Search Results

Search found 37285 results on 1492 pages for 'text rendering'.

Page 28/1492 | < Previous Page | 24 25 26 27 28 29 30 31 32 33 34 35  | Next Page >

  • How to convert Xml files to Text Files 2

    - by John
    Hi all, I have around 8000 xml files that needs to be converted into text files. The text file must contain title, description and keywords of the xml file without the tags and removing other elements and attributes as well. In other words, i need to create 8000 text files containing the title,description and keywords of the xml file. I need codings for this to be done systematically. Any help would be greatly appreciated. Thanks in advance. Hey all thank you all so so much with your replies. Here's a sample of what my xml looks like: <?xml version="1.0"?> <metadata> <identifier>43productionsNightatthegraveyard</identifier> <title>Night at the graveyard</title> <collection>opensource_movies</collection> <mediatype>movies</mediatype> <resource>movies</resource> <upload_application appid="ccPublisher" version="2.2.1"/> <uploader>[email protected]</uploader> <description>una noche en el cementerio (terror)</description> <license>http://creativecommons.org/licenses/by-nc/3.0/</license> <title>Night at the graveyard</title> <format>Video</format> <adder>[email protected]</adder> <licenseurl>http://creativecommons.org/licenses/by-nc/3.0/</licenseurl> <year>2007</year> <keywords>Night,at,the,graveyard,43,productions</keywords> <holder>43 productions</holder> <publicdate>2007-04-11 19:52:28</publicdate> </metadata> And this would be the output: una noche en el cementerio (terror) Night at the graveyard Night,at,the,graveyard,43,productions This need to be saved with the same name but in text format. Thanks all so much if any more suggestions would be much appreciated.

    Read the article

  • Modifying text files and executing programs with command line parameters in c# or c++ on Linux

    - by Robert Harvey
    I have a need to create a utility in Suze Linux. The utility will make modifications to some text files, and then use the information in those text files to program a device in the computer using a different executable which accepts command line parameters. I am fluent in c#, but have never worked with Linux. Should I take the time to learn Gnu C++ to do this, or install Mono? How would I execute the programming utility and pass it command line parameters?

    Read the article

  • Generating text file from database

    - by Goldmember
    I have a requirement to hand-code an text file from data residing in a SQL table. Just wondering if there are any best practices here. Should I write it as an XMLDocument first and transform using XSL or just use Streamwriter and skip transformation altogether? The generated text file will be in EDIFACT format, so layout is very specific.

    Read the article

  • Reading a Text file in xcode

    - by Nicolaj Zefting
    First off, I'm a complete beginner. This might be a stupid question, but here it goes: I'm currently working on an App than contains Latin texts that the users can view and read. I'm using Xcode 4 with the storybord function. Theway the app is built: user selects author - then the book - then app shows the text. I am kind of confused because i need to have various text files, depending on the users choice.

    Read the article

  • Writing text file on local server MVC 2.0

    - by Liado
    Hi, i'm trying to write a text file on remote server, i'm using the following code: [AcceptVerbs(HttpVerbs.Post)] public ActionResult Index(UserModels model) { if (!ModelState.IsValid) { return View("Index"); } try { using (StreamWriter w = new StreamWriter(Server.MapPath(TEXT_FILE_NAME), true)) { w.WriteLine(model.Email.ToString()); // Write the text } } catch { } the folder is still empty, can someone help? what should be the problem? Thanks

    Read the article

  • Text extra aliased(jagged) in IE - looks terrible - but OK in FF and Chrome

    - by jon
    I am building a website - http://www.efficaxdevelopment.com As you can see when you load the page(in IE) the text on the page that isn't an image or the menu looks terrible, while in FF and Chrome the text looks fine. you can view the source on the page and the css is here http://www.efficaxdevelopment.com/styles/mainstyle.css Also, the sliding bar over the menu appears a few pixels left of where it appears in FF and IE. Any ideas?

