Search Results

Search found 1145 results on 46 pages for 'pipe'.

Page 28/46 | < Previous Page | 24 25 26 27 28 29 30 31 32 33 34 35  | Next Page >

  • How to manage SOAP requests to a pool of VM each listening on a HTTP port with a priority value in these requests?

    - by sputnick
    I have a front SOAP web-server under Linux. It will have to communicate with Windows Servers VM listening each on a HTTP port, for a HTTP POST request. The chosen VM should return a report of the task to the SOAP client. In the SOAP requests, there's a special variable : the priority of the request (kind of SLA), and my question is coming right now : I think of using a ha software (nginx, HAProxy, HeartBeat...) that can manage priority in this point of view. Is it relevant or do you think I need to implement a queue by myself with some specific developments? Ex: I have a SOAP requests with low priority in the pipe : the weight priority for these VM should be decreased if I have high priority SOAP requests at the same time. Any clue will be really appreciated.

    Read the article

  • I/O redirection using cygwin and mingw

    - by KLee1
    I have written a program in C and have compiled it using MinGW. When I try to run that program in Cygwin, it seems to behave normally (i.e. prints correct output etc.) However, I'm trying to pipe output to a program so that I can parse information from the program's output. However, the piping does not seem to be working in that I am not getting any input into the second program. I have confirmed this by using the following commands: This command seems to work fine: ./prog Performing this command returns nothing: ./prog | cat This command verifies the first: ./prog | wc Which returns: 0 0 0 I know that the script (including the piping from the program) works perfectly fine in an all Linux environment. Does anyone have any idea for why the piping isn't working in Cygwin? Thanks!

    Read the article

  • Failing SSHFS connection drags down the system

    - by skerit
    From time to time my sshfs mount fails. All programs using the mount freeze when it happens. I can't even ls anything or use nautilus. Is there a way to find out what's the cause and how to handle it? I've noticed regular SSH sessions to the server get their fair share of Write failed: broken pipe disconnects, too. If I wait long enough (and I'm talking about 20-ish minutes, here) it will auto reconnect and things start working again.

    Read the article

  • How to avoid Remove-Item PowerShell errors "process cannot access the file"?

    - by Michael Freidgeim
    We are using TfsDeployer and PowerShell script to remove the folders ising Remove-Item before deployment of a new version. Sometimes the PS script failed with the error Remove-Item : Cannot remove item Services\bin: The process cannot access the file Services\bin' because it is being used by another proc Get-ChildItem -Path $Destination -Recurse | Remove-Item <<<< -force -recurse + CategoryInfo : WriteError: (C:\Program File..\Services\bin:DirectoryInfo) [Remove-Item], IOException FullyQualifiedErrorId : RemoveFileSystemItemIOError,Microsoft.PowerShell.Commands.RemoveItemCommand I’ve tried to follow the answer from PowerShell remove force to pipe get-childitem -recurse into remove-item. get-childitem * -include *.csv -recurse | remove-item ,but the error still happens periodically. We are using unlocker to manually kill locking application, (it’s usually w3wp), but I prefer to find automated solution. Another (not ideal) option is to-suppress-powershell-errors get-childitem -recurse -force -erroraction silentlycontinue Any suggestions are welcome.

    Read the article

  • Under *nix, how can I find a string within a file within a directory ?

    - by roberto
    Hi all. I'm using ubuntu linux, and I use bash from with a terminal emulator every day for many tasks. I would like to know how to find a string or a substring within a file that is within a particular directory. If I was knew the file which contained my target substring, I would just cat the file and pipe it through grep, thus: cat file | grep mysubstring But in this case, the pesky substring could be anywhere within a known directory. How do I hunt down my substring ?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • What does this error mean (Can't create TCP/IP socket (24))?

