Search Results

Search found 62199 results on 2488 pages for 'first order logic'.

Page 255/2488 | < Previous Page | 251 252 253 254 255 256 257 258 259 260 261 262  | Next Page >

  • How do I keep a table in Sync across 4 db's to be used in SQL Replication Filtering?

    - by Refracted Paladin
    I have a Win Form, Data Entry, application that uses 4 seperate Data Bases. This is an occasionally connected app that uses Merge Replication (SQL 2005) to stay in Sync. This is working just fine. The next hurdle I am trying to tackle is adding Filters to my Publications. Right now we are replicating 70mbs, compressed, to each of our 150 subscribers when, truthfully, they only need a tiny fraction of that. Using Filters I am able to accomplish this(see code below) but I had to make a mapping table in order to do so. This mapping table consists of 3 columns. A PrimaryID(Guid), WorkerName(varchar), and ClientID(int). The problem is I need this table present in all FOUR Databases in order to use it for the filter since, to my knowledge, views or cross-db query's are not allowed in a Filter Statement. What are my options? Seems like I would set it up to be maintained in 1 Database and then use Triggers to keep it updated in the other 3 Databases. In order to be a part of the Filter I have to include that table in the Replication Set so how do I flag it appropriately. Is there a better way, altogether? SELECT <published_columns> FROM [dbo].[tblPlan] WHERE [ClientID] IN (select ClientID from [dbo].[tblWorkerOwnership] where WorkerID = SUSER_SNAME()) Which allows you to chain together Filters, this next one is below the first one so it only pulls from the first's Filtered Set. SELECT <published_columns> FROM [dbo].[tblPlan] INNER JOIN [dbo].[tblHealthAssessmentReview] ON [tblPlan].[PlanID] = [tblHealthAssessmentReview].[PlanID] P.S. - I know how illogical the DB structure sounds. I didn't make it. I inherited it and was then told to make it a "disconnected app."

    Read the article

  • Word: MAC 2011, TOC on too many pages

    - by Mark
    I have a Word: MAC 2011 document where the bottom of the first 40 pages or so say "TOC: Page x". This notation appears to be in the Footer, as it is gray until I click on it (then the rest of the text goes gray instead). There is no TOC that I can see in the document, so I'm presuming someone tried to create one and messed things up. After the first 40 pages or so, all the other bottom of the page notations appear to be correct. (i.e. Chapter One, Chapter Two, etc.) How can I get those first 40 pages to be part of Chapter One rather than TOC?

    Read the article

  • Does Win 7 still requires copying all files over before burning to a DVD-R or BD-R?

    - by Jian Lin
    It seems that Win 7 still needs to copy all files over to a folder, before it burns all files to the DVD-R or BD-R? I think since XP or Vista, Windows always copy everything over to a temporary folder before it will burn to an empty DVD-R. So if you just want to burn a 4GB file to an empty DVD-R, it will first make a copy of that file, and then burn it, instead of just burning it without making a copy first. And now on Win 7, it seems like it is the case also? Most other 3rd party burning tools won't make an extra copy of the files first... Win 7 is the exception. Is there a way around it? (to avoid copying over 25GB or 50GB of data before burning)

    Read the article

  • Virtual host doesn't read .htaccess

    - by Charlie
    I just created virtual host: <VirtualHost myvirtualhost:80> ServerAdmin webmaster@myvirtualhost ServerName myvirtualhost DocumentRoot /home/myname/sites/public_html <Directory /> Options FollowSymLinks AllowOverride None </Directory> <Directory /home/myname/sites/public_html/> Options Indexes FollowSymLinks MultiViews AllowOverride None Order allow,deny allow from all </Directory> ScriptAlias /cgi-bin/ /usr/lib/cgi-bin/ <Directory "/usr/lib/cgi-bin"> AllowOverride None Options +ExecCGI -MultiViews +SymLinksIfOwnerMatch Order allow,deny Allow from all </Directory> ErrorLog /var/log/apache2/error.log # Possible values include: debug, info, notice, warn, error, crit, # alert, emerg. LogLevel warn CustomLog /var/log/apache2/access.log combined Alias /doc/ "/usr/share/doc/" <Directory "/usr/share/doc/"> Options Indexes MultiViews FollowSymLinks AllowOverride None Order deny,allow Deny from all Allow from 127.0.0.0/255.0.0.0 ::1/128 </Directory> It works, but it cant read .htacces file in public_html: DirectoryIndex otherindex.php I tried change all AllowOverride to All, but I get 500 error. How can I fix this ? thanks.

