Search Results

Search found 11768 results on 471 pages for 'railstutorial org'.

Page 283/471 | < Previous Page | 279 280 281 282 283 284 285 286 287 288 289 290  | Next Page >

• How to move a windows machine properly from RAID 1 to raid 10? [migrated]

  - by goober

  Goal I would like to add two more hard drives to my current RAID 1 setup and create a RAID 0 setup on top of the two RAID 1 setups (which I believe is referred to as "RAID 10"). Components Involved Intel P68 Chipset Motherboard 4 SATA ports that can be configured for Raid An intel SSD cache that sits in front of the RAID, and a 64 GB SSD configured in that manner Two 1TB HDDs configured in RAID 1 OS: Windows 7 Professional Resources Consulted so far I found a great resource on LinuxQuestions.org for a good "best practices" process for Linux machines, but I'd like to develop a similar process that I know works on Windows Machines.

  Read the article

• X11 not sending windows to remote computer matlab

  - by MZimmerman6

  I am trying to set up my home desktop, running OS X Mountain Lion, to basically do a bunch of grunt work for me remotely. I have set up ssh, and am able to remotely control the computer fine, but the issue comes in when I try to run X11 apps, like MATLAB, remotely and get windows to pop up. Every time I try to bring up a new window it either opens that window on the remote computer (not the one I am using to control it), or it tells me it can't find a display. here is how I am setting up my ssh assume my matlab alias is set up properly, which it is. ssh -X username@host.org matlab -nodesktop figure; This will open the window on the computer I am SSHing into, and not on the remote one. Basically I want that window to open on the computer I am remoting from. I changed my SSH X11Forwarding and stuff to be yes in ssh_config and sshd_config. Any other suggestions?

  Read the article

• Non interactive git clone (ssh fingerprint prompt)

  - by qwe

  I want to clone a repo in a non-interactive way. When cloning, git asks to confirm host's fingerprint: The authenticity of host 'bitbucket.org (207.223.240.182)' can't be established. RSA key fingerprint is 97:8c:1b:f2:6f:14:6b:5c:3b:ec:aa:46:46:74:7c:40. Are you sure you want to continue connecting (yes/no)? no How do I force "yes" every time this questions pops up? I tried using yes yes | git clone ..., but it doesn't work. EDIT: Here's a solution: Can I automatically add a new host to known_hosts? (adds entires to known_hosts with ssh-keyscan).

  Read the article

• Install Composer on Ubuntu

  - by Milos

  I am trying to install composer with the command: sudo curl -s https://getcomposer.org/installer | php And I am getting this error: All settings correct for using Composer Downloading... Download failed: failed to open stream: Permission denied Downloading... Download failed: failed to open stream: Permission denied Downloading... Download failed: failed to open stream: Permission denied The download failed repeatedly, aborting. I don't know why? Do you have an idea? I tryed to google it but nothing.

  Read the article

• How can I use target mode in Linux with USB?

  - by dash17291

  Kernel 3.5 introduces: This release includes a driver for using an IEEE-1394 connection as a SCSI transport. This enables to expose SCSI devices to other nodes on the Firewire bus, for example hard disk drives. It's a similar functionality to Firewire Target Disk Mode on many Apple computers. This release also adds a usb-gadget driver that does the same with USB. The driver supports two USB protocols are supported that is BBB or BOT (Bulk Only Transport) and UAS (USB Attached SCSI). BOT is advertised on alternative interface 0 (primary) and UAS is on alternative interface 1. Both protocols can work on USB 2.0 and USB 3.0. UAS utilizes the USB 3.0 feature called streams support. http://kernelnewbies.org/Linux_3.5 I have an Arch Linux with kernel 3.5.3-1 and wanna try out this feature.

  Read the article

• How to combine with openvpn, dynamic-ip?

  - by asfasdv

  Dear everyone, I am currently using openvpn to surf online to bypass censorship. Let me show you the initial scenario: before openvpn is turned on: IP: 1.2.3.4 (hypothetical, checked by visiting whatismyip.com/) after openvpn is turned on IP: 10.2.3.4 (this is also checked with whatismyip.com/, I assume this is where the vpn's exit point's IP ) Situation: Once I enable openvpn, I can still ssh into this computer by sshing into 1.2.3.4, even though visiting whatismyip.com/ says it's 10.2.3.4. However, I am on dynamic IP, I run a website, and am using tools (inadyn in particular) which pings the freedns.afraid.org (my dns server) and updates my ip. The messed up part is when inadyn does so, my dns changes the ip to 10.2.3.4, which is presumably the exit point of my vpn. How do I get around this? (Note that sshing into 1.2.3.4 STILL works).

