Search Results

Search found 2661 results on 107 pages for 'implict conversion'.

Page 28/107 | < Previous Page | 24 25 26 27 28 29 30 31 32 33 34 35  | Next Page >

  • How to convert a power point pdf to a pdf that is easy to read on kindle?

    - by SpaceTrucker
    I have several power point presentations as pdfs. I would like to read them on the original kindle in landscape format. When I read the original on the kindle then a single slide won't fit on the kindles display. I thought the easiest way to convert the pdf was to repring it with a pdf printer. However I don't know the paper size to use. I already tried using Calibre as suggested by this question. However the output is not usable because of formatting issues. So what paper size should I use for the pdf printer to reprint them in landscape format or are there any other tools I could use for that task?

    Read the article

  • Convert file from VOC to MP3

    - by Thomas
    I would like to convert a sound file (from a digital voice recorder) with the extension .voc to an .mp3 file or some other common sound files. I am on Windows 7 64 bit. I have tried the program voc2wav but it gives me an error message saying that the program isn't 64 bit. The program has to be free and able to run without installing. (The voice recorder did come with a program that I could install, but I would like to avoid that).

    Read the article

  • Importer or converter for ClarisWorks cwk format?

    - by Justin Dearing
    I have several ClarisWorks documents (*.CWK) that I'd like to import into a more modern format like Microsoft Word or Open Office. It seems Star Office can apparently open cwk files, but the product is discontinued and cannot be downloaded any more. There has been a feature request to add a cwk importer to OpenOffice since 2002, so I doubt that OpenOffice will support cwk files any time soon. Are there any utilities that can open a cwk file besides ClarisWorks itself?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • creating video from set of images on windows with java language [on hold]

    - by Atif
    I am stuck in making video from set of images, i am using ffmpeg tool on windows platform with java language, for single image it is converting into mp4 but for the set of images it gets failed, i have converted single % to double % with doube quotes but unsuccessful ffmpeg -r 1/5 -i "D:\novoworkspace\MGram\src\biz\novosol\mgram\main\img%%04d.jpg" -c:v libx264 -r 30 -pix_fmt yuv420p D:\novoworkspace\MGram\src\biz\novosol\mgram\main\video.mp4 Above is the exact command i tried from the command line as well from the java language with getRuntime() method. Environment is widows please suggest is it possibe under windows or I have to use some alternative Thanks Atif

    Read the article

  • How to run a command from anywhere in Mac OS X

    - by pabloruiz55
    I need to use a command for converting my images to pvrtc. It is located in /Developer/Platforms/iPhoneOS.platform/Developer/usr/bin/texturetool. Right now I have to be inside that folder to be able to use the command. How can I set it up so I can run this command from anywhere? Thanks

    Read the article

  • convert video to images

    - by Liam
    How can I convert a video file to a sequence of images, for example one frame every N seconds. Can mplayer or ffmpeg do this? I have used MPlayer to grab screenshots manually but I would like to automate this for a long video.

    Read the article

  • How to convert a 1 page PDF to a 2 page per sheet PDF?

    - by mokasin
    I would like to print a PDF so that on the front of the first page are the first two pages, on the back the 3rd and 4th and so on. ----------------- ----------------- | | | | | | | | | | | | | 1 | 2 | | 3 | 4 | . . . | | | | | | |_______|_______| |_______|_______| page 1 - front page 1 - front Because my printer using Linux fails to support manual duplex printing I'd thought, maybe I could edit the pdf in a according way. But how?

    Read the article

  • How can I reorder parts of a video file

    - by sandeep
    I have download a mkv movie file which gave me 3 files suffixed .001, .002, and .003. When i join them together with different tools like winrar, 7zip, hjsplit, concatenated file shows only last 40 min/1.22 hrs of the total length of the movie. If I play all the (.001, .002, .003) parts with vlc player, I can see that .003 is the first part of the video and .001 is the last part. Can anyone tell me how can join this parts of movie with correct position or how I can convert .003 file into .001 file.