    Read the article

  • Pre-load MS Windows right-click menus and Start menu at startup

    - by Steve
    Hello brainy people. On my WinXP SP3 laptop (1.4Ghz 1.2GB ram), after I first log in, when I right-click in Windows Explorer and choose New, the submenu can take up to 15 seconds to load, which is a pain in the ass when you want to do a quick easy operation. After the submenu has loaded the first time, subsequent loads perform instantly, obviously as the menu has been cached. My question is: can these right-click menus (and the Start menu, which also takes some time to load the first time) be pre-loaded at Windows startup? Thanks.

    Read the article

  • Apache Redirect is redirecting all HTTP instead of just one subdomain

    - by David Kaczynski
    All HTTP requests, such as http://example.com, are getting redirected to https://redmine.example.com, but I only want http://redmine.example.com to be redirected. For example, requests for I have the following in my 000-default configuration: <VirtualHost *:80> ServerName redmine.example.com DocumentRoot /usr/share/redmine/public Redirect permanent / https://redmine.example.com </VirtualHost> <VirtualHost *:80> ServerAdmin webmaster@localhost DocumentRoot /var/www <Directory /> Options FollowSymLinks AllowOverride None </Directory> <Directory /var/www/> Options Indexes FollowSymLinks MultiViews AllowOverride None Order allow,deny allow from all </Directory> . . . </VirtualHost> Here is my default-ssl configuration: <VirtualHost *:443> ServerName redmine.example.com DocumentRoot /usr/share/redmine/public SSLEngine on SSLCertificateFile /etc/ssl/certs/ssl-cert-snakeoil.pem SSLCertificateKeyFile /etc/ssl/private/ssl-cert-snakeoil.key BrowserMatch "MSIE [2-6]" \ nokeepalive ssl-unclean-shutdown \ downgrade-1.0 force-response-1.0 BrowserMatch "MSIE [17-9]" ssl-unclean-shutdown <Directory /usr/share/redmine/public> Options FollowSymLinks AllowOverride None Order allow,deny Allow from all </Directory> LogLevel info ErrorLog /var/log/apache2/redmine-error.log CustomLog /var/log/apache2/redmine-access.log combined </VirtualHost> <VirtualHost *:443> ServerAdmin webmaster@localhost DocumentRoot /var/www <Directory /> Options FollowSymLinks AllowOverride None </Directory> <Directory /var/www/> Options Indexes FollowSymLinks MultiViews AllowOverride None Order allow,deny allow from all </Directory> . . . </VirtualHost> Is there anything here that is cause all HTTP requests to be redirected to https://redmine.example.com?

    Read the article

  • Why does Windows Explorer highlight only second entry?

    - by normanius
    Why does Windows Explorer highlight the second but never the first entry if I use the keyboard for navigation? Example: let's look at a folder that contains the following entries a1 a2 a3 b1 b2 If I hit 'a' on the keyboard, the explorer highlights entry 'a2' instead of 'a1'. It works fine for 'b' with 'b1' (because it's not the first entry). Similarly, if I open a folder and use the arrow-down key to navigate then the first entry is skipped again. Why?! It's probable that I'm too stupid for this but this "feature" really annoys me!

    Read the article

  • How Do I Enable CUPS Browsing Across A Network?

    - by David Mackintosh
    I have a CUPS server with two print queues defined. Once this was defined, all the CUPS clients on the same subnet could see the two print queues automatically, no problem. Now I have a collection of machines on a separate subnet, reachable from the first subnet by a router. How do I enable CUPS browsing on the second set of machines so that they can see the print queues defined on the first machine? Let's call the server A.B.C.7. The first subnet is A.B.C.0/24. The second subnet is A.B.D.0/24, and there is a router with arms on both networks.

    Read the article

  • What may be wrong with String::ToIdentifier::EN tests?

