Search Results

Search found 17634 results on 706 pages for 'django multi db'.

Page 266/706 | < Previous Page | 262 263 264 265 266 267 268 269 270 271 272 273  | Next Page >

  • Set up Glassfish connection pool to talk to a database on a Ubuntu VPS

    - by Harry Pham
    On my Ubuntu VPS, i have a mysql server running and a Glassfish 3.0.1 Application Server running. And I am having a hard to have my GF successfully ping the database. Here is my GF set up Assume: x.y.z.t is the ip of my VPS Resource Type: javax.sql.ConnectionPoolDataSource User: root DatabaseName: scholar Url: jdbc:mysql://x.y.z.t:3306/scholar URL: jdbc:mysql://x.y.z.t:3306/scholar Password: xxxx PortNumber: 3306 ServerName: x.y.z.t Inside my glassfish3/glassfish/lib, I have my mysql-connector-java-5.1.13-bin.jar Inside the database, table mysql here is the result of the query select User, Host from user; +------------------+-----------+ | User | Host | +------------------+-----------+ | root | 127.0.0.1 | | debian-sys-maint | localhost | | root | localhost | | root | yunaeyes | +------------------+-----------+ Now from my machine, if I try to connect to this db via mysql browser (mysql client software), well I cant. Well from the table above, seem like it only allow localhost to connect to this db. Keep in mind that both my db and my GF are on the same VPS. Please help

    Read the article

  • How to use Binary Log file for Auditing and Replicating in MySQL?

    - by Pranav
    How to use Binary Log file for Auditing in MySQL? I want to track the change in a DB using Binary Log so that I can replicate these changes to other DB please do not give me hyperlinks for MySQL website. please direct me to find the solution EDIT I have looked for auditing options and created a script using Triggers for that, but due toi the Joomla DB structure it did'nt worked for me, hence I have to move on to Binary Log file concept now i am stucked in initiating the concept as I am not getting the concept of making the server master/slave, so can any body guide me how to actually initiate it via PHP?

    Read the article

  • How to proxy to different named databases on the same server using MySQL Proxy?

    - by cclark
    I would like to have two databases on my MySQL server: DEV_DB_A DEV_DB_B However, in order to keep everyone's scripts, Query Browser settings and anything else from changing when we switch from using on DB to another I'd like to have everyone connect to DEV_DB and then use something like MySQL Proxy running a lua script which knows the currently active DB is DEV_DB_A and routes queries to there. If we restore a fresh version of the DB to DEV_DB_B or make some changes (e.g. partition a table) we can easily switch to DEV_DB_B by changing one Lua script instead of updating references everywhere. I had hoped I might be able to symlink inside of the mysql data directory but that didn't work so it seems like MySQL Proxy is a reasonable approach. Being new to Lua and MySQL Proxy I'm wondering if anyone else has approached the problem this way and how it worked.

    Read the article

  • How to use Binary Log file for Auditing and Replicating in MySQL?

    - by Pranav
    How to use Binary Log file for Auditing in MySQL? I want to track the change in a DB using Binary Log so that I can replicate these changes to other DB please do not give me hyperlinks for MySQL website. please direct me to find the solution I have looked for auditing options and created a script using Triggers for that, but due toi the Joomla DB structure it did'nt worked for me, hence I have to move on to Binary Log file concept now i am stucked in initiating the concept as I am not getting the concept of making the server master/slave, so can any body guide me how to actually initiate it via PHP?

    Read the article

  • Multiple client connecting to master MySQL over SSL

    - by Bastien974
    I successfully configured a MySQL replication over SSL between 2 servers accross the internet. Now I want a second server in the same location as the replication slave, to open a connection to the master db over ssl. I used the same command found here http://dev.mysql.com/doc/refman/5.1/en/secure-create-certs.html to generate a new set of client-cert.pem and client-key.pem with the same master db ca-cert/key.pem and I also used a different Common Name. When I try to initiate a connection between this new server and the master db, it fails : mysql -hmasterdb -utestssl -p --ssl-ca=/var/lib/mysql/newcerts/ca-cert.pem --ssl-cert=/var/lib/mysql/newcerts/client-cert.pem --ssl-key=/var/lib/mysql/newcerts/client-key.pem ERROR 2026 (HY000): SSL connection error It's working without SSL.

    Read the article

  • Hyper-V cluster VS regular cluster

    - by Sasha
    We need to choice between Hyper-V and regular cluster technologies. What is the advantage and disadvantage of these approaches? Update: We have to physical servers and want to build reliably solution using cluster approach. We need to clustering our application and DB (MS SQL). We know that we can use: Regular Windows Cluster Service. Application and DB will be migrating from one node to other. Hyper-V Failover Cluster. Virtual machine will be migrating from one node to other. Combined variant. DB mirroring for MS SQL and Hyper-V for our application. We need to make a choice between this approach. So we need to know advantage and disadvantage of these approaches?

    Read the article

  • Migrating data from Oracle database to Pervasive .DAT files

    - by kaychaks
    The requirement is to migrate some tables with data from a Oracle database server to Pervasive database's .DAT file. Then those .DAT files will be used by a Pervasive database server. The restriction is that Oracle DB can not directly migrate to the Pervasive DB. It has to generate the .DAT files and then the new .DAT files will replace the old one for the Pervasive DB which will then use them for the new data. I was trying this task with SSIS. Exporting the Oracle table to a delimited .txt file and then creating a .DAT file from that text file. I can export the data from Oracle to .txt but I am not finding any way to migrate .txt to Pervasive .DAT? Is this the right approach? If not then please help with my problem.