    - by user105196
    I have web server with OS RHEL 6.2 and Mysql 5.5.23 on another server and the web server can read from Mysql server without problem, but some time I got this error: [Sun Sep 23 06:13:07 2012] [error] [client XXXXX] DBI connect('XXXX:192.168.1.2:3306','XXX',...) failed: Can't create TCP/IP socket (24) at /var/www/html/file.pm line 199. my question : What does this error mean (Can't create TCP/IP socket (24))? is it OS error or Mysql error ? perl -v This is perl, v5.10.1 (*) built for x86_64-linux-thread-multi mysql -V mysql Ver 14.14 Distrib 5.5.23, for Linux (x86_64) using readline 5.1 su - mysql -s /bin/bash -c 'ulimit -a' core file size (blocks, -c) 0 data seg size (kbytes, -d) unlimited scheduling priority (-e) 0 file size (blocks, -f) unlimited pending signals (-i) 127220 max locked memory (kbytes, -l) 64 max memory size (kbytes, -m) unlimited open files (-n) 1024 pipe size (512 bytes, -p) 8 POSIX message queues (bytes, -q) 819200 real-time priority (-r) 0 stack size (kbytes, -s) 10240 cpu time (seconds, -t) unlimited max user processes (-u) 1024 virtual memory (kbytes, -v) unlimited file locks (-x) unlimited

    Read the article

  • No COM1 port on hyper-v

    - by MPX
    I just made a fresh Windows 8.1 install and am trying to set-up a VM for kernel debugging. Therefore, I need to create a serial link to debug the VM using windbg. Usually I just simply add a new COM port and use it as a named pipe. However, I can't find any way to add this hardware. There is nothing relevant on the "add hardware list". What do I need to install this port then? Thanks in advance!

    Read the article

  • Problem accessing MICROSOFT##SSEE database (Error: 18456, Severity: 14, State: 16.)

    - by Philipp Schmid
    After an unexpected server shutdown due to a power failure, I can no longer connect to the internal windows database MICROSOFT##SSEE which is hosting Central Admin for my SBS 2008 server. The log shows: Error: 18456, Severity: 14, State: 16. Login failed for user 'NT AUTHORITY\NETWORK SERVICE'. [CLIENT: <named pipe>] I've tried to connect using the SQL Management studio (connecting to .pipemssql$microsoft##sseesqlquery) but no luck. The SQL Server Configuration Manager doesn't show a entry for 'Protocols for MICROSOFT##SSEE' (but shows it for 2 other database hosted on the same SQL server 2005 Express edition. I have tried to restore the master.ldf and mastlog.log files from a backup, but the issue persists.

    Read the article

  • Searching Multiple Terms

    - by nevets1219
    I know that grep -E 'termA|termB' files allows me to search multiple files for termA OR termB. What I would like to do instead is search for termA AND termB. They do not have to be on the same line as long as the two terms exists within the same file. Essentially a "search within result" feature. I know I can pipe the results of one grep into another but that seems slow when going over many files. grep -l "termA" * | xargs grep -l "termB" | xargs grep -E -H -n --color "termA|termB" Hopefully the above isn't the only way to do this. It would be extra nice if this could work on Windows (have cygwin) and Linux. I don't mind installing a tool to perform this task.

    Read the article

  • How to determine if my router is causing a bottleneck in uploads?

    - by Jimi
    I have a home network with a cheap-o little router with a development server and a few devices hooked up to it. I am finding that backups of my server are taking FOREVER (a week for 60gb) running backups renders my internet connection useless from any other box int he house. I have maxed out the pipe to my house from the ISP (10down, 3up), but is there a way for me to test and see if my router is bottlenecking anything? I feel like 60gb backups shouldn't take this long so any help would be great!

    Read the article

  • Is there a way for me to test my [closed]

    - by Jimi
    I have a home network with a cheap-o little router with a development server and a few devices hooked up to it. I am finding that backups of my server are taking FOREVER (a week for 60gb) running backups renders my internet connection useless from any other box int he house. I have maxed out the pipe to my house from the ISP (10down, 3up), but is there a way for me to test and see if my router is bottlenecking anything? I feel like 60gb backups shouldn't take this long so any help would be great!