    - by wk01
    I try to install Perl module String::ToIdentifier::EN (as depndency of DBIx::Class::Schema::Loader) but it fails on tests. I googled those errors but get no picture, where is problem: Building and testing String-ToIdentifier-EN-0.07 cp lib/String/ToIdentifier/EN.pm blib/lib/String/ToIdentifier/EN.pm cp lib/String/ToIdentifier/EN/Unicode.pm blib/lib/String/ToIdentifier/EN/Unicode.pm Manifying blib/man3/String::ToIdentifier::EN.3pm Manifying blib/man3/String::ToIdentifier::EN::Unicode.3pm PERL_DL_NONLAZY=1 /usr/bin/perl "-MExtUtils::Command::MM" "-e" "test_harness(0, 'inc', 'blib/lib', 'blib/arch')" t/00_basic.t t/10_ascii.t t/20_capitalization.t Byte order is not compatible at ../../lib/Storable.pm (autosplit into ../../lib/auto/Storable/_retrieve.al) line 380, at /home/wanradt/perl5/lib/perl5/Lingua/EN/Tagger.pm line 167 # Looks like you planned 25 tests but ran 4. # Looks like your test exited with 25 just after 4. t/00_basic.t ........... Dubious, test returned 25 (wstat 6400, 0x1900) Failed 21/25 subtests Byte order is not compatible at ../../lib/Storable.pm (autosplit into ../../lib/auto/Storable/_retrieve.al) line 380, at /home/wanradt/perl5/lib/perl5/Lingua/EN/Tagger.pm line 167 # Looks like you planned 768 tests but ran 512. # Looks like your test exited with 25 just after 512. t/10_ascii.t ........... Dubious, test returned 25 (wstat 6400, 0x1900) Failed 256/768 subtests t/20_capitalization.t .. ok Test Summary Report ------------------- t/00_basic.t (Wstat: 6400 Tests: 4 Failed: 0) Non-zero exit status: 25 Parse errors: Bad plan. You planned 25 tests but ran 4. t/10_ascii.t (Wstat: 6400 Tests: 512 Failed: 0) Non-zero exit status: 25 Parse errors: Bad plan. You planned 768 tests but ran 512. Files=3, Tests=528, 1 wallclock secs ( 0.07 usr 0.02 sys + 0.42 cusr 0.04 csys = 0.55 CPU) Result: FAIL Failed 2/3 test programs. 0/528 subtests failed. make: *** [test_dynamic] Error 255 -> FAIL Installing String::ToIdentifier::EN failed. See /home/wanradt/.cpanm/build.log for details. Byte order is not compatible at... seems a key, but to where?

    Read the article

  • Apache directory access with virtual host

    - by alexeygaidamaka
    I have a virtual host with a configuration like that. When i'm trying to get into foobar.com/dir providing valid username/password pair i get 403 forbidden page instead of that directory contents. www.foobar.com/dir has 777 rights, .httpaswd is chmoded 644. But i can't figure out why i am still not seeing contents. Please, give me a hint. ServerAdmin webmaster@localhost ServerName www.foobar.com ServerAlias www.foobar.com DocumentRoot /var/www/foobar <Directory /> Options FollowSymLinks AllowOverride All </Directory> <Directory /var/www/foobar> Options -Indexes FollowSymLinks AllowOverride All Order allow,deny allow from all </Directory> ScriptAlias /cgi-bin/ /usr/lib/cgi-bin/ <Directory "/usr/lib/cgi-bin"> AllowOverride None Options +ExecCGI -MultiViews +SymLinksIfOwnerMatch Order allow,deny Allow from all </Directory> <Directory /var/www/foobar/dir> AllowOverride AuthConfig AuthName "Authorize yourself, please!" AuthType Basic AuthUserFile /etc/apache2/.htpasswd AuthGroupFile /dev/null Allow from All Order Allow,Deny Require valid-user

    Read the article

  • Is there a reason the partition tool GParted doesn't show a percentage finish number initially?