    Read the article

  • Rendering ASP.NET MVC Razor Views outside of MVC revisited

    - by Rick Strahl
    Last year I posted a detailed article on how to render Razor Views to string both inside of ASP.NET MVC and outside of it. In that article I showed several different approaches to capture the rendering output. The first and easiest is to use an existing MVC Controller Context to render a view by simply passing the controller context which is fairly trivial and I demonstrated a simple ViewRenderer class that simplified the process down to a couple lines of code. However, if no Controller Context is available the process is not quite as straight forward and I referenced an old, much more complex example that uses my RazorHosting library, which is a custom self-contained implementation of the Razor templating engine that can be hosted completely outside of ASP.NET. While it works inside of ASP.NET, it’s an awkward solution when running inside of ASP.NET, because it requires a bit of setup to run efficiently.Well, it turns out that I missed something in the original article, namely that it is possible to create a ControllerContext, if you have a controller instance, even if MVC didn’t create that instance. Creating a Controller Instance outside of MVCThe trick to make this work is to create an MVC Controller instance – any Controller instance – and then configure a ControllerContext through that instance. As long as an HttpContext.Current is available it’s possible to create a fully functional controller context as Razor can get all the necessary context information from the HttpContextWrapper().The key to make this work is the following method:/// <summary> /// Creates an instance of an MVC controller from scratch /// when no existing ControllerContext is present /// </summary> /// <typeparam name="T">Type of the controller to create</typeparam> /// <returns>Controller Context for T</returns> /// <exception cref="InvalidOperationException">thrown if HttpContext not available</exception> public static T CreateController<T>(RouteData routeData = null) where T : Controller, new() { // create a disconnected controller instance T controller = new T(); // get context wrapper from HttpContext if available HttpContextBase wrapper = null; if (HttpContext.Current != null) wrapper = new HttpContextWrapper(System.Web.HttpContext.Current); else throw new InvalidOperationException( "Can't create Controller Context if no active HttpContext instance is available."); if (routeData == null) routeData = new RouteData(); // add the controller routing if not existing if (!routeData.Values.ContainsKey("controller") && !routeData.Values.ContainsKey("Controller")) routeData.Values.Add("controller", controller.GetType().Name .ToLower() .Replace("controller", "")); controller.ControllerContext = new ControllerContext(wrapper, routeData, controller); return controller; }This method creates an instance of a Controller class from an existing HttpContext which means this code should work from anywhere within ASP.NET to create a controller instance that’s ready to be rendered. This means you can use this from within an Application_Error handler as I needed to or even from within a WebAPI controller as long as it’s running inside of ASP.NET (ie. not self-hosted). Nice.So using the ViewRenderer class from the previous article I can now very easily render an MVC view outside of the context of MVC. Here’s what I ended up in my Application’s custom error HttpModule: protected override void OnDisplayError(WebErrorHandler errorHandler, ErrorViewModel model) { var Response = HttpContext.Current.Response; Response.ContentType = "text/html"; Response.StatusCode = errorHandler.OriginalHttpStatusCode; var context = ViewRenderer.CreateController<ErrorController>().ControllerContext; var renderer = new ViewRenderer(context); string html = renderer.RenderView("~/Views/Shared/GenericError.cshtml", model); Response.Write(html); }That’s pretty sweet, because it’s now possible to use ViewRenderer just about anywhere in any ASP.NET application, not only inside of controller code. This also allows the constructor for the ViewRenderer from the last article to work without a controller context parameter, using a generic view as a base for the controller context when not passed:public ViewRenderer(ControllerContext controllerContext = null) { // Create a known controller from HttpContext if no context is passed if (controllerContext == null) { if (HttpContext.Current != null) controllerContext = CreateController<ErrorController>().ControllerContext; else throw new InvalidOperationException( "ViewRenderer must run in the context of an ASP.NET " + "Application and requires HttpContext.Current to be present."); } Context = controllerContext; }In this case I use the ErrorController class which is a generic controller instance that exists in the same assembly as my ViewRenderer class and that works just fine since ‘generically’ rendered views tend to not rely on anything from the controller other than the model which is explicitly passed.While these days most of my apps use MVC I do still have a number of generic pieces in most of these applications where Razor comes in handy. This includes modules like the above, which when they error often need to display error output. In other cases I need to generate string template output for emailing or logging data to disk. Being able to render simply render an arbitrary View to and pass in a model makes this super nice and easy at least within the context of an ASP.NET application!You can check out the updated ViewRenderer class below to render your ‘generic views’ from anywhere within your ASP.NET applications. Hope some of you find this useful.ResourcesViewRenderer Class in Westwind.Web.Mvc Library (Github)Original ViewRenderer ArticleRazor Hosting Library (GitHub)Original Razor Hosting Article© Rick Strahl, West Wind Technologies, 2005-2013Posted in ASP.NET  MVC   Tweet !function(d,s,id){var js,fjs=d.getElementsByTagName(s)[0];if(!d.getElementById(id)){js=d.createElement(s);js.id=id;js.src="//platform.twitter.com/widgets.js";fjs.parentNode.insertBefore(js,fjs);}}(document,"script","twitter-wjs"); (function() { var po = document.createElement('script'); po.type = 'text/javascript'; po.async = true; po.src = 'https://apis.google.com/js/plusone.js'; var s = document.getElementsByTagName('script')[0]; s.parentNode.insertBefore(po, s); })();