    Read the article

  • DBD::mysql gives mysql_init not found

    - by highBandWidth
    I have to install a non-admin copy of mysql and perl module DBD::mysql in my home directory. I installed mysql in ~/software/db/mysql and this works since I can start and stop the server and go to the mysql prompt. Then, I downloaded the perl module and installed it using perl Makefile.PL PREFIX=~/myperl/ LIB=~/myperl/lib/lib64/perl5/ --mysql_config=/my_home/software/db/mysql/bin/mysql_config --libs=/myhome/software/db/mysql/lib/libmysqlclient.a make make install I did this to use the statically linked mysql client library. perl -MDBD::mysql -e 1 gives no errors. However, when I actually try to use the module, I get /usr/bin/perl: symbol lookup error: /myhome/myperl/lib/lib64/perl5/x86_64-linux-thread-multi/auto/DBD/mysql/mysql.so: undefined symbol: mysql_init

    Read the article

  • zero downtime during database scheme upgrade on SQL 2008

    - by eject
    I have web application on IIS7 with SQL server 2008 as RDBMS. Need get 0 downtime during future upgrades of ASP.NET code and DB schema as well. I need to get right scenario for this. I have 2 web servers and 2 sql servers and one http load balancer whcih allows to switch web backend server for web requests. Main goal is to make 1st web server and DB server up and running, update code and db schema on 2nd server and then switch all the requests to 2nd server and then main problem - how to copy data from 1st database 2nd (which was changed during upgrade).

    Read the article

  • Is allowing remote Sql Server Management Studio safe?

    - by dave thieben
    I administer a website that runs on IIS on one box, and SQL Server 2008 Workgroup on another box. typically I remote into the DB box and run SSMS to work on the db, but I would like to be able to access the db directly with SSMS on my local box. I've seen the other questions about allowing remote access to the database, but my question is, is this safe? I'm concerned that I'm opening a hole in the firewall and potential for hack attempts. Is this just a bad idea in general?

    Read the article

  • Backup all plesk MySQL Databases to individual files

    - by Michael
    Hy, Because I'm new to shell scripting I need a hand. I currently backup all mydatabases to a single file, thing that makes the restore preaty hard. The second problem that my MySQL password dosen't work because of a Plesk bug and i get the password from "/etc/psa/.psa.shadow". Here is the code that I use to backup all my databases to a single file. mysqldump -uadmin -p`cat /etc/psa/.psa.shadow` --all-databases | bzip2 -c > /root/21.10.2013.sql.bz2 I found some scripts on the web that backup each database to individual files but I don't know how to make them work for my situation. Here is a example script: for db in $(mysql -e 'show databases' -s --skip-column-names); do mysqldump $db | gzip > "/backups/mysqldump-$(hostname)-$db-$(date +%Y-%m-%d-%H.%M.%S).gz"; done Can someone help me make the script above work for my situation? Requirements: Backup each database to individual file using plesk password location.

    Read the article

  • htaccess not found

    - by clarkk
    I have installed a Apache 2 (from webmin) server on Debian 6.. I have setup a virtual host db.domain.com on the server which works fine, but .htaccess doesn't work if you get access from the ip address and the directory is listed if no index.php is found? db.domain.com -> 403 forbidden xxx.xxx.xxx.xxx -> gets access to the server Why is .htaccess omitted when you get access from the servers ip address? httpd.conf <Directory *> Options -Indexes FollowSymLinks </Directory> <VirtualHost *:80> ServerName db.domain.com DocumentRoot /var/www </VirtualHost> htaccess order deny,allow deny from all

    Read the article

  • MS Access 2007 end user access

    - by LtDan
    I need some good advise. I have used Access for many years and I use Sharepoint but never the two combined. My newly created Access db needs to be shared with many users across the organization. The back end is SQL and the old way to distribute the database would be placing the db on a shared drive, connecting their PC ODBC connections to the SQL db and then they would open the database and have at it. This has become the OLD way. What is the best (and simpliest) way to allow the end users to utilize a frontend for data entry/edit reporting etc. Can I create a link through SharePoint and the user just open it from there. Your good advise is greatly approciated.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • sql server: losing identity column on export/import

    - by Y.G.J
    Recently I started dealing with SQL Server, my previous experience was in MS-Access. When I'm doing an import/export of a db, from the server to my computer or even in the server, all column with primary key loose the key. Identity is set to false and even bit is not set to the default. How can I can I use an import/export job to make an exact copy of the db and its data? I don't want to have to perform a backup and restore every time I want the same db somewhere else, for another project, etc. I have read about "edit mapping" and the checkbox but that did not helped with the identity specification... and what about the primary key of the tables and the rest of the things?

    Read the article

  • minimum required bandwidth for remote database server

    - by user66734
    I want to build a small warehousing application for my company. We have a central warehouse which distributes to 8 sales points across the country. They insist on an in-house solution. I am thinking to setup a central mySQL db Linux server and have the branches connect to it to store sales. Queries to the db from the branches will be minimum, maybe 10 per hour. However I need all the branches to be able to store each sale data ( product ID, customer ID ) in the central db at peak time at most once every five minutes. My question is can I get away with simple 24mbps/768kbps DSL lines? If not what is the bandwith requirement? Can I rely on a load balancing router to combine additional lines if needed? Can you propose some server hardware specs?

    Read the article

  • RewriteMap syntax Regex

    - by ienabellamy
    in my .htaccess i've tons of directives, with same syntax: RewriteRule ^(.*)/PRODUCT_1.aspx http://www.site.com/product.php?id_product=2891 RewriteRule ^(.*)/PRODUCT_2.aspx http://www.site.com/product.php?id_product=2896 and everything works. Now, i created a RewriteMap in my because i need to increase velocity (20.000 redirect 301 in htaccess no good), so: RewriteEngine On RewriteMap redirects dbm=db:/var/www/html/presta152/prestashop/redirects.db RewriteCond ${redirects:$1} !="" RewriteRule ^(.*)$ ${redirects:$1} [redirect=permanent,last] and my redirects.db is created by redirects.txt, that contains: /PRODUCT_1.aspx http://www.site.com/product.php?id_product=2891 /PRODUCT_2.aspx http://www.site.com/product.php?id_product=2896 this works if i try to call for example: www.site.com/PRODUCT_1.aspx i'm redirected... but if i try to call www.site.com/everythingpossibileinside/PRODUCT_1.aspx the redirect doesn't work. So, in my .htaccess this rule: RewriteRule ^(.*)/PRODUCT_1.aspx http://www.site.com/product.php?id_product=2891 works, but in my RewriteMap no. I think i must change this directive: RewriteRule ^(.*)$ ${redirects:$1} [redirect=permanent,last] i tried, but unsuccessful. Thanks to all.