    - by Jian Lin
    I am using GParted more, and it seems to do a reliable work. I just wonder why if the tasks is to resize a 250GB partition to 190GB, and then create a new partition, the first 10, 15 minutes, there is only a blue bar moving left and right, but there won't be an indicator showing how many percent is done. Then after that 10 to 15 minutes, it does show 1:05:00 left to finish the job. Update: at first I thought there is no percentage or time remaining at all... but after waiting for 10, 15 mintues, it does show. I just wonder why it didn't show at first.

    Read the article

  • Enabling `mod_rewrite` apache, permissions issues

    - by rudolph9
    In attempting to enable mod_rewrite on the Apache2 web server installed with Mac OSX 10.7.4. Following these instruction, ultimately using the configuration to host CakePHP applications, I run into permissions issues accessing the site via a web browser when I set the directory block associated with cakephp site /etc/apache2/users/username.conf from: <Directory "/Users/username/Sites/"> Options Indexes FollowSymLinks MultiViews AllowOverride none Order allow,deny Allow from all </Directory> /etc/apache2/users/username.conf to: <Directory "/Users/username/Sites/"> Options Indexes MultiViews AllowOverride none Order allow,deny Allow from all </Directory> <Directory "/Users/username/Sites/cakephp_app/"> Options Indexes FollowSymLinks MultiViews AllowOverride all Order allow,deny Allow from all </Directory> The .htaccess files are the CakePHP 2.2.2 default as follows: /Users/username/Sites/cakephp_app/.htaccess <IfModule mod_rewrite.c> RewriteEngine on RewriteRule ^$ app/webroot/ [L] RewriteRule (.*) app/webroot/$1 [L] </IfModule> /Users/username/Sites/cakephp_app/app/.htaccess <IfModule mod_rewrite.c> RewriteEngine on RewriteRule ^$ webroot/ [L] RewriteRule (.*) webroot/$1 [L] </IfModule> /Users/username/Sites/cakephp_app/app/webroot/.htaccess <IfModule mod_rewrite.c> RewriteEngine on RewriteCond %{REQUEST_FILENAME} !-d RewriteCond %{REQUEST_FILENAME} !-f RewriteRule ^(.*)$ index.php [QSA,L] </IfModule> When performing the request via a web browser at to http://0.0.0.0/~username/cakephp_app/index.php the content of the response is Not Found The requested URL /Users/username/Sites/cakephp_app/app/webroot/ was not found on this server. Apache/2.2.21 (Unix) DAV/2 PHP/5.3.10 with Suhosin-Patch Server at 0.0.0.0 Port 80 Upon a request to http://0.0.0.0/~username/ and http://0.0.0.0/~username/cakephp_app/, added to /var/log/apache2/error_log accordingly are the following: [Tue Sep 04 22:53:26 2012] [error] [client 127.0.0.1] File does not exist: /Library/WebServer/Documents/Users, referer: http://0.0.0.0/~username/ [Tue Sep 04 22:53:26 2012] [error] [client 127.0.0.1] File does not exist: /Library/WebServer/Documents/favicon.ico What is causing the issue? Is there server program, ideally available via a homebrew script, which would make hosting CakePHP applications for testing purposes more effective and efficient?

    Read the article

  • Boot from Second SATA Drive

    - by Chris
    I have a Dell Precision 490 Workstation, and I just had my other question answered, Install Ubuntu to drive B without impacting drive A, and now I'm having a boot sequence issue. The external drive is great, boots up fine on my laptop, but how do I tell my desktop to boot from my second SATA drive and not the first SATAdrive. My drive configuration as follows SATA-0: Windows SATA-1: DVDR SATA-2: Ubuntu When I choose the boot menu, the option I have is "Internal Hard Drive". I assume it searches all drives, and loads the first bootable one it finds (which happens to be Windows), but I'd like to be able to select the drive from a list. Has anyone experienced this? Is possible without disabling the first hard drive in the BIOS?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • ESX Firewall Command Troubles