    Read the article

  • Appcelerator Titanium - auto height table views break with shortish text

    - by ceejayoz
    I posted this on the Appcelerator Titanium dev Q&A site, but maybe someone here has had this issue... KitchenSink 1.1 illustrates this issue. In table_view_api_auto_height.js, changing row: addRow(0,'This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text.'); to something like: addRow(0,'This is some long text. This is some long text.'); results in incorrect left padding on the row. See screenshot:

    Read the article

  • Webrat says it can't find some text, but the text is actually there

    - by Jason
    I have a webpage that has a form button on it called "delete", and a cuke scenario that has the line: And I should see "delete" When I run the scenario, I get this error: expected the following element's content to include "delete" ...and it dumps the webrat page to stdout and the "delete" is, in fact, not there. So far so good. However, when I tell webrat to show me the page before the error happens: Then show me the page And I should see "delete" ...Safari fires up and shows me the page, and in Safari there's the "delete" button, totally there. Why is webrat not finding the form button? I've also had this same problem with form fields, such as text inputs that have a value in them when the page loads, but webrat says there's nothing there. Looking at it in Safari shows, again, that the field does have the right text in it. Is this a bug, or is webrat just not suitable for checking form elements? Is there a different way to do this? Thanks!

    Read the article

  • The Case of the Extra Page: Rendering Reporting Services as PDF

    - by smisner
    I had to troubleshoot a problem with a mysterious extra page appearing in a PDF this week. My first thought was that it was likely to caused by one of the most common problems that people encounter when developing reports that eventually get rendered as PDF is getting blank pages inserted into the PDF document. The cause of the blank pages is usually related to sizing. You can learn more at Understanding Pagination in Reporting Services in Books Online. When designing a report, you have to be really careful with the layout of items in the body. As you move items around, the body will expand to accommodate the space you're using and you might eventually tighten everything back up again, but the body doesn't automatically collapse. One of my favorite things to do in Reporting Services 2005 - which I dubbed the "vacu-pack" method - was to just erase the size property of the Body and let it auto-calculate the new size, squeezing out all the extra space. Alas, that method no longer works beginning with Reporting Services 2008. Even when you make sure the body size is as small as possible (with no unnecessary extra space along the top, bottom, left, or right side of the body), it's important to calculate the body size plus header plus footer plus the margins and ensure that the calculated height and width do not exceed the report's height and width (shown as the page in the illustration above). This won't matter if users always render reports online, but they'll get extra pages in a PDF document if the report's height and width are smaller than the calculate space. Beginning the Investigation In the situation that I was troubleshooting, I checked the properties: Item Property Value Body Height 6.25in   Width 10.5in Page Header Height 1in Page Footer Height 0.25in Report Left Margin 0.1in   Right Margin 0.1in   Top Margin 0.05in   Bottom Margin 0.05in   Page Size - Height 8.5in   Page Size - Width 11in So I calculated the total width using Body Width + Left Margin + Right Margin and came up with a value of 10.7 inches. And then I calculated the total height using Body Height + Page Header Height + Page Footer Height + Top Margin + Bottom Margin and got 7.6 inches. Well, page sizing couldn't be the reason for the extra page in my report because 10.7 inches is smaller than the report's width of 11 inches and 7.6 inches is smaller than the report's height of 8.5 inches. I had to look elsewhere to find the culprit. Conducting the Third Degree My next thought was to focus on the rendering size of the items in the report. I've adapted my problem to use the Adventure Works database. At the top of the report are two charts, and then below each chart is a rectangle that contains a table. In the real-life scenario, there were some graphics present as a background for the tables which fit within the rectangles that were about 3 inches high so the visual space of the rectangles matched the visual space of the charts - also about 3 inches high. But there was also a huge amount of white space at the bottom of the page, and as I mentioned at the beginning of this post, a second page which was blank except for the footer that appeared at the bottom. Placing a textbox beneath the rectangles to see if they would appear on the first page resulted the textbox's appearance on the second page. For some reason, the rectangles wanted a buffer zone beneath them. What's going on? Taking the Suspect into Custody My next step was to see what was really going on with the rectangle. The graphic appeared to be correctly sized, but the behavior in the report indicated the rectangle was growing. So I added a border to the rectangle to see what it was doing. When I added borders, I could see that the size of each rectangle was growing to accommodate the table it contains. The rectangle on the right is slightly larger than the one on the left because the table on the right contains an extra row. The rectangle is trying to preserve the whitespace that appears in the layout, as shown below. Closing the Case Now that I knew what the problem was, what could I do about it? Because of the graphic in the rectangle (not shown), I couldn't eliminate the use of the rectangles and just show the tables. But fortunately, there is a report property that comes to the rescue: ConsumeContainerWhitespace (accessible only in the Properties window). I set the value of this property to True. Problem solved. Now the rectangles remain fixed at the configured size and don't grow vertically to preserve the whitespace. Case closed.