    Read the article

  • Two way replication

    - by Nidzaaaa
    I have a little problem... I have this case: -2 server instances -2 Databases -1 Table (5 columns) From server 1 I created publication to replicate all columns of table I have in 1. DB From server 2 I created subscription to pull all columns from table which is in server 1 DB But now, I need to publicate one columns of same table from server 2 to server 1 and also it has to be in same DB... I tried with using logic and creating publication for server 2 and subscription on server 1 but there is error appearing "You have selected the Publisher as a Subscriber and entered a subscription database that is the same as the publishing database. Select another subscription database." I hope someone understood my problem and have an answer for me, thanks in advance... p.s. Ask for more info if you need ...

    Read the article

  • Passing integer lists in a sql query, best practices

    - by Artiom Chilaru
    I'm currently looking at ways to pass lists of integers in a SQL query, and try to decide which of them is best in which situation, what are the benefots of each, and what are the pitfalls, what should be avoided :) Right now I know of 3 ways that we currently use in our application. 1) Table valued parameter: Create a new Table Valued Parameter in sql server: CREATE TYPE [dbo].[TVP_INT] AS TABLE( [ID] [int] NOT NULL ) Then run the query against it: using (var conn = new SqlConnection(DataContext.GetDefaultConnectionString)) { var comm = conn.CreateCommand(); comm.CommandType = CommandType.Text; comm.CommandText = @" UPDATE DA SET [tsLastImportAttempt] = CURRENT_TIMESTAMP FROM [Account] DA JOIN @values IDs ON DA.ID = IDs.ID"; comm.Parameters.Add(new SqlParameter("values", downloadResults.Select(d => d.ID).ToDataTable()) { TypeName = "TVP_INT" }); conn.Open(); comm.ExecuteScalar(); } The major disadvantages of this method is the fact that Linq doesn't support table valued params (if you create an SP with a TVP param, linq won't be able to run it) :( 2) Convert the list to Binary and use it in Linq! This is a bit better.. Create an SP, and you can run it within linq :) To do this, the SP will have an IMAGE parameter, and we'll be using a user defined function (udf) to convert this to a table.. We currently have implementations of this function written in C++ and in assembly, both have pretty much the same performance :) Basically, each integer is represented by 4 bytes, and passed to the SP. In .NET we have an extension method that convers an IEnumerable to a byte array The extension method: public static Byte[] ToBinary(this IEnumerable intList) { return ToBinaryEnum(intList).ToArray(); } private static IEnumerable<Byte> ToBinaryEnum(IEnumerable<Int32> intList) { IEnumerator<Int32> marker = intList.GetEnumerator(); while (marker.MoveNext()) { Byte[] result = BitConverter.GetBytes(marker.Current); Array.Reverse(result); foreach (byte b in result) yield return b; } } The SP: CREATE PROCEDURE [Accounts-UpdateImportAttempts] @values IMAGE AS BEGIN UPDATE DA SET [tsLastImportAttempt] = CURRENT_TIMESTAMP FROM [Account] DA JOIN dbo.udfIntegerArray(@values, 4) IDs ON DA.ID = IDs.Value4 END And we can use it by running the SP directly, or in any linq query we need using (var db = new DataContext()) { db.Accounts_UpdateImportAttempts(downloadResults.Select(d => d.ID).ToBinary()); // or var accounts = db.Accounts .Where(a => db.udfIntegerArray(downloadResults.Select(d => d.ID).ToBinary(), 4) .Select(i => i.Value4) .Contains(a.ID)); } This method has the benefit of using compiled queries in linq (which will have the same sql definition, and query plan, so will also be cached), and can be used in SPs as well. Both these methods are theoretically unlimited, so you can pass millions of ints at a time :) 3) The simple linq .Contains() It's a more simple approach, and is perfect in simple scenarios. But is of course limited by this. using (var db = new DataContext()) { var accounts = db.Accounts .Where(a => downloadResults.Select(d => d.ID).Contains(a.ID)); } The biggest drawback of this method is that each integer in the downloadResults variable will be passed as a separate int.. In this case, the query is limited by sql (max allowed parameters in a sql query, which is a couple of thousand, if I remember right). So I'd like to ask.. What do you think is the best of these, and what other methods and approaches have I missed?

    Read the article

  • Does anyone know how to appropriately deal with user timezones in rails 2.3?

