Search Results

Search found 52506 results on 2101 pages for 'multiple value'.

Page 284/2101 | < Previous Page | 280 281 282 283 284 285 286 287 288 289 290 291  | Next Page >

• xsl key - multiple levels for an element

  - by user1004770

  My previous post was not very meaningful. reposting here. What i am looking for is the QueueManager element, under SORRegion name="default"(which is the parent), within inan.xml. I have used xsl key. In my xsl the value 'default' is hardcoded. here is the xsl i used <xsl:stylesheet version="1.0" xmlns:xsl="http://www.w3.org/1999/XSL/Transform" > <xsl:output omit-xml-declaration="yes" indent="yes" method="xml" /> <xsl:key name="CR-lookup" match="Service" use="concat(@ServiceName, '+', SOR/@SORname, '+', */CountryCode/@Ctrycd, '+', */*/SORRegion/@name, '+', */*/*/ConsumerName/@name)"/> <xsl:variable name="CRTable" select="document('inan.xml')"/> <xsl:template match="/"> <Contributor> <ContributorRole> <xsl:for-each select="$CRTable"> <!-- change context document --> <xsl:for-each select="key('CR-lookup', concat('StatementIndicatorsService', '+', 'Globestar', '+', '124', '+', 'default', '+', 'MYCA'))"> <a> <xsl:value-of select="*/*/*/*/QueueManager"/> </a> </xsl:for-each> </xsl:for-each> </ContributorRole> </Contributor> </xsl:template> </xsl:stylesheet> any input xml file is fine. here is my actual output <Contributor> <ContributorRole /> </Contributor> expected output <Contributor> <ContributorRole> <a>MAO1</a> </ContributorRole> </Contributor> inan.xml document <RoutingDetails> <Service ServiceName="StatementIndicatorsService"> <SOR SORname="Globestar"> <CountryCode Ctrycd="124"> <SORRegion name="Test"> <ConsumerName name="MYCA"> <AutomationIds> <PreAutoId> <AutomationId>XA1146A</AutomationId> <AutomationId>XA1146B</AutomationId> </PreAutoId> <DefaultAutoId> <AutomationId>XA1146C</AutomationId> </DefaultAutoId> </AutomationIds> </ConsumerName> <QueueDetails> <QueueManager>MAO1</QueueManager> <ReplyQueueManager>MAO1</ReplyQueueManager> <RequestQueue>GSTAR.ICS.DP.DHIPO211.REQUEST</RequestQueue> <ReplyQueue>ICS.DP.REPLY</ReplyQueue> </QueueDetails> </SORRegion> <SORRegion name="default"> <ConsumerName name="MYCA"> <AutomationIds> <PreAutoId> <AutomationId>XA1146A</AutomationId> <AutomationId>XA1146A</AutomationId> </PreAutoId> <DefaultAutoId> <AutomationId>XA1146A</AutomationId> </DefaultAutoId> </AutomationIds> </ConsumerName> <QueueDetails> <QueueManager>MAO1</QueueManager> <ReplyQueueManager>MAO1</ReplyQueueManager> <RequestQueue>GSTAR.ICS.DP.DHIPO211.REQUEST</RequestQueue> <ReplyQueue>ICS.DP.REPLY</ReplyQueue> </QueueDetails> </SORRegion> <SORRegion name="CICDKBX1"> <ConsumerName name="MYCA"> <AutomationIds> <PreAutoId> <AutomationId>XA1146A</AutomationId> <AutomationId>XA1146A</AutomationId> </PreAutoId> <DefaultAutoId> <AutomationId>XA1146A</AutomationId> </DefaultAutoId> </AutomationIds> </ConsumerName> <QueueDetails> <QueueManager>MAO1</QueueManager> <ReplyQueueManager>MAO1</ReplyQueueManager> <RequestQueue>GSTAR.ICS.DP.DHIPO211.REQUEST</RequestQueue> <ReplyQueue>ICS.DP.REPLY</ReplyQueue> </QueueDetails> </SORRegion> <SORRegion name="CICDKAX4"> <ConsumerName name="MYCA"> <AutomationIds> <PreAutoId> <AutomationId>XA1146A</AutomationId> <AutomationId>XA1146A</AutomationId> </PreAutoId> <DefaultAutoId> <AutomationId>XA1146A</AutomationId> </DefaultAutoId> </AutomationIds> </ConsumerName> <QueueDetails> <QueueManager>MAO1</QueueManager> <ReplyQueueManager>MAO1</ReplyQueueManager> <RequestQueue>GSTAR.GDAS.DHIPO204.REQUEST</RequestQueue> <ReplyQueue>ICS.DP.REPLY</ReplyQueue> </QueueDetails> </SORRegion> <SORRegion name="CICDKEX7"> <ConsumerName name="MYCA"> <AutomationIds> <PreAutoId> <AutomationId>XA1146A</AutomationId> <AutomationId>XA1146A</AutomationId> </PreAutoId> <DefaultAutoId> <AutomationId>XA1146A</AutomationId> </DefaultAutoId> </AutomationIds> </ConsumerName> <QueueDetails> <QueueManager>MAO1</QueueManager> <ReplyQueueManager>MAO1</ReplyQueueManager> <RequestQueue>GSTAR.ICS.DP.DHIPO247.REQUEST</RequestQueue> <ReplyQueue>ICS.DP.REPLY</ReplyQueue> </QueueDetails> </SORRegion> </CountryCode> <CountryCode Ctrycd="826"> <SORRegion name="Test"> <ConsumerName name="MYCA"> <AutomationIds> <PreAutoId> <AutomationId>XA1146A</AutomationId> <AutomationId>XA1146A</AutomationId> </PreAutoId> <DefaultAutoId> <AutomationId>XA1146A</AutomationId> </DefaultAutoId> </AutomationIds> </ConsumerName> <QueueDetails> <QueueManager>MAO1</QueueManager> <ReplyQueueManager>MAO1</ReplyQueueManager> <RequestQueue>GSTAR.ICS.DP.DHIPO211.REQUEST</RequestQueue> <ReplyQueue>ICS.DP.REPLY</ReplyQueue> </QueueDetails> </SORRegion> <SORRegion name="default"> <ConsumerName name="MYCA"> <AutomationIds> <PreAutoId> <AutomationId>XA1146A</AutomationId> <AutomationId>XA1146A</AutomationId> </PreAutoId> <DefaultAutoId> <AutomationId>XA1146A</AutomationId> </DefaultAutoId> </AutomationIds> </ConsumerName> <QueueDetails> <QueueManager>MAO1</QueueManager> <ReplyQueueManager>MAO1</ReplyQueueManager> <RequestQueue>GSTAR.ICS.DP.DHIPO211.REQUEST</RequestQueue> <ReplyQueue>ICS.DP.REPLY</ReplyQueue> </QueueDetails> </SORRegion> <SORRegion name="CICDKBX1"> <ConsumerName name="MYCA"> <AutomationIds> <PreAutoId> <AutomationId>XA1146A</AutomationId> <AutomationId>XA1146A</AutomationId> </PreAutoId> <DefaultAutoId> <AutomationId>XA1146A</AutomationId> </DefaultAutoId> </AutomationIds> </ConsumerName> <QueueDetails> <QueueManager>MAO1</QueueManager> <ReplyQueueManager>MAO1</ReplyQueueManager> <RequestQueue>GSTAR.ICS.DP.DHIPO211.REQUEST</RequestQueue> <ReplyQueue>ICS.DP.REPLY</ReplyQueue> </QueueDetails> </SORRegion> <SORRegion name="CICDKAX4"> <ConsumerName name="MYCA"> <AutomationIds> <PreAutoId> <AutomationId>XA1146A</AutomationId> <AutomationId>XA1146A</AutomationId> </PreAutoId> <DefaultAutoId> <AutomationId>XA1146A</AutomationId> </DefaultAutoId> </AutomationIds> </ConsumerName> <QueueDetails> <QueueManager>MAO1</QueueManager> <ReplyQueueManager>MAO1</ReplyQueueManager> <RequestQueue>GSTAR.GDAS.DHIPO204.REQUEST</RequestQueue> <ReplyQueue>ICS.DP.REPLY</ReplyQueue> </QueueDetails> </SORRegion> <SORRegion name="CICDKEX7"> <ConsumerName name="MYCA"> <AutomationIds> <PreAutoId> <AutomationId>XA1146A</AutomationId> <AutomationId>XA1146A</AutomationId> </PreAutoId> <DefaultAutoId> <AutomationId>XA1146A</AutomationId> </DefaultAutoId> </AutomationIds> </ConsumerName> <QueueDetails> <QueueManager>MAO1</QueueManager> <ReplyQueueManager>MAO1</ReplyQueueManager> <RequestQueue>GSTAR.GDAS.DHIPO247.REQUEST</RequestQueue> <ReplyQueue>ICS.DP.REPLY</ReplyQueue> </QueueDetails> </SORRegion> </CountryCode> <CountryCode Ctrycd="724"> <SORRegion name="Test"> <ConsumerName name="MYCA"> <AutomationIds> <PreAutoId> <AutomationId>XA4248A</AutomationId> <AutomationId>XA1146A</AutomationId> </PreAutoId> <DefaultAutoId> <AutomationId>XA4248A</AutomationId> </DefaultAutoId> </AutomationIds> </ConsumerName> <QueueDetails> <QueueManager>MAO1</QueueManager> <ReplyQueueManager>MAO1</ReplyQueueManager> <RequestQueue>GSTAR.GDAS.DHIPO239.REQUEST</RequestQueue> <ReplyQueue>ICS.DP.REPLY</ReplyQueue> </QueueDetails> </SORRegion> <SORRegion name="default"> <ConsumerName name="MYCA"> <AutomationIds> <PreAutoId> <AutomationId>XA4248A</AutomationId> <AutomationId>XA1146A</AutomationId> </PreAutoId> <DefaultAutoId> <AutomationId>XA4248A</AutomationId> </DefaultAutoId> </AutomationIds> </ConsumerName> <QueueDetails> <QueueManager>MAO1</QueueManager> <ReplyQueueManager>MAO1</ReplyQueueManager> <RequestQueue>GSTAR.GDAS.DHIPO239.REQUEST</RequestQueue> <ReplyQueue>ICS.DP.REPLY</ReplyQueue> </QueueDetails> </SORRegion> <SORRegion name="CICDKBX1"> <ConsumerName name="MYCA"> <AutomationIds> <PreAutoId> <AutomationId>XA4248A</AutomationId> <AutomationId>XA1146A</AutomationId> </PreAutoId> <DefaultAutoId> <AutomationId>XA4248A</AutomationId> </DefaultAutoId> </AutomationIds> </ConsumerName> <QueueDetails> <QueueManager>MAO1</QueueManager> <ReplyQueueManager>MAO1</ReplyQueueManager> <RequestQueue>GSTAR.ICS.DP.DHIPO211.REQUEST</RequestQueue> <ReplyQueue>ICS.DP.REPLY</ReplyQueue> </QueueDetails> </SORRegion> <SORRegion name="CICDKAX4"> <ConsumerName name="MYCA"> <AutomationIds> <PreAutoId> <AutomationId>XA4248A</AutomationId> <AutomationId>XA1146A</AutomationId> </PreAutoId> <DefaultAutoId> <AutomationId>XA4248A</AutomationId> </DefaultAutoId> </AutomationIds> </ConsumerName> <QueueDetails> <QueueManager>MAO1</QueueManager> <ReplyQueueManager>MAO1</ReplyQueueManager> <RequestQueue>GSTAR.GDAS.DHIPO204.REQUEST</RequestQueue> <ReplyQueue>ICS.DP.REPLY</ReplyQueue> </QueueDetails> </SORRegion> <SORRegion name="CICDKEX7"> <ConsumerName name="MYCA"> <AutomationIds> <PreAutoId> <AutomationId>XA4248A</AutomationId> <AutomationId>XA1146A</AutomationId> </PreAutoId> <DefaultAutoId> <AutomationId>XA4248A</AutomationId> </DefaultAutoId> </AutomationIds> </ConsumerName> <QueueDetails> <QueueManager>MAO1</QueueManager> <ReplyQueueManager>MAO1</ReplyQueueManager> <RequestQueue>GSTAR.GDAS.DHIPO247.REQUEST</RequestQueue> <ReplyQueue>ICS.DP.REPLY</ReplyQueue> </QueueDetails> </SORRegion> </CountryCode> </SOR> </Service> </RoutingDetails>