    Read the article

  • Delphi Speech recognition delphi

    - by XBasic3000
    I need create a programatic equivalent using delphi language... or could someone post a link on how to do grammars in peech recogniton using the delphi. sorry for my english... XML Grammar Sample(s): <GRAMMAR> <!-- Create a simple "hello world" rule --> <RULE NAME="HelloWorld" TOPLEVEL="ACTIVE"> <P>hello world</P> </RULE> <!-- Create a more advanced "hello world" rule that changes the display form. When the user says "hello world" the display text will be "Hiya there!" --> <RULE NAME="HelloWorld_Disp" TOPLEVEL="ACTIVE"> <P DISP="Hiya there!">hello world</P> </RULE> <!-- Create a rule that changes the pronunciation and the display form of the phrase. When the user says "eh" the display text will be "I don't understand?". Note the user didn't say "huh". The pronunciation for "what" is specific to this phrase tag and is not changed for the user or application lexicon, or even other instances of "what" in the grammar --> <RULE NAME="Question_Pron" TOPLEVEL="ACTIVE"> <P DISP="I don't understand" PRON="eh">what</P> </RULE> <!-- Create a rule demonstrating repetition --> <!-- the rule will only be recognized if the user says "hey diddle diddle" --> <RULE NAME="NurseryRhyme" TOPLEVEL="ACTIVE"> <P>hey</P> <P MIN="2" MAX="2">diddle</P> </RULE> <!-- Create a list with variable phrase weights --> <!-- If the user says similar phrases, the recognizer will use the weights to pick a match --> <RULE NAME="UseWeights" TOPLEVEL="ACTIVE"> <LIST> <!-- Note the higher likelihood that the user is expected to say "recognizer speech" --> <P WEIGHT=".95">recognize speech</P> <P WEIGHT=".05">wreck a nice beach</P> </LIST> </RULE> <!-- Create a phrase with an attached semantic property --> <!-- Speaking "one two three" will return three different unique semantic properties, with different names, and different values --> <RULE NAME="UseProps" TOPLEVEL="ACTIVE"> <!-- named property, without value --> <P PROPNAME="NOVALUE">one</P> <!-- named property, with numeric value --> <P PROPNAME="NUMBER" VAL="2">two</P> <!-- named property, with string value --> <P PROPNAME="STRING" VALSTR="three">three</P> </RULE> </GRAMMAR> **Programmatic Equivalent:** To add a phrase to a rule, SAPI provides an API called ISpGrammarBuilder::AddWordTransition. The application developer can add the sentences as follows: SPSTATEHANDLE hsHelloWorld; // Create new top-level rule called "HelloWorld" hr = cpRecoGrammar->GetRule(L"HelloWorld", NULL, SPRAF_TopLevel | SPRAF_Active, TRUE, &hsHelloWorld); // Check hr // Add the command words "hello world" // Note that the lexical delimiter is " ", a space character. // By using a space delimiter, the entire phrase can be added // in one method call hr = cpRecoGrammar->AddWordTransition(hsHelloWorld, NULL, L"hello world", L" ", SPWT_LEXICAL, NULL, NULL); // Check hr // Add the command words "hiya there" // Note that the lexical delimiter is "|", a pipe character. // By using a pipe delimiter, the entire phrase can be added // in one method call hr = cpRecoGrammar->AddWordTransition(hsHelloWorld, NULL, L"hiya|there", L"|", SPWT_LEXICAL, NULL, NULL); // Check hr // save/commit changes hr = cpRecoGrammar->Commit(NULL); // Check hr

    Read the article

  • Supporting Piping (A Useful Hello World)