    Read the article

  • Convert video from .mp4 to .ogg

    - by Unknown
    I am using ffmpeg version 0.11.1 Copyright (c) 2000-2012 the FFmpeg developers . I need to convert a file .mp4, to .ogg format. I am on Mac OS X, and I have tried this so far: ffmpeg -i sample_mpeg4.mp4 -acodec vorbis -vcodec libtheora -f ogg output.ogv I am getting: Unknown encoder 'libtheora' ffmpeg -i sample_mpeg4.mp4 -acodec libvorbis -vcodec --enable-libtheora output.ogv I am getting: Unknown encoder '--enable-libtheora' ffmpeg -i sample_mpeg4.mp4 -acodec libvorbis -vcodec libtheora -f ogv output.ogv I am getting: [NULL @ 0x7f81bb00f800] Requested output format 'ogv' is not a suitable output format output.ogv: Invalid argument ffmpegtheora is not an option as it can not be install on the server.

    Read the article

  • How to train users converting from PC to Mac/Apple at a small non profit?

    - by Everette Mills
    Background: I am part of a team that provides volunteer tech support to a local non profit. We are in the position to obtain a grant to update almost all of our computers (many of them 5 to 7 year old machines running XP), provide laptops for users that need them, etc. We are considering switching our users from PC (WinXP) to Macs. The technical aspects of switching will not be an issue for the team. We are in the process of planning data conversions, machine setup, server changes, etc regardless of whether we switch to Macs or much newer PCs. About 1/4 of the staff uses or has access to a Mac at home, these users already understand the basics of using the equipment. We have another set of (generally younger) users that are technically savvy and while slightly inconvenienced and slowed for a few days should be able to switch over quickly. Finally, several members of the staff are older and have many issues using there computers today. We think in the long run switching to Macs may provide a better user experience, fewer IT headaches, and more effective use of computers. The questions we have is what resources and training (webpages, Books, online training materials or online courses) do you recommend that we provide to users to enable the switchover to happen smoothly. Especially, with a focus on providing different levels of training and support to users with different skill levels. If you have done this in your own organization, what steps were successful, what areas were less successful?

    Read the article

  • Connecting Samsung Note 3 to Hitachi CPX3030WN via Samsung MHL 2.0 HD kit , Will there be video output? [on hold]

    - by Monolord's Knight
    I need the video output to projector. but nobody can assure me this may work or not. some says yes some says no.But they have no real experience. Some says an special android app is required for this. Depending on this answer, I will purchase Samsung MHL 2.0 cable . If it wont work it will be no use for me. I don't have a way to change my phone or projector. Just want to know will it work or not. Thanks

    Read the article

  • how can i edit my admission form which i filled wrong . their is no other form is avilable now ...what i do ??? [closed]

    - by user60065
    Hi, I am a 2nd year student in graduation. Recently I filled an admission form for final year admission but it came back to me after 2 days because I had entered wrong information. I want to edit the wrong information and I have scanned the form. I am looking for a good online site where I can upload the scanned document and convert same into an editable format. I don’t mind paying. If any can point to a good site will be great & thanks in advance

    Read the article

  • Convert Microsoft Visio Drawing (vsd) to PDF automatically

    - by nhinkle
    An open-source project I am working on uses Visio drawings for documentation, which are checked into source control. For those working on the project who don't own Visio, we have been converting the vsd files to PDFs so that they can still view them. It's not too difficult to save a copy as a PDF when making changes to the documentation, but we would like an automated way to do this conversion, so that we can set it up as a pre-checkin script in the SVN client. If anybody knows of a way to do this, either using something built-in to Visio, or with an outside script or command line tool, we would appreciate it. Edit: Thanks to the suggestion below, I have found the Visio Viewer 2010. This will be helpful for our contributors using Windows. We would still like to have the ability to create PDFs though, as there are readers available on every major operating system, and our contributors will not be using only Windows.

    Read the article

  • How do you make a Factory that can return derived types?