  Read the article

• Setting up a copy of a site with IIS 7?

  - by SJaguar13

  I have a site running on IIS with a dyndns.org domain that points to the IP of the Windows 2008 machine hosting it. I need a copy of that site for development purposes. I set up another folder with all the files, and create a new site in IIS. I don't really have a domain for it, so I was just going to use the IP address. When I go to localhost, 127.0.0.1, or the internal IP, I get bad hostname. If I use the IP address on port 80 (the same as the real version of the site), I get 404 not found. If I use a different port so I don't have them both on the same IP with the same port, I get connection timed out. How do I go about setting this up?

  Read the article

• How to perform a nested mount when using chroot?

  - by user55542

  Note that this question is prompted by the circumstances detailed by me (as Xl1NntniNH7F) in http://www.linuxquestions.org/questions/linux-desktop-74/boot-failure-upon-updating-e2fsprogs-in-ubuntu-10-10-a-947328/. Thus if you could address the underlying cause of the boot failure, I would very much appreciate it. I'm trying to replicate the environment in my ubuntu installation (where the home folder is on a separate partition) in order to run make uninstall. I'm using a live cd. How to mount a dir in one partition (sda2, mounted in ubuntu as the home folder) into a directory on another mounted partition (sda3)? I did chroot /mnt/sda2 but I don't know how to mount sda3 to /home, and my various attempts didn't work. As I am unfamiliar with chroot, my approach could be wrong, so it would be great if you could suggest what I should do, given my circumstances.

  Read the article

• time on files differ by 1 sec. FAIL Robocopy sync

  - by csmba

  I am trying to use Robocopy to sync (/IMG) a folder on my PC and a shared network drive. The problem is that the file attributes differ by 1 sec on both locations (creation,modified and access). So every time I run robocopy, it syncs the file again... BTW, problem is the same if I delete the target file and robocopy it from new... still, new file has 1 sec different properties. Env Details: Source: Win 7 64 bit Target: WD My Book World Edition NAS 1TB which takes its time from online NTP pool.ntp.org (I don't know if file system is FAT or not)

  Read the article

• Running JBoss 6 with Runit / daemontools or other process supervision framework

  - by Alex Recarey

  I'm tying to use runit to daemonize JBoss. I use the /opt/jboss-6.1.0.Final/bin/run.sh script to start the server. When I do so from the comandline, JBoss does not detach (which is what we want), and will also shut down when CTRL+C is pressed. In theory a perfect candidate to use runit on. Everything works fine except when I try to get runit to shut down JBoss. When I issue the command sv stop jboss nothing happens. Runit thinks the process is stopped but jboss continues to run normally. I'm not doing anything special with the run script. This is my runit run script: #!/bin/sh exec 2>&1 exec /opt/jboss-6.1.0.Final/bin/run.sh -c standard -b 0.0.0.0 Looking at the jboss_init_redhat.sh script, the start section does mention ./bin/run.sh but the stop section has the following text: JBOSS_CMD_STOP=${JBOSS_CMD_STOP:-"java -classpath $JBOSSCP org.jboss.Shutdown --shutdown"} Any ideas of what I could try?

  Read the article

• Link two or more text boxes in Visio

  - by Dan

  I am working on creating a template in Visio 2007 (Professional). Each page should reflect a document number and a revision number (two text boxes). I would like to make the template such that entering or changing text in one of these boxes on one page will automatically update the equivalent text boxes on all other pages. Is there an easy way to link two (or more) text boxes to show the same data (mirror each other)? I've looked into creating a ShapeData set and then using the ShapeData field in place of each box, but this will require training others to access and adjust the ShapeData field. In short - I want the issue that was attempting to be solved in Changing Text in Visio Org Chart Shape Changes Multiple Shapes' Text .