    Read the article

  • Shadow mapping with deffered shading for directional lights - shadow map projection problem

    - by Harry
    I'm trying to implement shadow mapping to my engine. I started with directional lights because they seemed to be the easiest one, but I was wrong :) I have implemented deferred shading and I retrieve position from depth. I think that there is the biggest problem but code looks ok for me. Now more about problem: Shadow map projected onto meshes looks bad scaled and translated and also some informations from shadow map texture aren't visible. You can see it on this screen: http://img5.imageshack.us/img5/2254/93dn.png Yelow frustum is light frustum and I have mixed shadow map preview and actual scene. As you can see shadows are in wrong place and shadow of cone and sphere aren't visible. Could you look at my codes and tell me where I have a mistake? // create shadow map if(!_shd)glGenTextures(1, &_shd); glBindTexture(GL_TEXTURE_2D, _shd); glTexImage2D(GL_TEXTURE_2D, 0, GL_DEPTH_COMPONENT, 1024, 1024, 0, GL_DEPTH_COMPONENT, GL_FLOAT,NULL); // shadow map size glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_MAG_FILTER, GL_NEAREST); glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_MIN_FILTER, GL_NEAREST); glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_WRAP_S, GL_CLAMP_TO_EDGE); glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_WRAP_T, GL_CLAMP_TO_EDGE); glFramebufferTexture2D(GL_DRAW_FRAMEBUFFER, GL_DEPTH_ATTACHMENT, GL_TEXTURE_2D, _shd, 0); glDrawBuffer(GL_NONE); // setting camera Vector dire=Vector(0,0,1); ACamera.setLookAt(dire,Vector(0)); ACamera.setPerspectiveView(60.0f,1,0.1f,10.0f); // currently needed for proper frustum corners calculation Vector min(ACamera._point[0]),max(ACamera._point[0]); for(int i=0;i<8;i++){ max=Max(max,ACamera._point[i]); min=Min(min,ACamera._point[i]); } ACamera.setOrthogonalView(min.x,max.x,min.y,max.y,-max.z,-min.z); glBindFramebuffer(GL_DRAW_FRAMEBUFFER, _s_buffer); // framebuffer for shadow map // rendering to depth buffer glBindFramebuffer(GL_DRAW_FRAMEBUFFER, _g_buffer); Shaders["DirLight"].set(true); Matrix4 bias; bias.x.set(0.5,0.0,0.0,0.0); bias.y.set(0.0,0.5,0.0,0.0); bias.z.set(0.0,0.0,0.5,0.0); bias.w.set(0.5,0.5,0.5,1.0); Shaders["DirLight"].set("textureMatrix",ACamera.matrix*Projection3D*bias); // order of multiplications are 100% correct, everything gives mi the same result as using glm glActiveTexture(GL_TEXTURE5); glBindTexture(GL_TEXTURE_2D,_shd); lightDir(dir); // light calculations Vertex Shader makes nothing related to shadow calculatons Pixel shader function which calculates if pixel is in shadow or not: float readShadowMap(vec3 eyeDir) { // retrieve depth of pixel float z = texture2D(depth, gl_FragCoord.xy/screen).z; vec3 pos = vec3(gl_FragCoord.xy/screen, z); // transform by the projection and view inverse vec4 worldSpace = inverse(View)*inverse(ProjectionMatrix)*vec4(pos*2-1,1); worldSpace /= worldSpace.w; vec4 coord=textureMatrix*worldSpace; float vis=1.0f; if(texture2D(shadow, coord.xy).z < coord.z-0.001)vis=0.2f; return vis; } I also have question about shadows specifically for directional light. Currently I always look at 0,0,0 position and in further implementation I have to move light frustum along to camera frustum. I've found how to do this here: http://www.gamedev.net/topic/505893-orthographic-projection-for-shadow-mapping/ but it doesn't give me what I want. Maybe because of problems mentioned above, but I want know your opinion. EDIT: vec4 worldSpace is position read from depht of the scene (not shadow map). Maybe I wasn't precise so I'll try quick explain what is what: View is camera view matrix, ProjectionMatrix is camera projection,. First I try to get world space position from depth map and then multiply it by textureMatrix which is light view *light projection*bias. Rest of code is the same as in many tutorials. I can't use vertex shader to make something like gl_Position=textureMatrix*gl_Vertex and get it interpolated in fragment shader because of deffered rendering use so I want get it from depht buffer. EDIT2: I also tried make it as in Coding Labs tutorial about Shadow Mapping with Deferred Rendering but unfortunately this either works wrong.