    - by John
    Hi, I am working on creating some firewall rules to stop some of the SSH brute-force attacks that we have seen recently on our ESX server hosts. I have tried the following rules from the CLI to first block all SSH traffic and then allow the two ranges that I am interested in: esxcfg-firewall --ipruleAdd 0.0.0.0/0,22,tcp,REJECT,"Block_SSH" esxcfg-firewall --ipruleAdd 11.130.0.0/16,22,tcp,ACCEPT,"Allow_PUBLIC_SSH" esxcfg-firewall --ipruleAdd 10.130.0.0/16,22,tcp,ACCEPT,"Allow_PRIVATE_SSH" However, these rules are not working as intended. I know that if you do not enter the block rule first, then the allow rule will not be processed. We are now having the issue where the first entered allow rule is being ignored such that the block rule works and the last entered allow rule works. I was curious if anyone had any ideas on how I could allow a few different ranges of IP's with the esxcfg-firewall --ipruleAdd command? I am at a loss and am having a hard time locating examples or further documentation about this. Thanks in advance for your help with this.

    Read the article

  • How to convert excel individual cell values to percentage change values over time

    - by cgalloway
    I have two years of excel data showing daily share prices of a particular stock. I want to change those values to show percentage change (on a daily basis) from the zero date (ie the first day of the two year period). I know that the formula for showing daily percentage change would be (second day/first day -1) and that I can click and drag on that formula to extend over the rest of the two-year time period. The formula I want would be, basically, (each day/first day-1). Is there an easy way to automate the script so I dont have to type it out 730 times?

    Read the article

  • Sudo asks for password twice with LDAP authentication

    - by Gnudiff
    I have Ubuntu 8.04 LTS machine and Windows 2003 AD domain. I have succesfully set up that I can log in with domain username and password, using domain prefix, like "domain+username". Upon login to machine it all works first try, however, for some reason when I try to sudo my logged in user, it asks for the password twice every time when I try sudo. It accepts the password after 2nd time, but not the first time. Once or twice I might think I just keep entering wrong pass the first time, but this is what happens always, any ideas of what's wrong? pam.conf is empty pam.d/sudo only includes common-auth & common-account, and common-auth is: auth sufficient pam_unix.so nullok_secure auth sufficient pam_winbind.so auth requisite pam_deny.so auth required pam_permit.so

    Read the article

  • How can I password protect & let cgi-bin to work?

    - by jaaaaaaax
    This is taken from sites-available directory. It's a virtual host setting for apache. Accessing myiphere/cgi-bin/ throws 403. The directory setting for /var/www2/ drwxrwxrwx 8 www-data www-data NameVirtualHost myiphere <VirtualHost myiphere> ServerAdmin webmaster@localhost DocumentRoot /var/www2/ <Directory /> Options FollowSymLinks AllowOverride None </Directory> <Directory /var/www2/> Options Indexes FollowSymLinks MultiViews AllowOverride None Order allow,deny allow from all </Directory> ScriptAlias /cgi-bin/ /usr/lib/cgi-bin/ <Directory "/usr/lib/cgi-bin"> AllowOverride None Options +ExecCGI -MultiViews +SymLinksIfOwnerMatch Order allow,deny Allow from all </Directory> ErrorLog /var/log/apache2/error.log # Possible values include: debug, info, notice, warn, error, crit, # alert, emerg. LogLevel warn CustomLog /var/log/apache2/access.log combined ServerSignature On Alias /doc/ "/usr/share/doc/" <Directory "/usr/share/doc/"> Options Indexes MultiViews FollowSymLinks AllowOverride None Order deny,allow Deny from all Allow from 127.0.0.0/255.0.0.0 ::1/128 </Directory>

    Read the article

  • Merged rows in column, bottom row fixed height

    - by Styxxy
    I've been struggling some time now with a specific problem using Tables in MS Word (2010). I have a table with 2 rows and 2 columns and the last column, the rows are merged. Now it can happen that this last cell will expand, and I would like to have the last row in the first column to be of a fixed height and the first row has to expand. What happens now is that the last row expands and the first row has a "fixed" height. A picture of the behaviour at this moment: And this is how I would like it to behave: I have been looking through all properties and settings, but I don't seem to find any option. Neither can I found anything by searching online (probably not using the exact right keywords). Any help is appreciated.