  Read the article

• How to add some complex structure in multiple places in an XML file

  - by Guillaume

  I have an XML file which has many section like the one below: <Operations> <Action [some attributes ...]> [some complex content ...] </Action> <Action [some attributes ...]> [some complex content ...] </Action> </Operations> I have to add an <Action/> to every <Operations/>. It seems that an XSLT should be a good solution to this problem: <xsl:template match="Operations/Action[last()]"> <xsl:copy> <xsl:apply-templates select="@*|node()"/> </xsl:copy> <Action>[some complex content ...]</Action> </xsl:template> <xsl:template match="@*|node()"> <xsl:copy> <xsl:apply-templates select="@*|node()"/> </xsl:copy> </xsl:template> My problem is that the content of my <Action/> contains some xPath expressions. For example: <Action code="p_histo01"> <customScript languageCode="gel"> <gel:script xmlns:core="jelly:core" xmlns:gel="jelly:com.niku.union.gel.GELTagLibrary" xmlns:soap="jelly:com.niku.union.gel.SOAPTagLibrary" xmlns:soap-env="http://schemas.xmlsoap.org/soap/envelope/" xmlns:sql="jelly:sql" xmlns:x="jelly:xml" xmlns:xog="http://www.niku.com/xog" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"> <sql:param value="${gel_stepInstanceId}"/> </gel:script> </customScript> </Action> The ${gel_stepInstanceId} is interpreted by my XSLT but I would like it to be copied as-is. Is that possible? How?