    - by Amazing Jay
    We're building a rails app that needs to display dates (and more importantly, calculate them) in multiple timezones. Can anyone point me towards how to work with user timezones in rails 2.3(.5 or .8) The most inclusive article I've seen detailing how user time zones are supposed to work is here: http://wiki.rubyonrails.org/howtos/time-zones... although it is unclear when this was written or for what version of rails. Specifically it states that: "Time.zone - The time zone that is actually used for display purposes. This may be set manually to override config.time_zone on a per-request basis." Keys terms being "display purposes" and "per-request basis". Locally on my machine, this is true. However on production, neither are true. Setting Time.zone persists past the end of the request (to all subsequent requests) and also affects the way AR saves to the DB (basically treating any date as if it were already in UTC even when its not), thus saving completely inappropriate values. We run Ruby Enterprise Edition on production with passenger. If this is my problem, do we need to switch to JRuby or something else? To illustrate the problem I put the following actions in my ApplicationController right now: def test p_time = Time.now.utc s_time = Time.utc(p_time.year, p_time.month, p_time.day, p_time.hour) logger.error "TIME.ZONE" + Time.zone.inspect logger.error ENV['TZ'].inspect logger.error p_time.inspect logger.error s_time.inspect jl = JunkLead.create! jl.date_at = s_time logger.error s_time.inspect logger.error jl.date_at.inspect jl.save! logger.error s_time.inspect logger.error jl.date_at.inspect render :nothing => true, :status => 200 end def test2 Time.zone = 'Mountain Time (US & Canada)' logger.error "TIME.ZONE" + Time.zone.inspect logger.error ENV['TZ'].inspect render :nothing => true, :status => 200 end def test3 Time.zone = 'UTC' logger.error "TIME.ZONE" + Time.zone.inspect logger.error ENV['TZ'].inspect render :nothing => true, :status => 200 end and they yield the following: Processing ApplicationController#test (for 98.202.196.203 at 2010-12-24 22:15:50) [GET] TIME.ZONE#<ActiveSupport::TimeZone:0x2c57a68 @tzinfo=#<TZInfo::DataTimezone: Etc/UTC>, @name="UTC", @utc_offset=0> nil Fri Dec 24 22:15:50 UTC 2010 Fri Dec 24 22:00:00 UTC 2010 Fri Dec 24 22:00:00 UTC 2010 Fri, 24 Dec 2010 22:00:00 UTC +00:00 Fri Dec 24 22:00:00 UTC 2010 Fri, 24 Dec 2010 22:00:00 UTC +00:00 Completed in 21ms (View: 0, DB: 4) | 200 OK [http://www.dealsthatmatter.com/test] Processing ApplicationController#test2 (for 98.202.196.203 at 2010-12-24 22:15:53) [GET] TIME.ZONE#<ActiveSupport::TimeZone:0x2c580a8 @tzinfo=#<TZInfo::DataTimezone: America/Denver>, @name="Mountain Time (US & Canada)", @utc_offset=-25200> nil Completed in 143ms (View: 1, DB: 3) | 200 OK [http://www.dealsthatmatter.com/test2] Processing ApplicationController#test (for 98.202.196.203 at 2010-12-24 22:15:59) [GET] TIME.ZONE#<ActiveSupport::TimeZone:0x2c580a8 @tzinfo=#<TZInfo::DataTimezone: America/Denver>, @name="Mountain Time (US & Canada)", @utc_offset=-25200> nil Fri Dec 24 22:15:59 UTC 2010 Fri Dec 24 22:00:00 UTC 2010 Fri Dec 24 22:00:00 UTC 2010 Fri, 24 Dec 2010 15:00:00 MST -07:00 Fri Dec 24 22:00:00 UTC 2010 Fri, 24 Dec 2010 15:00:00 MST -07:00 Completed in 20ms (View: 0, DB: 4) | 200 OK [http://www.dealsthatmatter.com/test] Processing ApplicationController#test3 (for 98.202.196.203 at 2010-12-24 22:16:03) [GET] TIME.ZONE#<ActiveSupport::TimeZone:0x2c57a68 @tzinfo=#<TZInfo::DataTimezone: Etc/UTC>, @name="UTC", @utc_offset=0> nil Completed in 17ms (View: 0, DB: 2) | 200 OK [http://www.dealsthatmatter.com/test3] Processing ApplicationController#test (for 98.202.196.203 at 2010-12-24 22:16:04) [GET] TIME.ZONE#<ActiveSupport::TimeZone:0x2c57a68 @tzinfo=#<TZInfo::DataTimezone: Etc/UTC>, @name="UTC", @utc_offset=0> nil Fri Dec 24 22:16:05 UTC 2010 Fri Dec 24 22:00:00 UTC 2010 Fri Dec 24 22:00:00 UTC 2010 Fri, 24 Dec 2010 22:00:00 UTC +00:00 Fri Dec 24 22:00:00 UTC 2010 Fri, 24 Dec 2010 22:00:00 UTC +00:00 Completed in 151ms (View: 0, DB: 4) | 200 OK [http://www.dealsthatmatter.com/test] It should be clear above that the 2nd call to /test shows Time.zone set to Mountain, even though it shouldn't. Additionally, checking the database reveals that the test action when run after test2 saved a JunkLead record with a date of 2010-12-22 15:00:00, which is clearly wrong.