  Read the article

• Expertise Location [closed]

  - by Alexey Shatygin

  Is there some really working implementations of the expertise location systems exist? It is very hard to find anything about it. What sources to use, what to read, where to look? I've started with reading David W. McDonald's, Mark S. Ackerman's overview "Just talk to me" and now need just something more detailed. For those, who voting this question to be closed for off-topic: it is connected to IT sphere, if you don't know what it is - why ever vote? http://en.wikipedia.org/wiki/Expertise_finding http://citeseerx.ist.psu.edu/viewdoc/download?doi=10.1.1.40.4654&rep=rep1&type=pdf

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Redirecting HTTP traffic from a local server on the web

  - by MrJackV

  Here is the situation: I have a webserver (let's call it C1) that is running an apache/php server and it is port forwarded so that I can access it anywhere. However there is another computer within the webserver LAN that has a apache server too (let's call it C2). I cannot change the port forwarding nor I can change the apache server (a.k.a. install custom modules). My question is: is there a way to access C2 within a directory of C1? (e.g. going to www.website.org/random_dir will allow me to browse the root of C2 apache server.) I am trying to change as little as possible of the config/other (e.g. activating modules etc.) Is there a possible solution? Thanks in advance.

  Read the article

• Unable to open websites that use HTTPS on linux

  - by negai

  I have the following network configuration: My PC 192.168.1.20/24 uses 192.168.1.1/24 as a gateway. Dlink-2760U router with Local address 192.168.1.1/24 has a VPN connection open with the provider using PPTP. Whenever I'm trying to open some web-sites that has some authorization (e.g. gmail.com, coursera.org), I'm getting a request timeout. This problem is observed mostly on linux (Ubuntu 12.04 and Debian 6.0), while most of such websites work correctly on windows XP. Could you please help me diagnose the problem? Could it be related to NAT + HTTPS? Thanks

  Read the article

• How to make vim display unicode

  - by Yitzchak

  I am trying to work with a utf-8 encoded xml file in vim 7.3 running on ubuntu. ASCII characters display normally but vim gives me gibberish instead of the unicode characters. After trying the following, I've reached the limits of my knowledge: 1) Checked that unicode was enabled by running set termencoding?. Output was termencoding=utf-8. 2) I installed the script from here (vim.org/scripts) 3) moved my ~/.vimrc file into ~/.vim 4) moved it back into ~ 5) followed the instructions in the accepted answer to this question. Is there some other variable I'm supposed to set? I know my system has the fonts I need. Update: Issue seems to be limited to html files for some reason.

  Read the article

• Move and clone VirtualBox machines with filesystem commands

  - by mit

  I know of 2 ways to clone a VirtualBox machine on a linux host, one is by using the VirtualBox gui and exporting and re-importing as Appliance (in the file menu of VirtualBox). The other is by cloning only the virtual disk containers: VBoxManage clonevdi source.vdi target.vdi (Taken from http://forums.virtualbox.org/viewtopic.php?p=853#p858 ) I would have to create a new VM afterwards and use the cloned virtual disk. Is there a way I can just copy a virtual disk and the and do the rest by hand? I'd have to manually edit the ~/VirtualBox/VirtualBox.xml and insert a new disk and a new machine: Can I just make up UUIDs or how would this work? I would very much prefer this hardcore method of doing things as it allows me to freely and rapdily backup, restore, move or clone machines. Or ist there a better way to do this?

  Read the article

• How to limit server to specific IP addresses with mod_authz_host?

  - by BeeDog

  Hi! I am very new to this area, so please bear with me. :) Right now I am running an Apache HTTP server on my setup, a very basic configuration. The website hosted on it is accessible from anywhere, and I want to limit the access to a specific IP address range. I've looked into this and I found that one Apache module called mod_authz_host handles this. http://httpd.apache.org/docs/2.2/mod/mod_authz_host.html The problem is, I haven't managed to find documentation that explains well how to actually do the stuff. How do I actually make sure only a certain range of IP addresses can access my site/server? The machine is running Ubuntu Server 10.10, the web files are stored in /var/www/, the apache2 daemon has its stuff stored in /etc/apache2/ and /usr/lib/apache2/modules/*. Thanks in advance, and sorry if this is a stupid question!

  Read the article

• Window 2003 is PHP Limiting my Download Speed?

  - by JohnScout

  Hello, I have window 2003 100mbps server, i have tried using php script such as php indexer, zina pancake.org and others. The php script use to serve download such as images and music songs. I personally have 20mbps internet speed. When i use the php script (download pass thru PHP headers) , it will download at constant speed of 30-40KBps. I have tried different webserver such as apache 1.3, apache 2.2, abyss webserver & lighttpd for windows. The speed while relying on php is same constant 30-40KBps however when i tried direct link/straight from apache, the speed is 1MB/s. Is there any settings in Window 2003 Registry or PHP should i change to make the download speed is more faster when going thru PHP?