  Read the article

• get values from table as key value pairs with jquery

  - by liz

  I have a table: <table class="datatable" id="hosprates"> <caption> hospitalization rates test</caption> <thead> <tr> <th scope="col">Funding Source</th> <th scope="col">Alameda County</th> <th scope="col">California</th> </tr> </thead> <tbody> <tr> <th scope="row">Medi-Cal</th> <td>34.3</td> <td>32.3</td> </tr> <tr> <th scope="row">Private</th> <td>32.2</td> <td>34.2</td> </tr> <tr> <th scope="row">Other</th> <td>22.7</td> <td>21.7</td> </tr> </tbody> </table> i want to retrieve column 1 and column 2 values per row as pairs that end up looking like this [funding,number],[funding,number] i did this so far, but when i alert it, it only shows [object, object]... var myfunding = $('#hosprates tbody tr').each(function(){ var funding = new Object(); funding.name = $('#hosprates tbody tr td:nth-child(1)').map(function() { return $(this).text().match(/\S+/)[0]; }).get(); funding.value= $('#hosprates tbody tr td:nth-child(2)').map(function() { return $(this).text().match(/\S+/)[0]; }).get(); }); alert (myfunding);

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Entity Framework looking for wrong column

  - by m.edmondson

  I'm brand new to the Entity Framework and trying to learn all it can offer. I'm currently working my way through the MVC Music Store tutorial which includes the following code: public ActionResult Browse(string genre) { // Retrieve Genre and its Associated Albums from database var genreModel = storeDB.Genres.Include("Albums") .Single(g => g.Name == genre); return View(genreModel); } as I'm working in VB I converted it like so: Function Browse(ByVal genre As String) As ActionResult 'Retrieve Genre and its Associated Albums from database Dim genreModel = storeDB.Genres.Include("Albums"). _ Single(Function(g) g.Name = genre) Return(View(genreModel)) End Function The problem is I'm getting the following exception: Invalid column name 'GenreGenreId'. Which I know is true, but I can't for the life of my work out where it's getting 'GenreGenreId' from. Probably a basic question but I'll appreciate any help in the right direction. As per requested here is the source for my classes: Album.vb Public Class Album Private _title As String Private _genre As Genre Private _AlbumId As Int32 Private _GenreId As Int32 Private _ArtistId As Int32 Private _Price As Decimal Private _AlbumArtUrl As String Public Property Title As String Get Return _title End Get Set(ByVal value As String) _title = value End Set End Property Public Property AlbumId As Int16 Get Return _AlbumId End Get Set(ByVal value As Int16) _AlbumId = value End Set End Property Public Property GenreId As Int16 Get Return _GenreId End Get Set(ByVal value As Int16) _GenreId = value End Set End Property Public Property ArtistId As Int16 Get Return _ArtistId End Get Set(ByVal value As Int16) _ArtistId = value End Set End Property Public Property AlbumArtUrl As String Get Return _AlbumArtUrl End Get Set(ByVal value As String) _AlbumArtUrl = value End Set End Property Public Property Price As Decimal Get Return _Price End Get Set(ByVal value As Decimal) _Price = value End Set End Property Public Property Genre As Genre Get Return _genre End Get Set(ByVal value As Genre) _genre = value End Set End Property End Class Genre.vb Public Class Genre Dim _genreId As Int32 Dim _Name As String Dim _Description As String Dim _Albums As List(Of Album) Public Property GenreId As Int32 Get Return _genreId End Get Set(ByVal value As Int32) _genreId = value End Set End Property Public Property Name As String Get Return _Name End Get Set(ByVal value As String) _Name = value End Set End Property Public Property Description As String Get Return _Description End Get Set(ByVal value As String) _Description = value End Set End Property Public Property Albums As List(Of Album) Get Return _Albums End Get Set(ByVal value As List(Of Album)) _Albums = value End Set End Property End Class MusicStoreEntities.vb Imports System.Data.Entity Namespace MvcApplication1 Public Class MusicStoreEntities Inherits DbContext Public Property Albums As DbSet(Of Album) Public Property Genres As DbSet(Of Genre) End Class End Namespace

  Read the article

• XPATH: multiple negations in for-each

  - by Peter

  I have the following simplified XML: <?xml version="1.0" encoding="UTF-8" ?> <MATMAS05> <IDOC BEGIN="1"> <E1MARAM SEGMENT="1"> <MSGFN>005</MSGFN> <MATNR>000000000000401436</MATNR> <E1MARCM SEGMENT="1"> <MSGFN>005</MSGFN> <WERKS>A120</WERKS> <MMSTA>01</MMSTA> </E1MARCM> <E1MVKEM SEGMENT="1"> <VKORG>0120</VKORG> <VMSTA>04</VMSTA> </E1MVKEM> </E1MARAM> </IDOC> </MATMAS05> If <WERKS>=A120 and <MMSTA> is NOT '01' or '02' or '03' OR if <VKORG>=0120 and <VMSTA> is NOT '01' or '02' or '03' then the <MATNR> should be mapped to the target XML. I came up with the following XSLT: <?xml version="1.0" encoding="UTF-8"?> <xsl:stylesheet xmlns:xsl="http://www.w3.org/1999/XSL/Transform" version="1.0"> <xsl:output encoding="UTF-8" method="xml" indent="yes"/> <xsl:template match="/*"> <xsl:for-each select="IDOC[(E1MARAM/E1MVKEM[VKORG='0120'][not(VMSTA='01' or VMSTA='02' or VMSTA='03')]) or (E1MARAM/E1MARCM[WERKS = 'A120'][not(MMSTA='01' or MMSTA='02' or MMSTA='03')])]"> <Item> <ITEM_CODE> <xsl:value-of select="E1MARAM/MATNR"/> </ITEM_CODE> </Item> </xsl:for-each> </xsl:template> </xsl:stylesheet> But if I apply that XSLT I get the following unwanted output (because <MMSTA>='01'): <?xml version="1.0" encoding="UTF-8"?> <Item> <ITEM_CODE>000000000000401436</ITEM_CODE> </Item> How can I solve this? I have tried around with that XPATH expression but I can't get the wanted result. What am I doing wrong in my XPATH? Thank you for any ideas with this. Best regards, Peter