    Read the article

  • Dropdownlist post in ASP.NET MVC3 and Entity Framework Model

    - by Josh Blade
    I have 3 tables: RateProfile RateProfileID ProfileName Rate RateID RateProfileID PanelID Other stuff to update Panel PanelID PanelName I have models for each of these. I have an edit page using the RateProfile model. I display the information for RateProfile and also all of the Rates associated with it. This works fine and I can update it fine. However, I also added a dropdown so that I can filter Rates by PanelID. I need it to post back on change so that it can display the filtered rates. I'm using @Html.DropDownList("PanelID", (SelectList)ViewData["PanelDropDown"], new { onchange = "$('#RateForm').submit()" }) for my dropdownlist. Whenever it posts back to my HttpPost Edit method though, it seems to be missing all information about the Rates navigation property. It's weird because I thought it would do exactly what the input/submit button that I have in the form does (which actually passes the entire model back to my HttpPost Edit action and does what I want it to do). The panelID is properly being passed to my HttpPost Edit method and on to the next view, but when I try to query the Model.Rates navigation property is null (only when the post comes from the dropdown. Everything works fine when the post comes from my submit input). Get Edit: public ActionResult Edit(int id, int panelID = 1) { RateProfile rateprofile = db.RateProfiles.Single(r => r.RateProfileID == id); var panels = db.Panels; ViewData["PanelDropDown"] = new SelectList(panels, "PanelID", "PanelName", panelID); ViewBag.PanelID = panelID; return View(rateprofile); } HttpPost Edit: [HttpPost] public ActionResult Edit(RateProfile rateprofile, int panelID) { var panels = db.Panels; ViewData["PanelDropDown"] = new SelectList(panels, "PanelID", "PanelName", panelID); ViewBag.PanelID = panelID; if (ModelState.IsValid) { db.Entry(rateprofile).State = EntityState.Modified; foreach (Rate dimerate in rateprofile.Rates) { db.Entry(dimerate).State = EntityState.Modified; } db.SaveChanges(); return View(rateprofile); } return View(rateprofile); } View: @model PDR.Models.RateProfile @using (Html.BeginForm(null,null,FormMethod.Post, new {id="RateForm"})) { <div> @Html.Label("Panel") @Html.DropDownList("PanelID", (SelectList)ViewData["PanelDropDown"], new { onchange = "$('#RateForm').submit()" }) </div> @{var rates= Model.Rates.Where(a => a.PanelID == ViewBag.PanelID).OrderBy(a => a.minCount).ToList();} @for (int i = 0; i < rates.Count; i++) { <tr> <td> @Html.HiddenFor(modelItem => rates[i].RateProfileID) @Html.HiddenFor(modelItem => rates[i].RateID) @Html.HiddenFor(modelItem => rates[i].PanelID) @Html.EditorFor(modelItem => rates[i].minCount) @Html.ValidationMessageFor(model => rates[i].minCount) </td> <td> @Html.EditorFor(modelItem => rates[i].maxCount) @Html.ValidationMessageFor(model => rates[i].maxCount) </td> <td> @Html.EditorFor(modelItem => rates[i].Amount) @Html.ValidationMessageFor(model => rates[i].Amount) </td> </tr> } <input type="submit" value="Save" /> } To summarize my problem, the below query in my view only works when the post comes from the submit button and not when it comes from my dropdownlist. @{var rates= Model.Rates.Where(a => a.PanelID == ViewBag.PanelID).OrderBy(a => a.minCount).ToList();}

