS, i have a mysql server running and a Glassfish 3.0.1 Application Server running. And I am having a hard to have my GF successfully ping the database. Here is my GF set up Assume: x.y.z.t is the ip of my VPS Resource Type: javax.sql.ConnectionPoolDataSource User: root DatabaseName: scholar Url: jdbc:mysql://x.y.z.t:3306/scholar URL: jdbc:mysql://x.y.z.t:3306/scholar Password: xxxx PortNumber: 3306 ServerName: x.y.z.t Inside my glassfish3/glassfish/lib, I have my mysql-connector-java-5.1.13-bin.jar Inside the database, table mysql here is the result of the query select User, Host from user; +------------------+-----------+ | User | Host | +------------------+-----------+ | root | 127.0.0.1 | | debian-sys-maint | localhost | | root | localhost | | root | yunaeyes | +------------------+-----------+ Now from my machine, if I try to connect to this db via mysql browser (mysql client software), well I cant. Well from the table above, seem like it only allow localhost to connect to this db. Keep in mind that both my db and my GF are on the same VPS. Please help

    Read the article

  • How to proxy to different named databases on the same server using MySQL Proxy?

    - by cclark
    I would like to have two databases on my MySQL server: DEV_DB_A DEV_DB_B However, in order to keep everyone's scripts, Query Browser settings and anything else from changing when we switch from using on DB to another I'd like to have everyone connect to DEV_DB and then use something like MySQL Proxy running a lua script which knows the currently active DB is DEV_DB_A and routes queries to there. If we restore a fresh version of the DB to DEV_DB_B or make some changes (e.g. partition a table) we can easily switch to DEV_DB_B by changing one Lua script instead of updating references everywhere. I had hoped I might be able to symlink inside of the mysql data directory but that didn't work so it seems like MySQL Proxy is a reasonable approach. Being new to Lua and MySQL Proxy I'm wondering if anyone else has approached the problem this way and how it worked.

    Read the article

  • Migrating data from Oracle database to Pervasive .DAT files

    - by kaychaks
    The requirement is to migrate some tables with data from a Oracle database server to Pervasive database's .DAT file. Then those .DAT files will be used by a Pervasive database server. The restriction is that Oracle DB can not directly migrate to the Pervasive DB. It has to generate the .DAT files and then the new .DAT files will replace the old one for the Pervasive DB which will then use them for the new data. I was trying this task with SSIS. Exporting the Oracle table to a delimited .txt file and then creating a .DAT file from that text file. I can export the data from Oracle to .txt but I am not finding any way to migrate .txt to Pervasive .DAT? Is this the right approach? If not then please help with my problem.

    Read the article

  • Hyper-V cluster VS regular cluster

    - by Sasha
    We need to choice between Hyper-V and regular cluster technologies. What is the advantage and disadvantage of these approaches? Update: We have to physical servers and want to build reliably solution using cluster approach. We need to clustering our application and DB (MS SQL). We know that we can use: Regular Windows Cluster Service. Application and DB will be migrating from one node to other. Hyper-V Failover Cluster. Virtual machine will be migrating from one node to other. Combined variant. DB mirroring for MS SQL and Hyper-V for our application. We need to make a choice between this approach. So we need to know advantage and disadvantage of these approaches?

    Read the article

  • How to install pecl uploadprogress on Debian Lenny

    - by kidrobot
    I am getting this output/error for # pecl install uploadprogress downloading uploadprogress-1.0.1.tgz ... Starting to download uploadprogress-1.0.1.tgz (8,536 bytes) .....done: 8,536 bytes 4 source files, building running: phpize Configuring for: PHP Api Version: 20041225 Zend Module Api No: 20060613 Zend Extension Api No: 220060519 building in /var/tmp/pear-build-root/uploadprogress-1.0.1 running: /tmp/pear/temp/uploadprogress/configure checking for grep that handles long lines and -e... /bin/grep checking for egrep... /bin/grep -E checking for a sed that does not truncate output... /bin/sed checking for gcc... no checking for cc... no checking for cl.exe... no configure: error: no acceptable C compiler found in $PATH See `config.log' for more details. ERROR: `/tmp/pear/temp/uploadprogress/configure' failed php-pear is installed. I'm stumped.