    - by blastthisinferno
    I am trying to write a collection of simple C++ programs that follow the basic Unix philosophy by: Make each program do one thing well. Expect the output of every program to become the input to another, as yet unknown, program. I'm having an issue trying to get the output of one to be the input of the other, and getting the output of one be the input of a separate instance of itself. Very briefly, I have a program add which takes arguments and spits out the summation. I want to be able to pipe the output to another add instance. ./add 1 2 | ./add 3 4 That should yield 6 but currently yields 10. I've encountered two problems: The cin waits for user input from the console. I don't want this, and haven't been able to find a simple example showing a the use of standard input stream without querying the user in the console. If someone knows of an example please let me know. I can't figure out how to use standard input while supporting piping. Currently, it appears it does not work. If I issue the command ./add 1 2 | ./add 3 4 it results in 7. The relevant code is below: add.cpp snippet // ... COMMAND LINE PROCESSING ... std::vector<double> numbers = multi.getValue(); // using TCLAP for command line parsing if (numbers.size() > 0) { double sum = numbers[0]; double arg; for (int i=1; i < numbers.size(); i++) { arg = numbers[i]; sum += arg; } std::cout << sum << std::endl; } else { double input; // right now this is test code while I try and get standard input streaming working as expected while (std::cin) { std::cin >> input; std::cout << input << std::endl; } } // ... MORE IRRELEVANT CODE ... So, I guess my question(s) is does anyone see what is incorrect with this code in order to support piping standard input? Are there some well known (or hidden) resources that explain clearly how to implement an example application supporting the basic Unix philosophy? @Chris Lutz I've changed the code to what's below. The problem where cin still waits for user input on the console, and doesn't just take from the standard input passed from the pipe. Am I missing something trivial for handling this? I haven't tried Greg Hewgill's answer yet, but don't see how that would help since the issue is still with cin. // ... COMMAND LINE PROCESSING ... std::vector<double> numbers = multi.getValue(); // using TCLAP for command line parsing double sum = numbers[0]; double arg; for (int i=1; i < numbers.size(); i++) { arg = numbers[i]; sum += arg; } // right now this is test code while I try and get standard input streaming working as expected while (std::cin) { std::cin >> arg; std::cout << arg << std::endl; } std::cout << sum << std::endl; // ... MORE IRRELEVANT CODE ...

    Read the article

  • No-Weld Multi-Monitor Stand Crafted From Sturdy Metal Framing

    - by Jason Fitzpatrick
    As far as DIY stands for multiple monitors go, this design has to be the sturdiest and least difficult to construct model we’ve seen in some time. Read on to see how one DIYer cleverly crafted a solid metal triple monitor stand with no welding involved. Tinker and gamer Opteced wanted a new stand for his Eyefinity setup but wasn’t in a hurry to spend a pile of cash on a custom stand. His DIY solution is just as sturdy as a commercial metal stand but is made out of inexpensive hardware store parts–the main supports and base are made from Unistrut, a simple metal framing material. Unlike many DIY stands made from metal rods and piping, this build doesn’t require any sort of welding or custom pipe threading. In fact, the metal struts are so over engineered for the task of holding up flat-panel monitors he was able to simply partially saw through them and bend them to the shape he wanted. Hit up the link below for additional pictures of the build. Unistrut Monitor Stand [via Hack A Day] 8 Deadly Commands You Should Never Run on Linux 14 Special Google Searches That Show Instant Answers How To Create a Customized Windows 7 Installation Disc With Integrated Updates

    Read the article

  • Errors Code: /var/cache/apt/archives/linux-image-3.8.0-19-generic_3.8.0-19.30~precise1_amd64.deb

    - by user286682
    $ sudo apt-get dist-upgrade Reading package lists... Done Building dependency tree Reading state information... Done Calculating upgrade... Done The following packages will be upgraded: linux-image-3.8.0-19-generic 1 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 6 not fully installed or removed. Need to get 0 B/47.8 MB of archives. After this operation, 142 MB of additional disk space will be used. Do you want to continue [Y/n]? y (Reading database ... 164064 files and directories currently installed.) Preparing to replace linux-image-3.8.0-19-generic 3.8.0-19.29 (using .../linux-image-3.8.0-19-generic_3.8.0-19.30~precise1_amd64.deb) ... Done. Unpacking replacement linux-image-3.8.0-19-generic ... dpkg: error processing /var/cache/apt/archives/linux-image-3.8.0-19-generic_3.8.0-19.30~precise1_amd64.deb (--unpack): trying to overwrite '/lib/modules/3.8.0-19-generic/kernel/arch/x86/kvm/kvm-intel.ko', which is also in package linux-image-extra-3.8.0-19-generic 3.8.0-19.29 dpkg-deb: error: subprocess paste was killed by signal (Broken pipe) Examining /etc/kernel/postrm.d . run-parts: executing /etc/kernel/postrm.d/initramfs-tools 3.8.0-19-generic /boot/vmlinuz-3.8.0-19-generic run-parts: executing /etc/kernel/postrm.d/zz-update-grub 3.8.0-19-generic /boot/vmlinuz-3.8.0-19-generic Errors were encountered while processing: /var/cache/apt/archives/linux-image-3.8.0-19-generic_3.8.0-19.30~precise1_amd64.deb E: Sub-process /usr/bin/dpkg returned an error code (1) How can I get this update to work?