    Read the article

  • Entity Framework version 1- Brief Synopsis and Tips &ndash; Part 1

    - by Rohit Gupta
    To Do Eager loading use Projections (for e.g. from c in context.Contacts select c, c.Addresses)  or use Include Query Builder Methods (Include(“Addresses”)) If there is multi-level hierarchical Data then to eager load all the relationships use Include Query Builder methods like customers.Include("Order.OrderDetail") to include Order and OrderDetail collections or use customers.Include("Order.OrderDetail.Location") to include all Order, OrderDetail and location collections with a single include statement =========================================================================== If the query uses Joins then Include() Query Builder method will be ignored, use Nested Queries instead If the query does projections then Include() Query Builder method will be ignored Use Address.ContactReference.Load() OR Contact.Addresses.Load() if you need to Deferred Load Specific Entity – This will result in extra round trips to the database ObjectQuery<> cannot return anonymous types... it will return a ObjectQuery<DBDataRecord> Only Include method can be added to Linq Query Methods Any Linq Query method can be added to Query Builder methods. If you need to append a Query Builder Method (other than Include) after a LINQ method  then cast the IQueryable<Contact> to ObjectQuery<Contact> and then append the Query Builder method to it =========================================================================== Query Builder methods are Select, Where, Include Methods which use Entity SQL as parameters e.g. "it.StartDate, it.EndDate" When Query Builder methods do projection then they return ObjectQuery<DBDataRecord>, thus to iterate over this collection use contact.Item[“Name”].ToString() When Linq To Entities methods do projection, they return collection of anonymous types --- thus the collection is strongly typed and supports Intellisense EF Object Context can track changes only on Entities, not on Anonymous types. If you use a Defining Query for a EntitySet then the EntitySet becomes readonly since a Defining Query is the same as a View (which is treated as a ReadOnly by default). However if you want to use this EntitySet for insert/update/deletes then we need to map stored procs (as created in the DB) to the insert/update/delete functions of the Entity in the Designer You can use either Execute method or ToList() method to bind data to datasources/bindingsources If you use the Execute Method then remember that you can traverse through the ObjectResult<> collection (returned by Execute) only ONCE. In WPF use ObservableCollection to bind to data sources , for keeping track of changes and letting EF send updates to the DB automatically. Use Extension Methods to add logic to Entities. For e.g. create extension methods for the EntityObject class. Create a method in ObjectContext Partial class and pass the entity as a parameter, then call this method as desired from within each entity. ================================================================ DefiningQueries and Stored Procedures: For Custom Entities, one can use DefiningQuery or Stored Procedures. Thus the Custom Entity Collection will be populated using the DefiningQuery (of the EntitySet) or the Sproc. If you use Sproc to populate the EntityCollection then the query execution is immediate and this execution happens on the Server side and any filters applied will be applied in the Client App. If we use a DefiningQuery then these queries are composable, meaning the filters (if applied to the entityset) will all be sent together as a single query to the DB, returning only filtered results. If the sproc returns results that cannot be mapped to existing entity, then we first create the Entity/EntitySet in the CSDL using Designer, then create a dummy Entity/EntitySet using XML in the SSDL. When creating a EntitySet in the SSDL for this dummy entity, use a TSQL that does not return any results, but does return the relevant columns e.g. select ContactID, FirstName, LastName from dbo.Contact where 1=2 Also insure that the Entity created in the SSDL uses the SQL DataTypes and not .NET DataTypes. If you are unable to open the EDMX file in the designer then note the Errors ... they will give precise info on what is wrong. The Thrid option is to simply create a Native Query in the SSDL using <Function Name="PaymentsforContact" IsComposable="false">   <CommandText>SELECT ActivityId, Activity AS ActivityName, ImagePath, Category FROM dbo.Activities </CommandText></FuncTion> Then map this Function to a existing Entity. This is a quick way to get a custom Entity which is regular Entity with renamed columns or additional columns (which are computed columns). The disadvantage to using this is that It will return all the rows from the Defining query and any filter (if defined) will be applied only at the Client side (after getting all the rows from DB). If you you DefiningQuery instead then we can use that as a Composable Query. The Fourth option (for mapping a READ stored proc results to a non-existent Entity) is to create a View in the Database which returns all the fields that the sproc also returns, then update the Model so that the model contains this View as a Entity. Then map the Read Sproc to this View Entity. The other option would be to simply create the View and remove the sproc altogether. ================================================================ To Execute a SProc that does not return a entity, use a EntityCommand to execute that proc. You cannot call a sproc FunctionImport that does not return Entities From Code, the only way is to use SSDL function calls using EntityCommand.  This changes with EntityFramework Version 4 where you can return Scalar Types, Complex Types, Entities or NonQuery ================================================================ UDF when created as a Function in SSDL, we need to set the Name & IsComposable properties for the Function element. IsComposable is always false for Sprocs, for UDF's set this to true. You cannot call UDF "Function" from within code since you cannot import a UDF Function into the CSDL Model (with Version 1 of EF). only stored procedures can be imported and then mapped to a entity ================================================================ Entity Framework requires properties that are involved in association mappings to be mapped in all of the function mappings for the entity (Insert, Update and Delete). Because Payment has an association to Reservation... hence we need to pass both the paymentId and reservationId to the Delete sproc even though just the paymentId is the PK on the Payment Table. ================================================================ When mapping insert, update and delete procs to a Entity, insure that all the three or none are mapped. Further if you have a base class and derived class in the CSDL, then you must map (ins, upd, del) sprocs to all parent and child entities in the inheritance relationship. Note that this limitation that base and derived entity methods must all must be mapped does not apply when you are mapping Read Stored Procedures.... ================================================================ You can write stored procedures SQL directly into the SSDL by creating a Function element in the SSDL and then once created, you can map this Function to a CSDL Entity directly in the designer during Function Import ================================================================ You can do Entity Splitting such that One Entity maps to multiple tables in the DB. For e.g. the Customer Entity currently derives from Contact Entity...in addition it also references the ContactPersonalInfo Entity. One can copy all properties from the ContactPersonalInfo Entity into the Customer Entity and then Delete the CustomerPersonalInfo entity, finall one needs to map the copied properties to the ContactPersonalInfo Table in Table Mapping (by adding another table (ContactPersonalInfo) to the Table Mapping... this is called Entity Splitting. Thus now when you insert a Customer record, it will automatically create SQL to insert records into the Contact, Customers and ContactPersonalInfo tables even though you have a Single Entity called Customer in the CSDL =================================================================== There is Table by Type Inheritance where another EDM Entity can derive from another EDM entity and absorb the inherted entities properties, for example in the Break Away Geek Adventures EDM, the Customer entity derives (inherits) from the Contact Entity and absorbs all the properties of Contact entity. Thus when you create a Customer Entity in Code and then call context.SaveChanges the Object Context will first create the TSQL to insert into the Contact Table followed by a TSQL to insert into the Customer table =================================================================== Then there is the Table per Hierarchy Inheritance..... where different types are created based on a condition (similar applying a condition to filter a Entity to contain filtered records)... the diference being that the filter condition populates a new Entity Type (derived from the base Entity). In the BreakAway sample the example is Lodging Entity which is a Abstract Entity and Then Resort and NonResort Entities which derive from Lodging Entity and records are filtered based on the value of the Resort Boolean field =================================================================== Then there is Table per Concrete Type Hierarchy where we create a concrete Entity for each table in the database. In the BreakAway sample there is a entity for the Reservation table and another Entity for the OldReservation table even though both the table contain the same number of fields. The OldReservation Entity can then inherit from the Reservation Entity and configure the OldReservation Entity to remove all Scalar Properties from the Entity (since it inherits the properties from Reservation and filters based on ReservationDate field) =================================================================== Complex Types (Complex Properties) Entities in EF can also contain Complex Properties (in addition to Scalar Properties) and these Complex Properties reference a ComplexType (not a EntityType) DropdownList, ListBox, RadioButtonList, CheckboxList, Bulletedlist are examples of List server controls (not data bound controls) these controls cannot use Complex properties during databinding, they need Scalar Properties. So if a Entity contains Complex properties and you need to bind those to list server controls then use projections to return Scalar properties and bind them to the control (the disadvantage is that projected collections are not tracked by the Object Context and hence cannot persist changes to the projected collections bound to controls) ObjectDataSource and EntityDataSource do account for Complex properties and one can bind entities with Complex Properties to Data Source controls and they will be tracked for changes... with no additional plumbing needed to persist changes to these collections bound to controls So DataBound controls like GridView, FormView need to use EntityDataSource or ObjectDataSource as a datasource for entities that contain Complex properties so that changes to the datasource done using the GridView can be persisted to the DB (enabling the controls for updates)....if you cannot use the EntityDataSource you need to flatten the ComplexType Properties using projections With EF Version 4 ComplexTypes are supported by the Designer and can add/remove/compose Complex Types directly using the Designer =================================================================== Conditional Mapping ... is like Table per Hierarchy Inheritance where Entities inherit from a base class and then used conditions to populate the EntitySet (called conditional Mapping). Conditional Mapping has limitations since you can only use =, is null and IS NOT NULL Conditions to do conditional mapping. If you need more operators for filtering/mapping conditionally then use QueryView(or possibly Defining Query) to create a readonly entity. QueryView are readonly by default... the EntitySet created by the QueryView is enabled for change tracking by the ObjectContext, however the ObjectContext cannot create insert/update/delete TSQL statements for these Entities when SaveChanges is called since it is QueryView. One way to get around this limitation is to map stored procedures for the insert/update/delete operations in the Designer. =================================================================== Difference between QueryView and Defining Query : QueryView is defined in the (MSL) Mapping File/section of the EDM XML, whereas the DefiningQuery is defined in the store schema (SSDL). QueryView is written using Entity SQL and is this database agnostic and can be used against any database/Data Layer. DefiningQuery is written using Database Lanaguage i.e. TSQL or PSQL thus you have more control =================================================================== Performance: Lazy loading is deferred loading done automatically. lazy loading is supported with EF version4 and is on by default. If you need to turn it off then use context.ContextOptions.lazyLoadingEnabled = false To improve Performance consider PreCompiling the ObjectQuery using the CompiledQuery.Compile method