    Read the article

  • Multiple client connecting to master MySQL over SSL

    - by Bastien974
    I successfully configured a MySQL replication over SSL between 2 servers accross the internet. Now I want a second server in the same location as the replication slave, to open a connection to the master db over ssl. I used the same command found here http://dev.mysql.com/doc/refman/5.1/en/secure-create-certs.html to generate a new set of client-cert.pem and client-key.pem with the same master db ca-cert/key.pem and I also used a different Common Name. When I try to initiate a connection between this new server and the master db, it fails : mysql -hmasterdb -utestssl -p --ssl-ca=/var/lib/mysql/newcerts/ca-cert.pem --ssl-cert=/var/lib/mysql/newcerts/client-cert.pem --ssl-key=/var/lib/mysql/newcerts/client-key.pem ERROR 2026 (HY000): SSL connection error It's working without SSL.

    Read the article

  • How to use Binary Log file for Auditing and Replicating in MySQL?

    - by Pranav
    How to use Binary Log file for Auditing in MySQL? I want to track the change in a DB using Binary Log so that I can replicate these changes to other DB please do not give me hyperlinks for MySQL website. please direct me to find the solution I have looked for auditing options and created a script using Triggers for that, but due toi the Joomla DB structure it did'nt worked for me, hence I have to move on to Binary Log file concept now i am stucked in initiating the concept as I am not getting the concept of making the server master/slave, so can any body guide me how to actually initiate it via PHP?

    Read the article

  • DBD::mysql gives mysql_init not found

    - by highBandWidth
    I have to install a non-admin copy of mysql and perl module DBD::mysql in my home directory. I installed mysql in ~/software/db/mysql and this works since I can start and stop the server and go to the mysql prompt. Then, I downloaded the perl module and installed it using perl Makefile.PL PREFIX=~/myperl/ LIB=~/myperl/lib/lib64/perl5/ --mysql_config=/my_home/software/db/mysql/bin/mysql_config --libs=/myhome/software/db/mysql/lib/libmysqlclient.a make make install I did this to use the statically linked mysql client library. perl -MDBD::mysql -e 1 gives no errors. However, when I actually try to use the module, I get /usr/bin/perl: symbol lookup error: /myhome/myperl/lib/lib64/perl5/x86_64-linux-thread-multi/auto/DBD/mysql/mysql.so: undefined symbol: mysql_init

    Read the article

  • Cannot install Pecl (Imagick) extension on Centos server - autoconf missing

    - by Stevo
    I'm trying to install the pecl extension Imagick on a centos server, but I'm getting an error about autoconf. Autoconf is installed, as is make and gcc. but it's complaining about the path: [root@server ~]# pecl install imagick downloading imagick-3.0.1.tgz ... Starting to download imagick-3.0.1.tgz (93,920 bytes) .....................done: 93,920 bytes 13 source files, building running: phpize Configuring for: PHP Api Version: 20090626 Zend Module Api No: 20090626 Zend Extension Api No: 220090626 /usr/bin/phpize: /var/tmp/imagick/build/shtool: /bin/sh: bad interpreter: Permission denied Cannot find autoconf. Please check your autoconf installation and the $PHP_AUTOCONF environment variable. Then, rerun this script. ERROR: `phpize' failed What should I do?

    Read the article

  • zero downtime during database scheme upgrade on SQL 2008

    - by eject
    I have web application on IIS7 with SQL server 2008 as RDBMS. Need get 0 downtime during future upgrades of ASP.NET code and DB schema as well. I need to get right scenario for this. I have 2 web servers and 2 sql servers and one http load balancer whcih allows to switch web backend server for web requests. Main goal is to make 1st web server and DB server up and running, update code and db schema on 2nd server and then switch all the requests to 2nd server and then main problem - how to copy data from 1st database 2nd (which was changed during upgrade).