    Read the article

  • unmet dependencies and broken count>0 problem

    - by Simon
    I tried installing fbreader, following all the steps, but ended up with unmet dependencies, i also think a file is referenced in two locations at once and hence killing it.. any ideas how I can fix it? i've done alot of research and tried: simon@simon-Studio-1558:~$ sudo apt-get -f install Reading package lists... Done Building dependency tree Reading state information... Done Correcting dependencies... Done The following packages were automatically installed and are no longer required: dkms patch Use 'apt-get autoremove' to remove them. The following extra packages will be installed: libzlcore0.12 The following NEW packages will be installed: libzlcore0.12 0 upgraded, 1 newly installed, 0 to remove and 61 not upgraded. 6 not fully installed or removed. Need to get 0 B/270 kB of archives. After this operation, 811 kB of additional disk space will be used. Do you want to continue [Y/n]? y (Reading database ... 179860 files and directories currently installed.) Unpacking libzlcore0.12 (from .../libzlcore0.12_0.12.10dfsg-4_i386.deb) ... dpkg: error processing /var/cache/apt/archives/libzlcore0.12_0.12.10dfsg-4_i386.deb (--unpack): trying to overwrite '/usr/lib/libzlcore.so.0.12.10', which is also in package libzlcore 0.12.10-1 No apport report written because MaxReports is reached already dpkg-deb: error: subprocess paste was killed by signal (Broken pipe) Errors were encountered while processing: /var/cache/apt/archives/libzlcore0.12_0.12.10dfsg-4_i386.deb E: Sub-process /usr/bin/dpkg returned an error code (1) sorry for the formatting, but it basically isn't liking: dpkg: error processing /var/cache/apt/archives/libzlcore0.12_0.12.10dfsg-4_i386.deb (--unpack): trying to overwrite '/usr/lib/libzlcore.so.0.12.10', which is also in package libzlcore 0.12.10-1 Any ideas? Also I don't care about keeping the program, but the error is stopping sudo apt-get remove fbreader from working too.

    Read the article

  • GPLv2 - Multiple AI chess engines to bypass GPL

    - by Dogbert
    I have gone through a number of GPL-related questions, the most recent being this one: http://stackoverflow.com/questions/3248823/legal-question-about-the-gpl-license-net-dlls/3249001#3249001 I'm trying to see how this would work, so bear with me. I have a simple GUI interface for a game of Chess. It essentially can send/receive commands to/from an external chess engine (ie: Tong, Fruit, etc). The application/GUI is similar in nature to XBoard ( http://www.gnu.org/software/xboard/ ), but was independently designed. After going through a number of threads on this topic, it seems that the FSF considers dynamically linking against a GPLv2 library as a derivative work, and that by doing so, the GPLv2 extends to my proprietary code, and I must release the source to my entire project. Other legal precedents indicate the opposite, and that dynamic linking doesn't cause the "viral" effect of the GPL to propagate to my proprietary code. Since there is no official consensus that can give a "hard-and-fast" answer to the dynamic linking question, would this be an acceptable alternative: I build my chess GUI so that it sends/receives the chess engine AI logic as text commands from an external interface library that I write The interface library I wrote itself is then released under the GPL The interface library is only used to communicate via a generic text pipe to external command-line chess engines The chess engine itself would be built as a command-line utility rather than as a library of any sort, and just sends strings in the Universal Chess Interface of Chess Engine Communication Protocol ( http://en.wikipedia.org/wiki/Chess_Engine_Communication_Protocol ) format. The one "gotcha" is that the interface library should not be specific to one single GPL'ed chess engine, otherwise the entire GUI would be "entirely dependent" on it. So, I just make my interface library so that it is able to connect to any command-line chess engine that uses a specific format, rather than just one unique engine. I could then include pre-built command-line-app versions of any of the chess engines I'm using. Would that sort of approach allow me to do the following: NOT release the source for my UI Release the source of the interface library I built (if necessary) Use one or more chess engines and bundle them as external command-line utilities that ship with a binary version of my UI Thank you.