    Read the article

  • Need help with PHP web app bootstrapping error potentially related to Zend [migrated]

    - by Matt Shepherd
    I am trying to get a program called OpenFISMA running on an Ubuntu AMI in AWS. The app is not really coded on the Ubuntu platform, but I am in my comfort zone there, and have tried both CentOS and OpenSUSE (both are sort of "native" for the app) for getting it working with the same or worse results. So, why not just get it working on Ubuntu? Anyway, the app is found here: www.openfisma.org and an install guide is found here: https://openfisma.atlassian.net/wiki/display/030100/Installation+Guide The install guide kind of sucks. It doesn't list dependencies in any coherent way or provide much of any detail (does not even mention Zend once on the entire page) so I've done a lot of work to divine the information I do have. This page provided some dependency inf (though again, Zend is not mentioned once): https://openfisma.atlassian.net/wiki/display/PUBLIC/RPM+Management#RPMManagement-BasicOverviewofRPMPackages Anyway, I got all the way through the install (so far as I could reconstruct it). I am going to the login page for the first time, and there should be some sort of bootstrapping occurring when I load the page. (I am not a programmer so I have no idea what it is doing there.) Anyway, I get a message on the web page that says: "An exception occurred while bootstrapping the application." So, then I go look in /var/www/data/logs/php.log and find this message: [22-Oct-2013 17:29:18 UTC] PHP Fatal error: Uncaught exception 'Zend_Exception' with message 'No entry is registered for key 'Zend_Log'' in /var/www/library/Zend/Registry.php:147 Stack trace: #0 /var/www/public/index.php(188): Zend_Registry::get('Zend_Log') #1 {main} thrown in /var/www/library/Zend/Registry.php on line 147 This occurs every time I load the page. I gather there is an issue related to registering the Zend_Log variable in the Zend registry, but other than that I really have no idea what to do about it. Am I missing a package that it needs, or is this app not coded to register the variables properly? I have no clue. Any help is greatly appreciated. The application file referenced in the log message (index.php) is included below. <?php /** * Copyright (c) 2008 Endeavor Systems, Inc. * * This file is part of OpenFISMA. * * OpenFISMA is free software: you can redistribute it and/or modify it under the terms of the GNU General Public * License as published by the Free Software Foundation, either version 3 of the License, or (at your option) any later * version. * * OpenFISMA is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied * warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more * details. * * You should have received a copy of the GNU General Public License along with OpenFISMA. If not, see * {@link http://www.gnu.org/licenses/}. */ try { defined('APPLICATION_PATH') || define( 'APPLICATION_PATH', realpath(dirname(__FILE__) . '/../application') ); // Define application environment defined('APPLICATION_ENV') || define( 'APPLICATION_ENV', (getenv('APPLICATION_ENV') ? getenv('APPLICATION_ENV') : 'production') ); set_include_path( APPLICATION_PATH . '/../library/Symfony/Components' . PATH_SEPARATOR . APPLICATION_PATH . '/../library' . PATH_SEPARATOR . get_include_path() ); require_once 'Fisma.php'; require_once 'Zend/Application.php'; $application = new Zend_Application( APPLICATION_ENV, APPLICATION_PATH . '/config/application.ini' ); Fisma::setAppConfig($application->getOptions()); Fisma::initialize(Fisma::RUN_MODE_WEB_APP); $application->bootstrap()->run(); } catch (Zend_Config_Exception $zce) { // A zend config exception indicates that the application may not be installed properly echo '<h1>The application is not installed correctly</h1>'; $zceMsg = $zce->getMessage(); if (stristr($zceMsg, 'parse_ini_file') !== false) { if (stristr($zceMsg, 'application.ini') !== false) { if (stristr($zceMsg, 'No such file or directory') !== false) { echo 'The ' . APPLICATION_PATH . '/config/application.ini file is missing.'; } elseif (stristr($zceMsg, 'Permission denied') !== false) { echo 'The ' . APPLICATION_PATH . '/config/application.ini file does not have the ' . 'appropriate permissions set for the application to read it.'; } else { echo 'An ini-parsing error has occured in ' . APPLICATION_PATH . '/config/application.ini ' . '<br/>Please check this file and make sure everything is setup correctly.'; } } else if (stristr($zceMsg, 'database.ini') !== false) { if (stristr($zceMsg, 'No such file or directory') !== false) { echo 'The ' . APPLICATION_PATH . '/config/database.ini file is missing.<br/>'; echo 'If you find a database.ini.template file in the config directory, edit this file ' . 'appropriately and rename it to database.ini'; } elseif (stristr($zceMsg, 'Permission denied') !== false) { echo 'The ' . APPLICATION_PATH . '/config/database.ini file does not have the appropriate ' . 'permissions set for the application to read it.'; } else { echo 'An ini-parsing error has occured in ' . APPLICATION_PATH . '/config/database.ini ' . '<br/>Please check this file and make sure everything is setup correctly.'; } } else { echo 'An ini-parsing error has occured. <br/>Please check all configuration files and make sure ' . 'everything is setup correctly'; } } elseif (stristr($zceMsg, 'syntax error') !== false) { if (stristr($zceMsg, 'application.ini') !== false) { echo 'There is a syntax error in ' . APPLICATION_PATH . '/config/application.ini ' . '<br/>Please check this file and make sure everything is setup correctly.'; } elseif (stristr($zceMsg, 'database.ini') !== false) { echo 'There is a syntax error in ' . APPLICATION_PATH . '/config/database.ini ' . '<br/>Please check this file and make sure everything is setup correctly.'; } else { echo 'A syntax error has been reached. <br/>Please check all configuration files and make sure ' . 'everything is setup correctly.'; } } else { // Then the exception message says nothing about parse_ini_file nor 'syntax error' echo 'Please check all configuration files, and ensure all settings are valid.'; } echo '<br/>For more information and help on installing OpenFISMA, please refer to the ' . '<a target="_blank" href="http://manual.openfisma.org/display/ADMIN/Installation">' . 'Installation Guide</a>'; } catch (Doctrine_Manager_Exception $dme) { echo '<h1>An exception occurred while bootstrapping the application.</h1>'; // Does database.ini have valid settings? Or is it the same content as database.ini.template? $databaseIniFail = false; $iniData = file(APPLICATION_PATH . '/config/database.ini'); $iniData = str_replace(chr(10), '', $iniData); if (in_array('db.adapter = ##DB_ADAPTER##', $iniData)) { $databaseIniFail = true; } if (in_array('db.host = ##DB_HOST##', $iniData)) { $databaseIniFail = true; } if (in_array('db.port = ##DB_PORT##', $iniData)) { $databaseIniFail = true; } if (in_array('db.username = ##DB_USER##', $iniData)) { $databaseIniFail = true; } if (in_array('db.password = ##DB_PASS##', $iniData)) { $databaseIniFail = true; } if (in_array('db.schema = ##DB_NAME##', $iniData)) { $databaseIniFail = true; } if ($databaseIniFail) { echo 'You have not applied the settings in ' . APPLICATION_PATH . '/config/database.ini appropriately. ' . 'Please review the contents of this file and try again.'; } else { if (Fisma::debug()) { echo '<p>' . get_class($dme) . '</p><p>' . $dme->getMessage() . '</p><p>' . "<p><pre>Stack Trace:\n" . $dme->getTraceAsString() . '</pre></p>'; } else { $logString = get_class($dme) . "\n" . $dme->getMessage() . "\nStack Trace:\n" . $dme->getTraceAsString() . "\n"; Zend_Registry::get('Zend_Log')->err($logString); } } } catch (Exception $exception) { // If a bootstrap exception occurs, that indicates a serious problem, such as a syntax error. // We won't be able to do anything except display an error. echo '<h1>An exception occurred while bootstrapping the application.</h1>'; if (Fisma::debug()) { echo '<p>' . get_class($exception) . '</p><p>' . $exception->getMessage() . '</p><p>' . "<p><pre>Stack Trace:\n" . $exception->getTraceAsString() . '</pre></p>'; } else { $logString = get_class($exception) . "\n" . $exception->getMessage() . "\nStack Trace:\n" . $exception->getTraceAsString() . "\n"; Zend_Registry::get('Zend_Log')->err($logString); } }