    - by Seth Spearman
    I have created a factory class called AlarmFactory as such... 1 class AlarmFactory 2 { 3 public static Alarm GetAlarm(AlarmTypes alarmType) //factory ensures that correct alarm is returned and right func pointer for trigger creator. 4 { 5 switch (alarmType) 6 { 7 case AlarmTypes.Heartbeat: 8 HeartbeatAlarm alarm = HeartbeatAlarm.GetAlarm(); 9 alarm.CreateTriggerFunction = QuartzAlarmScheduler.CreateMinutelyTrigger; 10 return alarm; 11 12 break; 13 default: 14 15 break; 16 } 17 } 18 } Heartbeat alarm is derived from Alarm. I am getting a compile error "cannot implicitly convert type...An explicit conversion exists (are you missing a cast?)". How do I set this up to return a derived type? Seth

    Read the article

  • [C#] How to convert string encoded in windows-1250 to unicode ?

    - by Deveti Putnik
    Hi! I am receiving from some dll (which is wrapper for some external data source) strings in Windows-1250 codepage and I would like to insert them correctly (as unicode) to table in SQL Server Database. Since particular row in database which should hold that data is of NVarchar type, I only needed to convert it in my C# code to unicode and pass it as parameter. Everything is well and nice, but I stumbled on conversion step. I tried the following but that doesn't work: private static String getUnicodeValue(string string2Encode) // { Encoding srcEncoding = Encoding.GetEncoding("Windows-1250"); UnicodeEncoding dstEncoding = new UnicodeEncoding(); byte[] srcBytes = srcEncoding.GetBytes(string2Encode); byte[] dstBytes = dstEncoding.GetBytes(string2Encode); return dstEncoding.GetString(dstBytes); } When I insert this returned string to table, I don't get correct letters like Ð, d, C, c, C or c. Please, help! :)

    Read the article

  • convert integer to a string in a given numeric base in python

    - by Mark Borgerding
    Python allows easy creation of an integer from a string of a given base via int(str,base). I want to perform the inverse: creation of a string from an integer. i.e. I want some function int2base(num,base) such that: int( int2base( X , BASE ) , BASE ) == X the function name/argument order is unimportant For any number X and base BASE that int() will accept. This is an easy function to write -- in fact easier than describing it in this question -- however, I feel like I must be missing something. I know about the functions bin,oct,hex; but I cannot use them for a few reasons: Those functions are not available on older versions of python with which I need compatibility (2.2) I want a general solution that can be called the same way for different bases I want to allow bases other than 2,8,16 Related Python elegant inverse function of int(string,base) Interger to base-x system using recursion in python Base 62 conversion in Python How to convert an integer to the shortest url-safe string in Python?

    Read the article

  • How to read and modify the colorspace of an image in c#

    - by Matthias
    I'm loading a Bitmap from a jpg file. If the image is not 24bit RGB, I'd like to convert it. The conversion should be fairly fast. The images I'm loading are up to huge (9000*9000 pixel with a compressed size of 40-50MB). How can this be done? Btw: I don't want to use any external libraries if possible. But if you know of an open source utility class performing the most common imaging tasks, I'd be happy to hear about it. Thanks in advance.

    Read the article

  • How can I get the Visual Studio 2010 converstion wizard to come back up?

    - by 2GDave
    When I first opened my website project with Visual Studio 2010 the conversion wizard came up and I said that I didn't want to convert the project. Now I'm ready to convert the project, but I can't find a shortcut or a way to get it back? I tried to remove the suo file, and that didn't do it. If I go into the project properties I can switch the target framework to 4.0, but that tells me it's going to close and reopen the project and I'll have to adjust the pages by hand - doesn't seem like very much fun. Anyone know how to get it to prompt again, or even a command line that would run it? Thank you!

    Read the article

  • strod() and sprintf() inconsistency under GCC and MSVC

    - by Dmitry Sapelnikov
    I'm working on a cross-platform app for Windows and Mac OS X, and I have a problem with two standard C library functions: strtod() (string-to-double conversion) ? sprintf (when used for outputting double-precision floating point numbers) -- their GCC and MSVC versions return different results. I'm looking for a well-tested cross-platform open-source implementation of those functions, or just for a pair of functions that would correctly and consistently convert double to string and back. I've already tried the clib GCC implementation, but the code is too long and too dependent on other source files, so I expect the adaptation to be difficult. What implementations of string-to-double and double-to-string functions would you recommend?

    Read the article

< Previous Page | 24 25 26 27 28 29 30 31 32 33 34 35  | Next Page >