    Read the article

  • MySQL Cluster Failover doesn't work

    - by Lukasz
    I have two servers, where First server 10.100.15.150: 1. one mgm server 2. one ndbd 3. one mysql api Second server 10.100.15.160: 1. one ndbd 2. one mysql api When i start all 'parts' of cluster it looks : Cluster Configuration [ndbd(NDB)] 2 node(s) id=21 @10.100.15.150 (mysql-5.1.56 ndb-7.1.17, Nodegroup: 0) id=22 @10.100.15.160 (mysql-5.1.56 ndb-7.1.17, Nodegroup: 0, Master) [ndb_mgmd(MGM)] 1 node(s) id=3 @10.100.15.150 (mysql-5.1.56 ndb-7.1.17) [mysqld(API)] 2 node(s) id=11 @10.100.15.150 (mysql-5.1.56 ndb-7.1.17) id=12 @10.100.15.160 (mysql-5.1.56 ndb-7.1.17) When i shutdown first machine - 10.100.15.150, on second the nbdb process also has been shutdown so i cannot use this data node and cluster fail ... How i must configure this cluster to get FailOver working ? Thx

    Read the article

  • Network monitoring library, or objects, for a cloud

    - by Andrew Smith
    I am looking for library to support server / switch monitoring, to actually be able to check with the device if it's working OK. However this requires some sort of auto-detection and device support. Basically I need to automatically detect a new device, start monitoring it like CPU and PING. So how do I auto-detect the machine remotely, this is something I need library for. Rackspace has something like this - "Cloud Monitoring API". But is there anything opensource which can be used same way? The Nagios and others doesnt have such API, and the big and expensive systems are too big to handle in public cloud, so there must be some other network monitoring engine with API, which can add a new servers automatically and support user isolation for example so I dont see other servers except mine.

    Read the article

  • Is allowing remote Sql Server Management Studio safe?

    - by dave thieben
    I administer a website that runs on IIS on one box, and SQL Server 2008 Workgroup on another box. typically I remote into the DB box and run SSMS to work on the db, but I would like to be able to access the db directly with SSMS on my local box. I've seen the other questions about allowing remote access to the database, but my question is, is this safe? I'm concerned that I'm opening a hole in the firewall and potential for hack attempts. Is this just a bad idea in general?

    Read the article

  • just another apache to nginx rewrite question

    - by Brandon
    I have the following Apache rewrite directives: RewriteCond %{REQUEST_URI} ^/proxy(/|$) [NC] RewriteCond %{QUERY_STRING} (^|&)uri=(.*?)(&|$) [NC] RewriteRule .* /api/vs1.0/%2 [NC,L] And I'm trying out nginx, so trying to move the rewrites over. I came up with... rewrite ^/proxy(/|$) /api/vs1.0/$2 last; rewrite (^|&)uri=(.*?)(&|$) /api/vs1.0/$2 last; Which is probably grossly incorrect. I'm just a mere web developer, so I was wondering if anyone could lend a hand here. I would be much obliged. I see that I am ignoring the query string specification, but I'm thinking that it shouldn't matter. I only have a vague idea of what the original rewrite is accomplishing, so I haven't much hope here in coming up with something decent, despite reading the relevant documentation for both servers.

    Read the article

  • MS Access 2007 end user access

    - by LtDan
    I need some good advise. I have used Access for many years and I use Sharepoint but never the two combined. My newly created Access db needs to be shared with many users across the organization. The back end is SQL and the old way to distribute the database would be placing the db on a shared drive, connecting their PC ODBC connections to the SQL db and then they would open the database and have at it. This has become the OLD way. What is the best (and simpliest) way to allow the end users to utilize a frontend for data entry/edit reporting etc. Can I create a link through SharePoint and the user just open it from there. Your good advise is greatly approciated.

    Read the article

  • htaccess not found

    - by clarkk
    I have installed a Apache 2 (from webmin) server on Debian 6.. I have setup a virtual host db.domain.com on the server which works fine, but .htaccess doesn't work if you get access from the ip address and the directory is listed if no index.php is found? db.domain.com -> 403 forbidden xxx.xxx.xxx.xxx -> gets access to the server Why is .htaccess omitted when you get access from the servers ip address? httpd.conf <Directory *> Options -Indexes FollowSymLinks </Directory> <VirtualHost *:80> ServerName db.domain.com DocumentRoot /var/www </VirtualHost> htaccess order deny,allow deny from all

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Backup all plesk MySQL Databases to individual files