  Read the article

• Problem while adding a new value to a hashtable when it is enumerated

  - by karthik

  `hi I am doing a simple synchronous socket programming,in which i employed twothreads one for accepting the client and put the socket object into a collection,other thread will loop through the collection and send message to each client through the socket object. the problem is 1.i connect to clients to the server and start send messages 2.now i want to connect a new client,while doing this i cant update the collection and add a new client to my hashtable.it raises an exception "collection modified .Enumeration operation may not execute" how to add a NEW value without having problems in a hashtable. private void Listen() { try { //lblStatus.Text = "Server Started Listening"; while (true) { Socket ReceiveSock = ServerSock.Accept(); //keys.Clear(); ConnectedClients = new ListViewItem(); ConnectedClients.Text = ReceiveSock.RemoteEndPoint.ToString(); ConnectedClients.SubItems.Add("Connected"); ConnectedList.Items.Add(ConnectedClients); ClientTable.Add(ReceiveSock.RemoteEndPoint.ToString(), ReceiveSock); //foreach (System.Collections.DictionaryEntry de in ClientTable) //{ // keys.Add(de.Key.ToString()); //} //ClientTab.Add( //keys.Add( } //lblStatus.Text = "Client Connected Successfully."; } catch (Exception ex) { MessageBox.Show(ex.Message); } } private void btn_receive_Click(object sender, EventArgs e) { Thread receiveThread = new Thread(new ThreadStart(Receive)); receiveThread.IsBackground = true; receiveThread.Start(); } private void Receive() { while (true) { //lblMsg.Text = ""; byte[] Byt = new byte[2048]; //ReceiveSock.Receive(Byt); lblMsg.Text = Encoding.ASCII.GetString(Byt); } } private void btn_Send_Click(object sender, EventArgs e) { Thread SendThread = new Thread(new ThreadStart(SendMsg)); SendThread.IsBackground = true; SendThread.Start(); } private void btnlist_Click(object sender, EventArgs e) { //Thread ListThread = new Thread(new ThreadStart(Configure)); //ListThread.IsBackground = true; //ListThread.Start(); } private void SendMsg() { while (true) { try { foreach (object SockObj in ClientTable.Keys) { byte[] Tosend = new byte[2048]; Socket s = (Socket)ClientTable[SockObj]; Tosend = Encoding.ASCII.GetBytes("FirstValue&" + GenerateRandom.Next(6, 10).ToString()); s.Send(Tosend); //ReceiveSock.Send(Tosend); Thread.Sleep(300); } } catch (Exception ex) { MessageBox.Show(ex.Message); } } }

  Read the article

• Using one data source across multiple views in Kendo UI SPA

  - by user3731783

  I am trying to build a Kendo UI SPA. I have two views. View 1 (appListView) shows Application Details in a grid and view 2 (activityView) will have a dropdown for application names and a grid that shows the activity for selected application As I am loading all the application details on the loading of view 1, I would like to re-use those details to populate the dropdown on view 2. Please see my code below. Everything works fine but when I go to View 2 it makes a call to the service again to get application details. I would like to use the existing data if it is already loaded and if the uses comes to view 2 directly then it should get application data also. I am not sure what I am missing in the code. View Markup: <script id="appListView" type="text/x-kendo-template"> <h3 data-bind="html: displayName"></h3> <div data-role="grid" data-editable="{'mode':'popup'}" data-bind="source: items" data-columns="[ {'field': 'Name'}, {'field': 'ContactEmail','title':'Contact Email'} ]"> </div> </script> <script id="" type="text\x-kendo-template"> <div> Activity for Application&nbsp;&nbsp; <input name="AppName" data-role="dropdownlist" data-source="appsModel.items" data-text-field="Name" data-value-field="Id" data-option-label="Choose an application name" style="width:250px;" /> </div> <div id="Activities" data-role="grid" data-bind="source: items" data-auto-bind="false" data-columns="[ {'field': 'Domain','title':'Domain'}, {'field': 'ActivityType','title':'Activity Type'} ]"> </div> </script> js with DataSource and View Model: //data sources var applications = new kendo.data.DataSource({ schema: { model: { id: "Id" } }, serverFiltering : true, transport: { read: { url: '/api/App', dataType: 'json', type:'GET' } } }); var activities = new kendo.data.DataSource({ schema: { model: { id: "Id" } }, transport: { read: { url: '/api/Activity', dataType: 'json', type: 'GET' }, parameterMap: function (data, type) { if (type == "read") { return 'appId=' + $("#AppName").val() ; } } } }); //Models var appsModel = kendo.observable({ items: applications, displayName: 'My Applications' }); var activityModel = kendo.observable({ items: activities, onAppChange: function(t){ $("#Activities").data("kendoGrid").dataSource.read(); }, dispayName: 'Application Activities' }); //views var layout = new kendo.Layout("layout-template"); var appListView = new kendo.View("appListView", { model: appsModel }); var activityView = new kendo.View("activityView", { model: activityModel }); Thank you for taking time to read this long question.

  Read the article

• Regular expression to convert ul to textindent and back, with a different attribute value for first

  - by chapmanio

  Hi, This is a related to a previous question I have asked here, see the link below for a brief description as to why I am trying to do this. Regular expression from font to span (size and colour) and back (VB.NET) Basically I need a regex replace function (or if this can be done in pure VB then that's fine) to convert all ul tags in a string to textindent tags, with a different attribute value for the first textindent tag. For example: <ul> <li>This is some text</li> <li>This is some more text</li> <li> <ul> <li>This is some indented text</li> <li>This is some more text</li> </ul> </li> <li>More text!</li> <li> <ul> <li>This is some indented text</li> <li>This is some more text</li> </ul> </li> <li>More text!</li> </ul> Will become: <textformat indent="0"> <li>This is some text</li> <li>This is some more text</li> <li> <textformat indent="20"> <li>This is some indented text</li> <li>This is some more text</li> </textformat> </li> <li>More text!</li> <li> <textformat indent="20"> <li>This is some indented text</li> <li>This is some more text</li> </textformat> </li> <li>More text!</li> </textformat> Basically I want the first ul tag to have no indenting, but all nested ul tags to have an indent of 20. I appreciate this is a strange request but hopefully that makes sense, please let me know if you have any questions. Thanks in advance.