    Read the article

  • Sesame OData Browser updated

    - by Fabrice Marguerie
    Since the first preview of Sesame was published, I've been working on improving it with new features.Today, I've published an update that provides the following: Support for hyperlinks (URLs and email addresses) Improved support for the OData format. More OData producers are supported, including Netflix and vanGuide, for example. Fixed display of images (images used to appear mixed up) Support for image URLs Image zoom (try to hover over pictures in Netflix' Titles or MIX10's Speakers) Support for complex types (test this with Netflix' Titles and the OData Test Service's Suppliers) Partial open types support Partial feed customization support (Products.Name and Products.Description are now displayed for http://services.odata.org/OData/OData.svc for example) Partial HTML support Query number is now unique by connection and not globally Support for query continuation (paging) - See the "Load more" button Partial support for <FunctionImport> (see Movies, Series, Seasons, Discs and Episodes with Netflix) Version number is now displayed More links to examples (coming from http://www.odata.org/producers) provided in the connection dialog You can try all this at the same place as before. Choose Netflix in the connection dialog to see most of the new features in action and to get a richer experience. There is a lot more in the pipe. Enough to keep me busy for a few more weeks :-)

    Read the article

  • Can Ubuntu-One be installed on Ubuntu 10.04?

    - by crivello
    I have installed ubuntu-one by the several ways on a 10.04-TLS, it appears on my System Preference Ubuntu One. however, Clicking one it , nothing happens. On a terminal, the command : ~$ ubuntuone-launch doe not working too, and the following command ~$ ubuntuone-preferences leads to an error message, given below, that made me crazy. Does somebody has an idea one a solution to solve that ? Many thanks. \jcc Traceback (most recent call last): File "/usr/bin/ubuntuone-preferences", line 63, in <module> from desktopcouch.replication_services import ubuntuone as dcouch File "/usr/lib/python2.6/dist-packages/desktopcouch/__init__.py", line 20, in <module> from desktopcouch.start_local_couchdb import process_is_couchdb, read_pidfile File "/usr/lib/python2.6/dist-packages/desktopcouch/start_local_couchdb.py", line 38, in <module> from desktopcouch import local_files File "/usr/lib/python2.6/dist-packages/desktopcouch/local_files.py", line 300, in <module> xdg_base_dirs.save_config_path("desktop-couch")) File "/usr/lib/python2.6/dist-packages/desktopcouch/local_files.py", line 235, in __init__ self.couch_exec_command = [COUCH_EXE, self.couch_chain_ini_files(), File "/usr/lib/python2.6/dist-packages/desktopcouch/local_files.py", line 274, in couch_chain_ini_files stdout=subprocess.PIPE) File "/usr/lib/python2.6/subprocess.py", line 633, in __init__errread, errwrite) File "/usr/lib/python2.6/subprocess.py", line 1139, in _execute_child raise child_exception OSError: [Errno 13] Permission denied