    Read the article

  • ASP.NET Conditionally Change ButtonField text at runTime

    - by Rodney Vinyard
    ASP.NET Conditionally Change ButtonField text at runTime   <asp:ButtonField CommandName="Edit" HeaderText="" Text="Edit" ButtonType="Link" />       protected void gvRequests_RowDataBound(object sender, GridViewRowEventArgs e)     {         if (e.Row.RowType == DataControlRowType.DataRow)         {             //----------------------------------------------------             // If status = "Saved", change buttonField.LinkButton.Text to "Copy"             //----------------------------------------------------             if (e.Row.Cells[(int)gCol.Status].Text == "Saved")             {                 //----------------------------------------------------                 // no !                 //----------------------------------------------------                 //string x = e.Row.Cells[(int)gCol.EditLink].Text;                 //e.Row.Cells[(int)gCol.EditLink].Text = "Copy";                   //----------------------------------------------------                 // yes !                 //----------------------------------------------------                 LinkButton linkButton = (LinkButton)e.Row.Cells[(int)gCol.EditLink].Controls[0];                 linkButton.Text = "Copy";             }         }     }

    Read the article

  • knockout bind text label to dropdown value selected option text

    - by Adam Levitt
    Is there a simple way to bind the textbox of a div to change based on the text value of the selected option in a dropdown on the same page? <div data-bind="text: dropdownValue"></div> <select> <option value="1">Value1</option> <option value="2">Value2</option> </select> Please note, I don't want to put the values into the select element using javascript. I'd like to bind to the value straight from the HTML. I can also include jQuery to make it work.

    Read the article

  • C# Tip - Rendering HTML in a Gridview cell

    - by BobPalmer
    Just a quick tip for working with the gridview in ASP.Net.  If your data column contains HTML text, you've probably seen something like this in your gridview after pulling the data: <font color="red">First Item</font><br/><font color="green">Second Item</font><br/><font color="blue">Third Item</font> To have the relevant column render in HTML, just go to your gridview property pages, find the column you need rendered in HTML, and click 'convert this Field into a TemplateField'.  The result is that as a template field, HTML within your bound data value will be rendered properly.  So our example above would transform into: First Item Second Item Third Item I primarily use this technique for enabling HTML content in comment fields, and to insert line breaks when building the data for these fields. Hope this helps out! -Bob