  Read the article

• Android Multiple objects in SimpleAdapter

  - by Adam Sherratt

  I have a need (unless you can think of a better way) of passing multiple objects to a custom list adapter. I know that I'm barking up the wrong tree here, and would appreciate someone setting me on the right course! Thanks playlistadapter = new MyPlaylistAdapter(MyApplication.getAppContext(), songsList, retained_songsList, folderMode, R.layout.file_view, new String[] { "songTitle","songAlbum", "songPath" }, new int[] { R.id.checkTextView, R.id.text2, R.id.text3 }); And my adapter class: public class MyPlaylistAdapter extends SimpleAdapter{ private ArrayList <Song> songsList = new ArrayList<Song>(); private ArrayList <Song> retained_songsList = new ArrayList<Song>(); private ArrayList<Song> playlistcheck = new ArrayList<Song>(); private String folderMode; private String TAG = "AndroidMediaCenter"; public MyPlaylistAdapter(Context context,List<Song> SongsList, List<Song> Retained_songsList, String FolderMode,int resource, String[] from, int[] to) { super(context, null, resource, from, to); songsList.clear(); songsList.addAll(SongsList); Log.i(TAG, "MyPlayListAdapter Songslist = " + songsList.size()); retained_songsList.clear(); retained_songsList.addAll(Retained_songsList); folderMode = FolderMode; } public View getView(int position, View convertView, ViewGroup parent) { //PlayListViewHolder holder; CheckedTextView checkTextView; TextView text2; TextView text3; if (convertView == null) { LayoutInflater inflater = (LayoutInflater) MyApplication.getAppContext().getSystemService(Context.LAYOUT_INFLATER_SERVICE); //LayoutInflater inflater=getLayoutInflater(); convertView=inflater.inflate(R.layout.file_view, parent, false); //convertView.setBackgroundColor(0xFF00FF00 ); //holder = new PlayListViewHolder(); checkTextView = (CheckedTextView) convertView.findViewById(R.id.checkTextView); text2 = (TextView) convertView.findViewById(R.id.text2); text3 = (TextView) convertView.findViewById(R.id.text3); //convertView.setTag(holder); } else { //holder = (PlayListViewHolder) convertView.getTag(); } //put something into textviews String tracks = null; String tracks_Details = null; String trackspath = null; tracks = songsList.get(position).getSongTitle(); tracks_Details = songsList.get(position).getAlbum() + " (" + songsList.get(position).getArtist() + ")"; trackspath = songsList.get(position).getSongPath(); checkTextView = (CheckedTextView) convertView.findViewById(R.id.checkTextView); text2 = (TextView) convertView.findViewById(R.id.text2); text3 = (TextView) convertView.findViewById(R.id.text3); checkTextView.setText(tracks); if(folderMode.equals("Playlists")){ checkTextView.setBackgroundColor(Color.GREEN); checkTextView.setChecked(false); try { int listsize_rs = retained_songsList.size(); for (int j = 0; j<listsize_rs;j++){ if((retained_songsList.get(j).getSongPath()).equals(songsList.get(position).getSongPath())){ checkTextView.setBackgroundColor(Color.TRANSPARENT); //Need to check here whether the checkedtextview is ticked or not checkTextView.setChecked(true); playlistcheck.add(songsList.get(position)); break; } } } catch (Exception e) { e.printStackTrace(); } }else { //Need to check here whether the checkedtextview is ticked or not try { if (songsList.get(position).getSongCheckedStatus()==true){ checkTextView.setChecked(true); }else{ checkTextView.setChecked(false); } } catch (Exception e) { e.printStackTrace(); } } text2.setText(tracks_Details); text3.setText(trackspath); Log.i(TAG, "MyPlayListAdapter Songslist = " + songsList.size()); return convertView; } } However, this doesn't inflate, throwing the following errors: 10-26 23:11:09.464: E/AndroidRuntime(2826): FATAL EXCEPTION: main 10-26 23:11:09.464: E/AndroidRuntime(2826): java.lang.RuntimeException: Error receiving broadcast Intent { act=android.intent.action.GetMusicComplete flg=0x10 } in com.Nmidia.AMC.MusicActivity$18@414c5770 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.app.LoadedApk$ReceiverDispatcher$Args.run(LoadedApk.java:765) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.os.Handler.handleCallback(Handler.java:615) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.os.Handler.dispatchMessage(Handler.java:92) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.os.Looper.loop(Looper.java:137) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.app.ActivityThread.main(ActivityThread.java:4745) 10-26 23:11:09.464: E/AndroidRuntime(2826): at java.lang.reflect.Method.invokeNative(Native Method) 10-26 23:11:09.464: E/AndroidRuntime(2826): at java.lang.reflect.Method.invoke(Method.java:511) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:786) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:553) 10-26 23:11:09.464: E/AndroidRuntime(2826): at dalvik.system.NativeStart.main(Native Method) 10-26 23:11:09.464: E/AndroidRuntime(2826): Caused by: java.lang.NullPointerException 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.widget.SimpleAdapter.getCount(SimpleAdapter.java:93) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.widget.ListView.setAdapter(ListView.java:460) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.Nmidia.AMC.MusicActivity.setFilterMusic(MusicActivity.java:1230) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.Nmidia.AMC.MusicActivity$18.onReceive(MusicActivity.java:996) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.app.LoadedApk$ReceiverDispatcher$Args.run(LoadedApk.java:755) 10-26 23:11:09.464: E/AndroidRuntime(2826): ... 9 more

  Read the article

• Multiple instances of this carousel on a single page - can't get it to work

  - by Andy

  This code comes from a tutorial so it's not originally my own work. What I am trying to do is implement this several times on a single page. I have tried and so far failed - by numbering the id "carousel" and so forth. Any help would be seriously appreciated. I'm tearing my hair out. http://jsfiddle.net/AndyMP/zcKDV/5/ For completeness.. this is the carousel JQuery as it stands. //rotation speed and timer var speed = 5000; var run = setInterval('rotate()', speed); //grab the width and calculate left value var item_width = $('#slides li').outerWidth(); var left_value = item_width * (-1); //move the last item before first item, just in case user click prev button $('#slides li:first').before($('#slides li:last')); //set the default item to the correct position $('#slides ul').css({'left' : left_value}); //if user clicked on prev button $('#prev').click(function() { //get the right position var left_indent = parseInt($('#slides ul').css('left')) + item_width; //slide the item $('#slides ul').animate({'left' : left_indent}, 200,function(){ //move the last item and put it as first item $('#slides li:first').before($('#slides li:last')); //set the default item to correct position $('#slides ul').css({'left' : left_value}); }); //cancel the link behavior return false; }); //if user clicked on next button $('#next').click(function() { //get the right position var left_indent = parseInt($('#slides ul').css('left')) - item_width; //slide the item $('#slides ul').animate({'left' : left_indent}, 200, function () { //move the first item and put it as last item $('#slides li:last').after($('#slides li:first')); //set the default item to correct position $('#slides ul').css({'left' : left_value}); }); //cancel the link behavior return false; }); //if mouse hover, pause the auto rotation, otherwise rotate it $('#slides').hover( function() { clearInterval(run); }, function() { run = setInterval('rotate()', speed); } ); //a simple function to click next link //a timer will call this function, and the rotation will begin :) function rotate() { $('#next').click(); }

  Read the article

• Cross-site request forgery protections: Where do I put all these lines?