  Read the article

• What is the `/etc/hostname` used/required for?

  - by static

  I found in the /etc/hostname my IP-address, than I deleted it and each time I use sudo - I get a message and a system email sudo: unable to resolve host (none) or if in the /etc/hostname is saved myhostname than sudo: unable to resolve host (myhostname). I know it is used to set the system's hostname via /etc/init.d/hostname.sh while booting process, but what is this setting required for (programs, services, daemons ...)? What if i set to localhost (so it doesn't happen any sudo: unable to resolve host (none) anymore, but is it still ok?)? UPD1: I found some information here: http://jblevins.org/log/hostname, but it is all about how to use it and not about - why it is required.

  Read the article

• Missing time zones in OSX and Windows

  - by pellepim

  I am working on a javascript to automatically detect a user's timezone (https://bitbucket.org/pellepim/jstimezonedetect/). But there are two timezones that I have a really hard time to test, since I can not set my system to observe these timezones. The timezones I am talking about are UTC+1245 (Chatham Islands, NZ) and UTC+0845 (Australia/Eucla). As far as I can tell in OSX (Snow Leopard) and in Windows 7 these timezones do not exist as a setting. Granted, very few people live in these areas, and it might just not be worth it. Does anyone know of a way to set these timezones on a system level? In any operating system? If it is not possible in a trivial way, what do people who live in these areas do to get their systems working as they would like?

  Read the article

• debian installation without internet connection

  - by Gobliins

  Hi i want to install some Debian distributions (Grip, Crush, Lenny...) for arm / armel architectures. www.emdebian.org/ i refer to this guide www.aurel32.net/info/debian_arm_qemu.php The Problem i have is that i dont have internet connection with My Linux VM or Qemu i am behind a Proxy. I want to know is there a way where i can dl all the needed files and save them to disk that i don´t need an i.c. during the installation? I am working under Windows now. my regards

  Read the article

• How to upgrade Nginx?

  - by jwerre

  I'm on Ububtu and I'm trying upgrade Nginx 1.0.5 to the latest version 1.2.6. Here's what I did and what didn't work. $ nginx -v nginx: nginx version: nginx/1.0.5 $ curl -O http://nginx.org/download/nginx-1.2.6.tar.gz $ tar xvzf nginx-1.2.6.tar.gz $ cd nginx-1.2.6/ $ ./configure $ make && sudo make install $ nginx -v nginx: nginx version: nginx/1.0.5 <<< still old version!!! Any ideas would be much appreciated. Thanks.

  Read the article

• SFTP not working, but SSH is

  - by Dan

  I've had a server running CentOS for a few months now. A few days ago, I stopped being able to connect to it over SFTP. I've tried from multiple computers, OSes, clients, and internet connections. I can SSH in just fine, though. For example, Nautilus gives me this: Error: DBus error org.freedesktop.DBus.Error.NoReply: Did not receive a reply. Possible causes include: the remote application did not send a reply, the message bus security policy blocked the reply, the reply timeout expired, or the network connection was broken. Please select another viewer and try again. I was under the impression that SFTP was just pure SSH, and if one worked, the other would, and vice-versa. Clearly that's not the case, though. What could I have done wrong?

  Read the article

• Allow Internet Access with Default Gateway on Windows 7 VPN Server

  - by Hakoda

  I have a Windows 7 box at home (which I'll refer to as Home-VPN) that runs a simple PPTP VPN server. I have a range of 2 IP address (192.168.1.10-192.168.1.11) to give out, although the server is only able to give out one concurrent connection. Ports 1723 & 47 are correctly forwarded to the server. IPv6 is disabled on both Home-VPN and the client. I setup Home-VPN just like this Youtube video: http://www.youtube.com/watch?v=1s5JxMG06L4 I can connect to it just fine but I can't access the Internet when connected to Home-VPN, all outside web servers (eg. google.com, mozilla.org, apple.com) are unreachable. I know I can uncheck "Use Default Gateway on Remote Servers" on the client side under IPv4 settings but that will route all my traffic through my current connection, rather than through the VPN, defeating the purpose of said VPN. Any ideas on how I can fix this?

  Read the article

< Previous Page | 279 280 281 282 283 284 285 286 287 288 289 290  | Next Page >