    Read the article

  • Apache directory access with virtual host [SOLVED]

    - by alexeygaidamaka
    I have a virtual host with a configuration like that. When i'm trying to get into foobar.com/dir providing valid username/password pair i get 403 forbidden page instead of that directory contents. www.foobar.com/dir has 777 rights, .httpaswd is chmoded 644. But i can't figure out why i am still not seeing contents. Please, give me a hint. ServerAdmin webmaster@localhost ServerName www.foobar.com ServerAlias www.foobar.com DocumentRoot /var/www/foobar <Directory /> Options FollowSymLinks AllowOverride All </Directory> <Directory /var/www/foobar> Options -Indexes FollowSymLinks AllowOverride All Order allow,deny allow from all </Directory> ScriptAlias /cgi-bin/ /usr/lib/cgi-bin/ <Directory "/usr/lib/cgi-bin"> AllowOverride None Options +ExecCGI -MultiViews +SymLinksIfOwnerMatch Order allow,deny Allow from all </Directory> <Directory /var/www/foobar/dir> AllowOverride AuthConfig AuthName "Authorize yourself, please!" AuthType Basic AuthUserFile /etc/apache2/.htpasswd AuthGroupFile /dev/null Allow from All Order Allow,Deny Options +Indexes<<- that one should be added Require valid-user you have to add the line Options +Indexes to see directory contents

    Read the article

  • Asterisk Register username with special character like "@"

    - by Najibul Huq
    I am using a SIP provider that has provided me with a username like: [email protected] (Note this is only the username part) And has a numerical password. My Register string looks something like this: [email protected]:[email protected] But this is not working, as asterisk is only sending the first part +112223344 before the first @. My provider is adamant about having the full form of it. This is the first time I am facing this issue that is quite unusual for me. Please help.

    Read the article

  • .htaccess redirect working on localhost but not on server

    - by Thread7
    I want users who hit my web site's root directory to be sent to a subdirectory. So anyone going to: http://MyDomain.com or /index.php would be sent to http://MyDomain.com/subdir I used the .htaccess file to successfully do this on my local machine (with Apache 2). But it doesn't work on the server? Users still see the default index.php in the root directory. Here is my simple .htaccess file. Any ideas? RewriteEngine On Redirect /index.php http://MyDomain.com/subdir/ Now my httpd.conf file AccessFileName .htaccess <Directory /> Options FollowSymLinks AllowOverride All </Directory> <Directory "/var/www/icons"> Options Indexes MultiViews FollowSymLinks AllowOverride None Order allow,deny Allow from all </Directory> <Directory "/var/www/cgi-bin"> AllowOverride None Options None Order allow,deny Allow from all </Directory> <IfModule mod_negotiation.c> <IfModule mod_include.c> <Directory "/var/www/error"> AllowOverride None Options IncludesNoExec AddOutputFilter Includes html AddHandler type-map var Order allow,deny Allow from all LanguagePriority en es de fr ForceLanguagePriority Prefer Fallback </Directory> </IfModule> </IfModule>

    Read the article

  • What's the proper way to prepare chroot to recover a broken Linux installation?

    - by ~quack
    This question relates to questions that are asked often. The procedure is frequently mentioned or linked to offsite, but is not often clearly and correctly stated. In an objective to concentrate useful information in one place, this question seeks to provide a clear, correct reference for this procedure. What are the proper steps to prepare a chroot environment for a recovery procedure? In many situations, repairing a broken Linux installation is best done from within the installation. But if the system won't boot, how do you fix it from within? Let's assume you manage to boot into an alternate system. Once there, you need to access your broken installation in order to fix it. Many recovery How-Tos recommend using chroot in order to run programs as if you are actually booted into the broken installation. What is the basic procedure? Are there accepted best-practices to follow? What variables need to be considered in order to adapt the basic preparation steps to a particular recovery task? As this is Community Wiki, feel free to edit this question to improve it as well.

    Read the article

  • Ubuntu 12.04 on Amazon EC2: /dev/xvda1 will be checked for errors at next reboot?