  - by brilliant

  Hello, I was looking for a python code that would be able to log in from "Google App Engine" to some of my accounts on some websites (like yahoo or eBay) and was given this code: import urllib, urllib2, cookielib url = "https://login.yahoo.com/config/login?" form_data = {'login' : 'my-login-here', 'passwd' : 'my-password-here'} jar = cookielib.CookieJar() opener = urllib2.build_opener(urllib2.HTTPCookieProcessor(jar)) form_data = urllib.urlencode(form_data) # data returned from this pages contains redirection resp = opener.open(url, form_data) # yahoo redirects to http://my.yahoo.com, so lets go there instead resp = opener.open('http://mail.yahoo.com') print resp.read() Unfortunately, this code didn't work, so I asked another question here and one supporter among other things said this: "You send MD5 hash and not plain password. Also you'd have to play along with all kinds of CSRF protections etc. that they're implementing. Look: <input type="hidden" name=".tries" value="1"> <input type="hidden" name=".src" value="ym"> <input type="hidden" name=".md5" value=""> <input type="hidden" name=".hash" value=""> <input type="hidden" name=".js" value=""> <input type="hidden" name=".last" value=""> <input type="hidden" name="promo" value=""> <input type="hidden" name=".intl" value="us"> <input type="hidden" name=".bypass" value=""> <input type="hidden" name=".partner" value=""> <input type="hidden" name=".u" value="bd5tdpd5rf2pg"> <input type="hidden" name=".v" value="0"> <input type="hidden" name=".challenge" value="5qUiIPGVFzRZ2BHhvtdGXoehfiOj"> <input type="hidden" name=".yplus" value=""> <input type="hidden" name=".emailCode" value=""> <input type="hidden" name="pkg" value=""> <input type="hidden" name="stepid" value=""> <input type="hidden" name=".ev" value=""> <input type="hidden" name="hasMsgr" value="0"> <input type="hidden" name=".chkP" value="Y"> <input type="hidden" name=".done" value="http://mail.yahoo.com"> <input type="hidden" name=".pd" value="ym_ver=0&c=&ivt=&sg="> I am not quite sure where he got all these lines from and where in my code I am supposed to add them. Do You have any idea? I know I was supposed to ask him this question first, and I did, but he never returned, so I decided to ask a separate question here.

  Read the article

• Multiple word Auttosuggest using Lucene.Net

  - by eric

  I am currently working on an search application which uses Lucene.Net to index the data from the database to Index file. I have a product catalog which has Name, short and long description, sku and other fields. The data is stored in Index using StandardAnalyzer. I am trying to add auto suggestion for a text field and using TermEnum to get all the keyword terms and its score from the Index. But the terms returned are of single term. For example, if I type for co, the suggestion returned are costume, count, collection, cowboy, combination etc. But I want the suggestion to return phrases. For exmaple, if I search for co, the suggestions should be cowboy costume, costume for adults, combination locks etc. The following is the code used to get the suggestions: public string[] GetKeywords(string strSearchExp) { IndexReader rd = IndexReader.Open(mIndexLoc); TermEnum tenum = rd.Terms(new Term("Name", strSearchExp)); string[] strResult = new string[10]; int i = 0; Dictionary<string, double> KeywordList = new Dictionary<string, double>(); do { //terms = tenum.Term(); if (tenum.Term() != null) { //strResult[i] = terms.text.ToString(); KeywordList.Add(tenum.Term().text.ToString(), tenum.DocFreq()); } } while (tenum.Next() && tenum.Term().text.StartsWith(strSearchExp) && tenum.Term().text.Length > 1); var sortedDict = (from entry in KeywordList orderby entry.Value descending select entry); foreach (KeyValuePair<string, double> data in sortedDict) { if (data.Key.Length > 1) { strResult[i] = data.Key; i++; } if (i >= 10) //Exit the for Loop if the count exceeds 10 break; } tenum.Close(); rd.Close(); return strResult; } Can anyone please give me directions to achive this? Thanks for looking into this.

  Read the article

• How can I use curl to login multiple users from one php script

  - by kamal

  Here is the scenario: I have configured multiple users with login names aa1, aa2 .. zz99 , all with the same password, now i want to login to a php based server with these login ID's. I have a working script that logs in one user with a username and password, and using curl, browses to a target page: // Assume php , since somehow the php encapsulation quotes were giving me trouble $sHost = $argv[2]; $sStart = $argv[3]; $sReqId = $argv[4]; $sPage = $argv[5]; $sReqLogFile = $argv[6]; $sRespLogFile = $argv[7]; $sUserName = $argv[8]; $sPassword = $argv[9]; $sExecDelay = $argv[10]; //optional args: if($argc 11) { $sCommonSID = $argv[11]; } //$sXhprofLogFile = ""; $sSysStatsLogFile= ""; $sBaseUrl = 'https://'.$sHost.'/'; $nExecTime = 0; $sCookieFileName = 'cookiejar/'.genRandomString().'.txt'; touch($sCookieFileName); // Set the execution delay: $sStart += $sExecDelay; // Get the PHP Session Id: if(isset($sCommonSID)) { $sSID = $sCommonSID; }else{ $sSID = getSID($sHost,$sBaseUrl, $sUserName, $sPassword); } // Sleep for 100us intervals until we reach the stated execution time: do { usleep(100); }while(getFullMicrotime()$sPage, "pageUrl"=$sBaseUrl, "execStart" =$nExecStart, "execEnd"=$nExecEnd, "respTime"=$nExecTime, "xhprofToken"=$sXhpToken, "xhprofLink"=$sXhpLink, "fiveMinLoad"=$nFiveMinLoad); }else{ $nExecStart = 0; $sUrl = "***ERROR***"; $aReturn = null; } writeReqLog($sReqId, $nExecStart, $sSID, $sUrl, $sReqLogFile); return $aReturn; } function getFullMicrotime() { $fMtime = microtime(true); if(strpos($fMtime, ' ') !== false) { list($nUsec, $nSec) = explode(' ', $fMtime); return $nSec + $nUsec; } return $fMtime; } function writeRespLog($nReqId, $sHost, $sPage, $sSID = "***ERROR***", $nExecStart = 0, $nExecEnd = 0, $nRespTime = 0, $sXhpToken = "", $sXhpLink = "", $nFiveMinLoad = 0, $sRespLogFile) { $sMsg = $nReqId; $sMsg .= "\t".$sHost; $sMsg .= "/".$sPage; $sMsg .= "\t".$sSID; $sMsg .= "\t".$nExecStart; $sMsg .= "\t".$nExecEnd; $sMsg .= "\t".$nRespTime; $sMsg .= "\t".$sXhpToken; $sMsg .= "\t".$nFiveMinLoad; error_log($sMsg."\n",3,$sRespLogFile); } function writeReqLog($nReqId, $nExecStart, $sSID, $sUrl, $sReqLogFile) { $sMsg = $nReqId; $sMsg .= "\t".$sUrl; $sMsg .= "\t".$sSID; $sMsg .= "\t".$nExecStart; error_log($sMsg."\n",3,$sReqLogFile); } function parseSIDValue($sText) { $sSID = ""; preg_match('/SID:(.*)/',$sText, $aSID); if (count($aSID)) { $sSID = $aSID[1]; } return $sSID; } function parseFiveMinLoad($sText) { $nLoad = 0; $aMatch = array(); preg_match('/--5-MIN-LOAD:(.*)--/',$sText, $aMatch); if (count($aMatch)) { $nLoad = $aMatch[1]; } return $nLoad; } function curlRequest($sUrl, $sSID="") { global $sCookieFileName; $ch = curl_init(); curl_setopt($ch, CURLOPT_URL, $sUrl); curl_setopt($ch, CURLOPT_SSL_VERIFYPEER, FALSE); curl_setopt($ch, CURLOPT_SSL_VERIFYHOST, 2); curl_setopt($ch, CURLOPT_HEADER, 1); curl_setopt($ch, CURLOPT_USERAGENT, "Mozilla/4.0 (compatible; MSIE 6.0; Windows NT 5.0)"); curl_setopt($ch, CURLOPT_RETURNTRANSFER,1); if($sSID == "") { curl_setopt($ch, CURLOPT_COOKIEJAR, $sCookieFileName); } else { curl_setopt($ch, CURLOPT_COOKIEFILE, $sCookieFileName); } $result =curl_exec ($ch); curl_close ($ch); return $result; } function parseXHProfToken($sPageContent) { //https://ktest.server.net/xhprof/xhprof_html/index.php?run=4d004b280a990&source=mybox $sToken = ""; $sRelLink = ""; $aMatch = array(); $aResp = array(); preg_match('/$sToken, "relLink"=$sRelLink); return $aResp; } function genRandomString() { $length = 10; $characters = '0123456789abcdefghijklmnopqrstuvwxyz'; $string = ''; for ($p = 0; $p