    Read the article

  • Shockwave Flash crashes with Chromium and Firefox

    - by Stephan
    Since updating to Ubuntu 13.10, Shockwave Flash does not work in Chromium or Firefox. Both show a "Shockwave Flash has crashed" dialog. Chromium 29.0.1547.65 After loading a page with a Flash video, I get this warning on the console twice: NVIDIA: could not open the device file /dev/nvidia0 (Operation not permitted). When I try to play the video, it crashes and I receive these disorted error messages: (exe:14868): Gdk-WARNING **: XID collision, trouble ahead [xcb] Extra reply data still left in queue [xcb] This is most likely caused by a broken X extension library [xcb] Aborting, sorry about that. owser --type=plugin --plugin-path=/usr/lib/flashplugin-installer/libflashplayer.so --lang=de --channel=14560.18.20766867: ../../src/xcb_io.c:576: _XReply: Assertion `!xcb_xlib_extra_reply_data_left' failed. Firefox 25.0 With Firefox, I get these errors: ###!!! ABORT: Request 154.24: BadValue (integer parameter out of range for operation); 3 requests ago: file /build/buildd/firefox-25.0+build3/toolkit/xre/nsX11ErrorHandler.cpp, line 157 WARNING: pipe error (110): Connection reset by peer: file /build/buildd/firefox-25.0+build3/ipc/chromium/src/chrome/common/ipc_channel_posix.cc, line 437 ###!!! [Parent][RPCChannel] Error: Channel error: cannot send/recv What I tried so far Reinstalling flashplugin-installer Changing permissions of /dev/nvidia0 It seems that Flash Aid is no longer available. GPU acceleration is working fine, e.g. for Portal. Does anyone know how to fix this?

    Read the article

  • Per-vertex animation with VBOs: VBO per character or VBO per animation?

    - by charstar
    Goal To leverage the richness of well vetted animation tools such as Blender to do the heavy lifting for a small but rich set of animations. I am aware of additive pose blending like that from Naughty Dog and similar techniques but I would prefer to expend a little RAM/VRAM to avoid implementing a thesis-ready pose solver. I would also like to avoid implementing a key-frame + interpolation curve solver (reinventing Blender vertex groups and IPOs), if possible. Scenario Meshes are animated using either skeletons (skinned animation) or some form of morph targets (i.e. per-vertex key frames). However, in either case, the animations are known in full at load-time, that is, there is no physics, IK solving, or any other form of in-game pose solving. The number of character actions (animations) will be limited but rich (hand-animated). There may be multiple characters using a each mesh and its animations simultaneously in-game (they will likely be at different frames of the same animation at the same time). Assume color and texture coordinate buffers are static. Current Considerations Much like a non-shader-powered pose solver, create a VBO for each character and copy vertex and normal data to each VBO on each frame (VBO in STREAMING). Create one VBO for each animation where each frame (interleaved vertex and normal data) is concatenated onto the VBO. Then each character simply has a buffer pointer offset based on its current animation frame (e.g. pointer offset = (numVertices+numNormals)*frameNumber). (VBO in STATIC) Known Trade-Offs In 1 above: Each VBO would be small but there would be many VBOs and therefore lots of buffer binding and vertex copying each frame. Both client and pipeline intensive. In 2 above: There would be few VBOs therefore insignificant buffer binding and no vertex data getting jammed down the pipe each frame, but each VBO would be quite large. Are there any pitfalls to number 2 (aside from finite memory)? I've found a lot of information on what you can do, but no real best practices. Are there other considerations or methods that I am missing?

    Read the article

  • Can I override fonts installed by ttf-mscorefonts-installer, prefer Liberation fonts?

    - by conner_bw
    I had to apt-get install ttf-mscorefonts-installer on Ubuntu 12.04/12.10. The short version is I need to pipe PDF files out of an application that requires these fonts for certain glyphs. The problem, after running this command, is that the fonts in my web browser (and some java apps) are now "ugly." Obviously this is a subjective opinion but it is the one I hold. I want the old fonts back for most cases (Liberation, DejaVu, Ubuntu, ...). I'm not sure how best to describe this but here's an example: Example CSS in Webbrowser font-family: Verdana,Arial,sans-serif; Without ttf-mscorefonts-installer (Case 1): $ fc-match Verdana LiberationSans-Regular.ttf: "Liberation Sans" "Regular" $ fc-match Arial LiberationSans-Regular.ttf: "Liberation Sans" "Regular" $ fc-match sans-serif LiberationSans-Regular.ttf: "Liberation Sans" "Regular"` With ttf-mscorefonts-installer (Case 2): $ fc-match Verdana Verdana.ttf: "Verdana" "Normal" $ fc-match Arial Arial.ttf: "Arial" "Normal" $ fc-match sans-serif LiberationSans-Regular.ttf: "Liberation Sans" "Regular"` I want (Case 1). Optionally, I want the fonts in (Case 2) not to look "ugly" IE. they are more jagged, less smooth than their free alternatives in my web browsers. Is this possible?