    - by Michael
    Hy, Because I'm new to shell scripting I need a hand. I currently backup all mydatabases to a single file, thing that makes the restore preaty hard. The second problem that my MySQL password dosen't work because of a Plesk bug and i get the password from "/etc/psa/.psa.shadow". Here is the code that I use to backup all my databases to a single file. mysqldump -uadmin -p`cat /etc/psa/.psa.shadow` --all-databases | bzip2 -c > /root/21.10.2013.sql.bz2 I found some scripts on the web that backup each database to individual files but I don't know how to make them work for my situation. Here is a example script: for db in $(mysql -e 'show databases' -s --skip-column-names); do mysqldump $db | gzip > "/backups/mysqldump-$(hostname)-$db-$(date +%Y-%m-%d-%H.%M.%S).gz"; done Can someone help me make the script above work for my situation? Requirements: Backup each database to individual file using plesk password location.

    Read the article

  • sql server: losing identity column on export/import

    - by Y.G.J
    Recently I started dealing with SQL Server, my previous experience was in MS-Access. When I'm doing an import/export of a db, from the server to my computer or even in the server, all column with primary key loose the key. Identity is set to false and even bit is not set to the default. How can I can I use an import/export job to make an exact copy of the db and its data? I don't want to have to perform a backup and restore every time I want the same db somewhere else, for another project, etc. I have read about "edit mapping" and the checkbox but that did not helped with the identity specification... and what about the primary key of the tables and the rest of the things?

    Read the article

  • For a particular domain, how can I cache its JSON responses locally?

    - by Chris
    I'm coding the frontend of a web app that uses XHR to grab JSON data from a 3rd party. The 3rd party service is slow and because of its API design, we need to make a LOT of API requests every time I refresh the page to test some new code. It's making the development loop painful. The requests are GETs, POSTs and PUTs even though I'm pretty sure none of the requests are changing state. I want to go to localhost for the JSON rather than to this 3rd party API - simply to make my development process faster.

    Read the article

  • minimum required bandwidth for remote database server

    - by user66734
    I want to build a small warehousing application for my company. We have a central warehouse which distributes to 8 sales points across the country. They insist on an in-house solution. I am thinking to setup a central mySQL db Linux server and have the branches connect to it to store sales. Queries to the db from the branches will be minimum, maybe 10 per hour. However I need all the branches to be able to store each sale data ( product ID, customer ID ) in the central db at peak time at most once every five minutes. My question is can I get away with simple 24mbps/768kbps DSL lines? If not what is the bandwith requirement? Can I rely on a load balancing router to combine additional lines if needed? Can you propose some server hardware specs?

    Read the article

  • RewriteMap syntax Regex

    - by ienabellamy
    in my .htaccess i've tons of directives, with same syntax: RewriteRule ^(.*)/PRODUCT_1.aspx http://www.site.com/product.php?id_product=2891 RewriteRule ^(.*)/PRODUCT_2.aspx http://www.site.com/product.php?id_product=2896 and everything works. Now, i created a RewriteMap in my because i need to increase velocity (20.000 redirect 301 in htaccess no good), so: RewriteEngine On RewriteMap redirects dbm=db:/var/www/html/presta152/prestashop/redirects.db RewriteCond ${redirects:$1} !="" RewriteRule ^(.*)$ ${redirects:$1} [redirect=permanent,last] and my redirects.db is created by redirects.txt, that contains: /PRODUCT_1.aspx http://www.site.com/product.php?id_product=2891 /PRODUCT_2.aspx http://www.site.com/product.php?id_product=2896 this works if i try to call for example: www.site.com/PRODUCT_1.aspx i'm redirected... but if i try to call www.site.com/everythingpossibileinside/PRODUCT_1.aspx the redirect doesn't work. So, in my .htaccess this rule: RewriteRule ^(.*)/PRODUCT_1.aspx http://www.site.com/product.php?id_product=2891 works, but in my RewriteMap no. I think i must change this directive: RewriteRule ^(.*)$ ${redirects:$1} [redirect=permanent,last] i tried, but unsuccessful. Thanks to all.

    Read the article

< Previous Page | 251 252 253 254 255 256 257 258 259 260 261 262  | Next Page >