    - by cwd
    I'm running the lastest Ubuntu 12.04 AMI (ami-a29943cb) from Canonical on Amazon EC2 and quite often when I log in I get the message: *** /dev/xvda1 will be checked for errors at next reboot *** I have read a bunch of documentation on this and seem to understand that every so many reboots (around 37 see Mount count / Maximum mount count below) Ubuntu wants to check a disk for errors. I can see that by using dumpe2fs -h /dev/xvda1 (reference) to get information such as: Last mounted on: / Filesystem UUID: 1ad27d06-4ecf-493d-bb19-4710c3caf924 Filesystem magic number: 0xEF53 Filesystem revision #: 1 (dynamic) Filesystem features: has_journal ext_attr resize_inode dir_index filetype needs_recovery extent flex_bg sparse_super large_file huge_file uninit_bg dir_nlink extra_isize Filesystem flags: signed_directory_hash Default mount options: (none) Filesystem state: clean Errors behavior: Continue Filesystem OS type: Linux Inode count: 524288 Block count: 2097152 Reserved block count: 104857 Free blocks: 1778055 Free inodes: 482659 First block: 0 Block size: 4096 Fragment size: 4096 Reserved GDT blocks: 511 Blocks per group: 32768 Fragments per group: 32768 Inodes per group: 8192 Inode blocks per group: 512 Flex block group size: 16 Filesystem created: Tue Apr 24 03:07:48 2012 Last mount time: Thu Nov 8 03:17:58 2012 Last write time: Tue Apr 24 03:08:52 2012 Mount count: 3 Maximum mount count: 37 Last checked: Tue Apr 24 03:07:48 2012 Check interval: 15552000 (6 months) Next check after: Sun Oct 21 03:07:48 2012 Lifetime writes: 2454 MB Reserved blocks uid: 0 (user root) Reserved blocks gid: 0 (group root) First inode: 11 Inode size: 256 Required extra isize: 28 Desired extra isize: 28 Journal inode: 8 Default directory hash: half_md4 Directory Hash Seed: 0a25e04c-6169-4d68-bfa6-a1acd8e39632 Journal backup: inode blocks Journal features: journal_incompat_revoke Journal size: 128M Journal length: 32768 Journal sequence: 0x0000158b Journal start: 1 I've tried these things to get rid of the message and usually the badblocks is what does it for me: Run this command and reboot: sudo touch /forcefsck Run badblocks to check the disk: badblocks /dev/sda1 Edit /etc/fstab and change the last "0" which is the fs_passno column accordingly and then reboot: The root filesystem should be specified with a fs_passno of 1, and other filesystems should have a fs_passno of 2. I don't understand: If this is a virtual drive shouldn't it be less prone to errors? Was the image created with one of the flags set? If not what is triggering it? Why is fs_passno set to 0 on Amazon EC2 Ubuntu images? This is not the first one that is like this.

    Read the article

  • Sublinear Extra Space MergeSort

    - by hulkmeister
    I am reviewing basic algorithms from a book called Algorithms by Robert Sedgewick, and I came across a problem in MergeSort that I am, sad to say, having difficulty solving. The problem is below: Sublinear Extra Space. Develop a merge implementation that reduces that extra space requirement to max(M, N/M), based on the following idea: Divide the array into N/M blocks of size M (for simplicity in this description, assume that N is a multiple of M). Then, (i) considering the blocks as items with their first key as the sort key, sort them using selection sort; and (ii) run through the array merging the first block with the second, then the second block with the third, and so forth. The problem I have with the problem is that based on the idea Sedgewick recommends, the following set of arrays will not be sorted: {0, 10, 12}, {3, 9, 11}, {5, 8, 13}. The algorithm I use is the following: Divide the full array into subarrays of size M. Run Selection Sort on each of the subarrays. Merge each of the subarrays using the method Sedgwick recommends in (ii). (This is where I encounter the problem of where to store the results after the merge.) This leads to wanting to increase the size of the auxiliary space needed to handle at least two subarrays at a time (for merging), but based on the specifications of the problem, that is not allowed. I have also considered using the original array as space for one subarray and using the auxiliary space for the second subarray. However, I can't envision a solution that does not end up overwriting the entries of the first subarray. Any ideas on other ways this can be done? NOTE: If this is suppose to be on StackOverflow.com, please let me know how I can move it. I posted here because the question was academic.

    Read the article

< Previous Page | 251 252 253 254 255 256 257 258 259 260 261 262  | Next Page >