    Read the article

  • Cannot install extensions required for GNOME Shell themes

    - by Soham Chowdhury
    I keep getting this output: soham@fortress:~$ sudo apt-get install gnome-shell-extensions gnome-tweak-tool Reading package lists... Done Building dependency tree Reading state information... Done gnome-tweak-tool is already the newest version. The following NEW packages will be installed: gnome-shell-extensions 0 upgraded, 1 newly installed, 0 to remove and 43 not upgraded. 1 not fully installed or removed. Need to get 0 B/121 kB of archives. After this operation, 849 kB of additional disk space will be used. Do you want to continue [Y/n]? y (Reading database ... 179291 files and directories currently installed.) Unpacking gnome-shell-extensions (from .../gnome-shell-extensions_3.4.1~git20120508.dfd7191a-0ubuntu1~12.04~ricotz0_all.deb) ... dpkg: error processing /var/cache/apt/archives/gnome-shell-extensions_3.4.1~git20120508.dfd7191a-0ubuntu1~12.04~ricotz0_all.deb (--unpack): trying to overwrite '/usr/share/locale/lv/LC_MESSAGES/gnome-shell-extensions.mo', which is also in package gnome-shell-extensions-common 3.2.0-0ubuntu1~oneiric1 No apport report written because MaxReports is reached already dpkg-deb: error: subprocess paste was killed by signal (Broken pipe) Errors were encountered while processing: /var/cache/apt/archives/gnome-shell-extensions_3.4.1~git20120508.dfd7191a-0ubuntu1~12.04~ricotz0_all.deb E: Sub-process /usr/bin/dpkg returned an error code (1) Update: Fixed that. Now GNOME Tweak Tool shows me an exclamation mark beside the extension enable button, saying "Extension doesn't support shell version". My GNOME shell is already the latest version. Help!

    Read the article

  • Xubuntu 12.04 : Random boot to black screen

    - by Thibaud Ruelle
    My xubuntu 12.04 has worked flawlessly since install in September. However, lately I randomly have the following boot issue : The computer boots to grub, and after choosing xubuntu either boots normally or boots to a black screen. Here are some observations I have made : The black screen seems to happen randomly. The black screen does not seem to happen in safe mode (- nomodeset in grub). The black screen does not allow me to ctrl + alt + F1-6 into a terminal. The black screen allows me to use SysRq keys (Alt + SysRq + K does not work though). The black screen often happens on first boot in several hours and the computer usually boots normally after a RSEINUB. When the computer boots I get "SP5100 TCO timer: mmio address 0xfec000f0 already in use" at startup and "Could not write bytes: broken pipe" at shutdown. However research on these errors did not yield answers to my particular issue. Comparing Xorg.0.log (successful boot) and Xorg.0.log.old (black screen), and reading the answers to similar problem, it seems that I might have a X driver issue. However the system worked flawlessly since lately. Additional info on my system : ACER AO722 C62kk Operating system : 3.2.0-31-generic ubuntu Edit : I made a fresh install of Xubuntu 12.04 x64, the issue is still there ... (I have a separate /home so config. files were not erased). Edit 2 : I followed troubleshooting blank screen, so my new observations are without quiet and splash in grub : When the system boots normally, the screen goes black after grub then lights up and displays text information then goes to login screen. (After that the desktop starting time vary substantially, which is new and may be a separate issue ?). When the boot fails, after grub the screen goes black, lights up, goes black, lights up again and most times goes black again. At this point it responds to Alt+SysReq K by lighting up but no more, and has to be rebooted through Alt+SysReq+ RSEINUB. Thank you for your time and attention in advance ! Thibaud Ruelle

    Read the article

< Previous Page | 24 25 26 27 28 29 30 31 32 33 34 35  | Next Page >