  Read the article

• Get Confirm value in vb.net

  - by user1805641

  I have a hidden asp Button in a Repeater. In the VB.NET code behind I use the Rerpeater_ItemCommand to get the click event within the Repeater. There's a check if user is already recording a project. If yes and he wants to start a new one, a confirm box should appear asking "Are you sure?" How can I access the click value from confirm? <asp:Repeater ID="Repeater1" runat="server" OnItemCommand="Repeater1_ItemCommand"> <ItemTemplate> <div class="tile user_view user_<%# Eval("employeeName") %>"> <div class="tilesheight"></div> <div class="element"> <asp:Button ID="Button1" CssClass="hiddenbutton" runat="server" /> Index: <asp:Label ID="Label1" runat="server" Text='<%# Eval("index") %>' /><br /> <hr class="hr" /> customer: <asp:Label ID="CustomerLabel" runat="server" Text='<%# Eval("customer") %>' /><br /> <hr class ="hr" /> order: <asp:Label ID="OrderNoLabel" runat="server" Text='<%# Eval("orderNo") %>' /><br /> <asp:Label ID="DescriptionLabel" runat="server" Text='<%# Eval("description") %>' /><br /> <hr class="hr" /> </div> </div> </ItemTemplate> </asp:Repeater> code behind: If empRecs.Contains(projects.Item(index.Text).employeeID) Then 'Catch index of recording order i = empRecs.IndexOf(projects.Item(index.Text).employeeID) Page.ClientScript.RegisterStartupScript(Me.GetType, "confirm", "confirm('Order " & empRecs(i + 2) & " already recording. Would you like to start a new one?')",True) 'If users clicks ok insertData() End If Other solutions are using the Click Event and a hidden field. But the problem is, I don't want the confirmbox to appear every time the button is clicked. Only when empRecs conatins an employee. Thanks for helping

  Read the article

• Swing: does DefaultBoundedRangeModel coalesce multiple events?

  - by Jason S

  I have a JProgressBar displaying a BoundedRangeModel which is extremely fine grained and I was concerned that updating it too often would slow down my computer. So I wrote a quick test program (see below) which has a 10Hz timer but each timer tick makes 10,000 calls to microtick() which in turn increments the BoundedRangeModel. Yet it seems to play nicely with a JProgressBar; my CPU is not working hard to run the program. How does JProgressBar or DefaultBoundedRangeModel do this? They seem to be smart about how much work it does to update the JProgressBar, so that as a user I don't have to worry about updating the BoundedRangeModel's value. package com.example.test.gui; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import javax.swing.BoundedRangeModel; import javax.swing.DefaultBoundedRangeModel; import javax.swing.JFrame; import javax.swing.JPanel; import javax.swing.JProgressBar; import javax.swing.Timer; public class BoundedRangeModelTest1 extends JFrame { final private BoundedRangeModel brm = new DefaultBoundedRangeModel(); final private Timer timer = new Timer(100, new ActionListener() { @Override public void actionPerformed(ActionEvent arg0) { tick(); } }); public BoundedRangeModelTest1(String title) { super(title); JPanel p = new JPanel(); p.add(new JProgressBar(this.brm)); getContentPane().add(p); this.brm.setMaximum(1000000); this.brm.setMinimum(0); this.brm.setValue(0); } protected void tick() { for (int i = 0; i < 10000; ++i) { microtick(); } } private void microtick() { this.brm.setValue(this.brm.getValue()+1); } public void start() { this.timer.start(); } static public void main(String[] args) { BoundedRangeModelTest1 f = new BoundedRangeModelTest1("BoundedRangeModelTest1"); f.pack(); f.setVisible(true); f.setDefaultCloseOperation(EXIT_ON_CLOSE); f.start(); } }