    Read the article

  • Entity Framework &amp; Transactions

    - by Sudheer Kumar
    There are many instances we might have to use transactions to maintain data consistency. With Entity Framework, it is a little different conceptually. Case 1 – Transaction b/w multiple SaveChanges(): here if you just use a transaction scope, then Entity Framework (EF) will use distributed transactions instead of local transactions. The reason is that, EF closes and opens the connection when ever required only, which means, it used 2 different connections for different SaveChanges() calls. To resolve this, use the following method. Here we are opening a connection explicitly so as not to span across multipel connections.   using (TransactionScope ts = new TransactionScope()) {     context.Connection.Open();     //Operation1 : context.SaveChanges();     //Operation2 :  context.SaveChanges()     //At the end close the connection     ts.Complete(); } catch (Exception ex) {       //Handle Exception } finally {       if (context.Connection.State == ConnectionState.Open)       {            context.Connection.Close();       } }   Case 2 – Transaction between DB & Non-DB operations: For example, assume that you have a table that keeps track of Emails to be sent. Here you want to update certain details like DataSent once if the mail was successfully sent by the e-mail client. Email eml = GetEmailToSend(); eml.DateSent = DateTime.Now; using (TransactionScope ts = new TransactionScope()) {    //Update DB    context.saveChanges();   //if update is successful, send the email using smtp client   smtpClient.Send();   //if send was successful, then commit   ts.Complete(); }   Here since you are dealing with a single context.SaveChanges(), you just need to use the TransactionScope, just before saving the context only.   Hope this was helpful!

    Read the article

  • Web workflow solution - how should I approach the design?

    - by Tom Pickles
    We've been tasked with creating a web based workflow tool to track change management. It has a single workflow with multiple synchronous tasks for the most part, but branch out at a point to tasks running in parallel which meet up later on. There will be all sorts of people using the application, and all of them will need to see their outstanding tasks for each change, but only theirs, not others. There will also be a high level group of people who oversee all changes, so need to see everything. They will need to see tasks which have not been done in the specified time, who's responsible etc. The data will be persisted to a SQL database. It'll all be put together using .Net. I've been trying to learn and implement OOP into my designs of late, but I'm wondering if this is moot in this instance as it may be better to have the business logic for this in stored procedures in the DB. I could use POCO's, a front end layer and a data access layer for the web application and just use it as a mechanism for CRUD actions on the DB, then use SP's fired in the DB to apply the business rules. On the other hand, I could use an object oriented design within the web app, but as the data in the app is state-less, is this a bad idea? I could try and model out the whole application into a class structure, implementing interfaces, base classes and all that good stuff. So I would create a change class, which contained a list of task classes/types, which defined each task, and implement an ITask interface etc. Put end-user types into the tasks to identify who should be doing what task. Then apply all the business logic in the respective class methods etc. What approach do you guys think I should be using for this solution?

    Read the article

< Previous Page | 262 263 264 265 266 267 268 269 270 271 272 273  | Next Page >