    Read the article

  • Issue with parsed text with HTMLCleaner - spaces at the begining of text

    - by ansol90
    Im able to get text using HTMLCleaner from website. The problem is that when I set the text to a TextView it shows the beginning of the text with a big space on it. Here is the screenshot of what im talking about. I have tried android:gravity but nothing happened. Please help. Here is my Code: private class SiteParser extends AsyncTask<String, Void, String> { protected String doInBackground(String... arg) { String output = null; try { HtmlHelper hh = new HtmlHelper(new URL(arg[0])); List<TagNode> news = hh.getnewsByClass("TextoPrint"); for (Iterator<TagNode> iterator = newss.iterator(); iterator .hasNext();) { TagNode divElement = (TagNode) iterator.next(); output = divElement.getText().toString(); } } catch (Exception e) { e.printStackTrace(); } return output; } protected void onPostExecute(String output) { Bundle bundle=new Bundle(); bundle.putString("body",output); Intent mainIntent = new Intent(act, MyView.class); mainIntent.putExtras(bundle); startActivity(mainIntent); act.finish(); } } public class HtmlHelper { TagNode rootNode; public HtmlHelper(URL htmlPage) throws IOException, XPatherException { HtmlCleaner cleaner = new HtmlCleaner(); rootNode = cleaner.clean(htmlPage); } List<TagNode> getnewsByClass(String Classname){ List<TagNode> newsList = new ArrayList<TagNode>(); TagNode divElements[] = rootNode.getElementsByName("div", true); for (int i = 0; divElements != null && i < divElements.length; i++) { String classType = divElements[i].getAttributeByName("id"); if (classType != null && classType.equals(Classname)) { newsList.add(divElements[i]); } } return newsList; } }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Change input text to regular text on blur and ability to edit jQuery

    - by eknown
    I'm creating a form where I'm eliminating the use of a save button. The form is made up of input text boxes and textareas. After the user enters data into the input field, I want to trigger an onBlur function and change the input into a span that contains the information that the user entered. I also want to have the ability to edit this information, so if the user clicks on the newly created span with text, it will turn back into the input field with the current information for their editing pleasure. For reference, I'm looking to have a functionality pretty much like on editing a photo title on Flickr. If possible, I'd also like to have the textbox show "saving..." for half a second after the blur to reflect interaction with server.

    Read the article

  • Send SMS text messages for FREE using Java ME

    - by hinkmond
    Here's a way to get around those nasty SMS text messages charges (and maybe a way to get around the Pakistan SMS text censors too!). Use this Java ME SMS text app for your Java ME mobile phone, called JaxtrSMS: See: JaxtrSMS free Java ME SMS Here's a quote: JaxtrSMS lets you send FREE SMS and txt messages to any mobile phone in the world. Best of all, the receiver does not have to have the JaxtrSMS app. International and local SMS/texting can be expensive but with JaxtrSMS you can text anyone in the world for FREE! Great! Now, you can send 2,000 text messages from your phone every month and not worry about a huge bill. You don't send 2,000 text message in a month? Well, get it for your teenage kids then. They certainly send 2,000 text messages in a month... Hinkmond

    Read the article

  • Efficient way to render tile-based map in Java

    - by Lucius
    Some time ago I posted here because I was having some memory issues with a game I'm working on. That has been pretty much solved thanks to some suggestions here, so I decided to come back with another problem I'm having. Basically, I feel that too much of the CPU is being used when rendering the map. I have a Core i5-2500 processor and when running the game, the CPU usage is about 35% - and I can't accept that that's just how it has to be. This is how I'm going about rendering the map: I have the X and Y coordinates of the player, so I'm not drawing the whole map, just the visible portion of it; The number of visible tiles on screen varies according to the resolution chosen by the player (the CPU usage is 35% here when playing at a resolution of 1440x900); If the tile is "empty", I just skip drawing it (this didn't visibly lower the CPU usage, but reduced the drawing time in about 20ms); The map is composed of 5 layers - for more details; The tiles are 32x32 pixels; And just to be on the safe side, I'll post the code for drawing the game here, although it's as messy and unreadable as it can be T_T (I'll try to make it a little readable) private void drawGame(Graphics2D g2d){ //Width and Height of the visible portion of the map (not of the screen) int visionWidht = visibleCols * TILE_SIZE; int visionHeight = visibleRows * TILE_SIZE; //Since the map can be smaller than the screen, I center it just to be sure int xAdjust = (getWidth() - visionWidht) / 2; int yAdjust = (getHeight() - visionHeight) / 2; //This "deducedX" thing is to move the map a few pixels horizontally, since the player moves by pixels and not full tiles int playerDrawX = listOfCharacters.get(0).getX(); int deducedX = 0; if (listOfCharacters.get(0).currentCol() - visibleCols / 2 >= 0) { playerDrawX = visibleCols / 2 * TILE_SIZE; map_draw_col = listOfCharacters.get(0).currentCol() - visibleCols / 2; deducedX = listOfCharacters.get(0).getXCol(); } //"deducedY" is the same deal as "deducedX", but vertically int playerDrawY = listOfCharacters.get(0).getY(); int deducedY = 0; if (listOfCharacters.get(0).currentRow() - visibleRows / 2 >= 0) { playerDrawY = visibleRows / 2 * TILE_SIZE; map_draw_row = listOfCharacters.get(0).currentRow() - visibleRows / 2; deducedY = listOfCharacters.get(0).getYRow(); } int max_cols = visibleCols + map_draw_col; if (max_cols >= map.getCols()) { max_cols = map.getCols() - 1; deducedX = 0; map_draw_col = max_cols - visibleCols + 1; playerDrawX = listOfCharacters.get(0).getX() - map_draw_col * TILE_SIZE; } int max_rows = visibleRows + map_draw_row; if (max_rows >= map.getRows()) { max_rows = map.getRows() - 1; deducedY = 0; map_draw_row = max_rows - visibleRows + 1; playerDrawY = listOfCharacters.get(0).getY() - map_draw_row * TILE_SIZE; } //map_draw_row and map_draw_col representes the coordinate of the upper left tile on the screen //iterate through all the tiles on screen and draw them - this is what consumes most of the CPU for (int col = map_draw_col; col <= max_cols; col++) { for (int row = map_draw_row; row <= max_rows; row++) { Tile[] tiles = map.getTiles(col, row); for(int layer = 0; layer < tiles.length; layer++){ Tile currentTile = tiles[layer]; boolean shouldDraw = true; //I only draw the tile if it exists and is not empty (id=-1) if(currentTile != null && currentTile.getId() >= 0){ //The layers above 1 can be draw behing or infront of the player according to where it's standing if(layer > 1 && currentTile.getId() >= 0){ if(playerBehind(col, row, layer, listOfCharacters.get(0))){ behinds.get(0).add(new int[]{col, row}); //the tiles that are infront of the player wont be draw right now shouldDraw = false; } } if(shouldDraw){ g2d.drawImage( tiles[layer].getImage(), (col-map_draw_col)*TILE_SIZE - deducedX + xAdjust, (row-map_draw_row)*TILE_SIZE - deducedY + yAdjust, null); } } } } } } There's some more code in this method but nothing relevant to this question. Basically, the biggest problem is that I iterate over around 5000 tiles (in this specific resolution) 60 times each second. I thought about rendering the visible portion of the map once and storing it into a BufferedImage and when the player moved move the whole image the same amount but to the opposite side and then drawn the tiles that appeared on the screen, but if I do it like that, I wont be able to have animated tiles (at least I think). That being said, any suggestions?

    Read the article

  • Changing Text colour in text field by dropdown menu - Visual Studio 2008

    - by Wayne
    Hey, i'm just doing some testing on Visual Studio 2008, what i'm trying to do is to change the text colour inside the multi-textfield which isn't working and I don't know why... Public Class Form1 Dim ColourValue As Color Private Sub Form1_Load(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles MyBase.Load rbBlue.Checked = False rbRed.Checked = False rbGreen.Checked = False End Sub Private Sub rbRed_CheckedChanged(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles rbRed.CheckedChanged txtSpace.BackColor = Color.Red End Sub Private Sub rbBlue_CheckedChanged(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles rbBlue.CheckedChanged txtSpace.BackColor = Color.Blue End Sub Private Sub rbGreen_CheckedChanged(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles rbGreen.CheckedChanged txtSpace.BackColor = Color.Green End Sub Private Sub cbColours_SelectedValueChanged(ByVal sender As Object, ByVal e As System.EventArgs) Handles cbColours.SelectedValueChanged ColourValue = cbColours.SelectedValue txtSpace.BackColor = ColourValue End Sub End Class Basically i have the radio buttons that would change the background colour of the textfield, but i just need the dropdown menu to change the text colour. Many thanks :)

    Read the article

< Previous Page | 24 25 26 27 28 29 30 31 32 33 34 35  | Next Page >