  Read the article

• Changing multiple objects with a new class name using Jquery

  - by liquilife

  I'd like to click on a trigger and show a specific image. There are multiple triggers which would show a specific image related to it within a set. There are 4 sets The challenge for me is toggling the other images to hide only in this 'set' when one of these triggers are clicked, as there can only be one image showing at a time in each set. Here is the HTML I've put together thus far: <!-- Thumbnails which can be clicked on to toggle the larger preview image --> <div class="materials"> <a href="javascript:;" id="shirtgrey"><img src="/grey_shirt.png" height="122" width="122" /></a> <a href="javascript:;" id="shirtred"><img src="red_shirt.png" height="122" width="122" /></a> <a href="javascript:;" id="shirtblue"><img src="hblue_shirt.png" height="122" width="122" /></a> <a href="javascript:;" id="shirtgreen"><img src="green_shirt.png" height="122" width="122" /></a> </div> <div class="collars"> <a href="javascript:;" id="collargrey"><img src="grey_collar.png" height="122" width="122" /></a> <a href="javascript:;" id="collarred"><img src="red_collar.png" height="122" width="122" /></a> <a href="javascript:;" id="collarblue"><img src="blue_collar.png" height="122" width="122" /></a> <a href="javascript:;" id="collargreen"><img src="green_collar.png" height="122" width="122" /></a> </div> <div class="cuffs"> <a href="javascript:;" id="cuffgrey"><img src="grey_cuff.png" height="122" width="122" /></a> <a href="javascript:;" id="cuffred"><img src="red_cuff.png" height="122" width="122" /></a> <a href="javascript:;" id="cuffblue"><img src="blue_cuff.png" height="122" width="122" /></a> <a href="javascript:;" id="cuffgreen"><img src="/green_cuff.png" height="122" width="122" /></a> </div> <div class="pockets"> <a href="javascript:;" id="pocketgrey"><img src="grey_pocket.png" height="122" width="122" /></a> <a href="javascript:;" id="pocketred"><img src=".png" height="122" width="122" /></a> <a href="javascript:;" id="pocketblue"><img src="blue_pocket.png" height="122" width="122" /></a> <a href="javascript:;" id="pocketgreen"><img src="green_pocket.png" height="122" width="122" /></a> </div> <!-- The larger images where one from each set should be viewable at one time, triggered by the thumb clicked above --> <div class="selectionimg"> <div class="selectShirt"> <img src="grey_shirt.png" height="250" width="250" class="selectShirtGrey show" /> <img src="red_shirt.png" height="250" width="250" class="selectShirtRed hide" /> <img src="blue_shirt.png" height="250" width="250" class="selectShirtBlue hide" /> <img src="green_shirt.png" height="250" width="250" class="selectShirtGreen hide" /> </div> <div class="selectCollar"> <img src="grey_collar.png" height="250" width="250" class="selectCollarGrey show" /> <img src="red_collar.png" height="250" width="250" class="selectCollarRed hide" /> <img src="blue_collar.png" height="250" width="250" class="selectCollarBlue hide" /> <img src="green_collar.png" height="250" width="250" class="selectCollarGreen hide" /> </div> <div class="selectCuff"> <img src="grey_cuff.png" height="250" width="250" class="selectCuffGrey show" /> <img src="red_cuff.png" height="250" width="250" class="selectCuffRed hide" /> <img src="blue_cuff.png" height="250" width="250" class="selectCuffBlue hide" /> <img src="green_cuff.png" height="250" width="250" class="selectCuffGreen hide" /> </div> <div class="selectPocket"> <img src="grey_pocket.png" height="250" width="250" class="selectPocketGrey show" /> <img src="hred_pocket.png" height="250" width="250" class="selectPocketRed hide" /> <img src="blue_pocket.png" height="250" width="250" class="selectPocketBlue hide" /> <img src="green_pocket.png" height="250" width="250" class="selectPocketGreen hide" /> </div> </div> How can jQuery be used to change a class of an image to "show" and ensure that all other images in that same div are set to a class of "hide"? First time posting here. I'm very efficient with HTML and CSS and have a basic understanding of jQuery. I'm learning and this just seems a little bit beyond my abilities at the moment. I hope this all makes sense. Thanks for any help.

  Read the article

• Unexpected return value

  - by Nicholas Gibson

  Program stopped compiling at this point: What is causing this error? (Error is at the bottom of post) public class JFrameWithPanel extends JFrame implements ActionListener, ItemListener { int packageIndex; double price; double[] prices = {49.99, 39.99, 34.99, 99.99}; DecimalFormat money = new DecimalFormat("$0.00"); JLabel priceLabel = new JLabel("Total Price: "+price); JButton button = new JButton("Check Price"); JComboBox packageChoice = new JComboBox(); JPanel pane = new JPanel(); TextField text = new TextField(5); JButton accept = new JButton("Accept"); JButton decline = new JButton("Decline"); JCheckBox serviceTerms = new JCheckBox("I Agree to the Terms of Service.", false); JTextArea termsOfService = new JTextArea("This is a text area", 5, 10); public JFrameWithPanel() { super("JFrame with Panel"); setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); pane.add(packageChoice); setContentPane(pane); setSize(250,250); setVisible(true); packageChoice.addItem("A+ Certification"); packageChoice.addItem("Network+ Certification "); packageChoice.addItem("Security+ Certifictation"); packageChoice.addItem("CIT Full Test Package"); pane.add(button); button.addActionListener(this); pane.add(text); text.setEditable(false); text.setBackground(Color.WHITE); text.addActionListener(this); pane.add(termsOfService); termsOfService.setEditable(false); termsOfService.setBackground(Color.lightGray); pane.add(serviceTerms); serviceTerms.addItemListener(this); pane.add(accept); accept.addActionListener(this); pane.add(decline); decline.addActionListener(this); } public void actionPerformed(ActionEvent e) { packageIndex = packageChoice.getSelectedIndex(); price = prices[packageIndex]; text.setText("$"+price); Object source = e.getSource(); if(source == accept) { if(serviceTerms.isSelected() = false) // line 79 { JOptionPane.showMessageDialog(null,"Please accept the terms of service."); } else { JOptionPane.showMessageDialog(null,"Thanks."); } } } Error: \Desktop\Java Programming\JFrameWithPanel.java:79: unexpected type required: variable found : value if(serviceTerms.isSelected() = false) ^ 1 error

  Read the article

• c++ setting string attribute value in class is throwing "Access violation reading location"

  - by user259789

  I am having some trouble getting this simple code to work: class CreateUserView { public: CreateUserView(void); ~CreateUserView(void); UserController* controller; void showView(); string name; string lastname; string address; string email; string dateOfBirth; }; All i need is to set these attributes in the implementation with getline(). CreateUserView::CreateUserView(void) { } void CreateUserView::showView() { cout << endl << " New User" << endl; cout << "--------------------------" << endl; cout << " Name\t\t: "; getline(cin, name); cout << " Lastname\t: "; getline(cin, lastname); cout << " Email\t\t: "; getline(cin, email); cout << " ===============================" << endl; cout << " 1. SAVE 2.CHANGE 3.CANCEL" << endl; cout << " ===============================" << endl; cout << " choice: "; int choice; cin >> choice; cin.ignore(); controller->createUser_choice(choice); } I keep getting this "Access violation reading location" error at this line: getline(cin, name); what's the best way of assigning a value to an std::string attribute of a class? even name = "whatever" is throwing that error!! thanks

  Read the article

• get return value from 2 threads in C

  - by polslinux

  #include <stdio.h> #include <stdlib.h> #include <pthread.h> #include <stdint.h> #include <inttypes.h> typedef struct tmp_num{ int tmp_1; int tmp_2; }t_num; t_num t_nums; void *num_mezzo_1(void *num_orig); void *num_mezzo_2(void *num_orig); int main(int argc, char *argv[]){ pthread_t thread1, thread2; int tmp=0,rc1,rc2,num; num=atoi(argv[1]); if(num <= 3){ printf("Questo è un numero primo: %d\n", num); exit(0); } if( (rc1=pthread_create( &thread1, NULL, &num_mezzo_1, (void *)&num)) ){ printf("Creazione del thread fallita: %d\n", rc1); exit(1); } if( (rc2=pthread_create( &thread2, NULL, &num_mezzo_2, (void *)&num)) ){ printf("Creazione del thread fallita: %d\n", rc2); exit(1); } t_nums.tmp_1 = 0; t_nums.tmp_2 = 0; pthread_join(thread1, (void **)(&t_nums.tmp_1)); pthread_join(thread2, (void **)(&t_nums.tmp_2)); tmp=t_nums.tmp_1+t_nums.tmp_2; printf("%d %d %d\n", tmp, t_nums.tmp_1, t_nums.tmp_2); if(tmp>2){ printf("Questo NON è un numero primo: %d\n", num); } else{ printf("Questo è un numero primo: %d\n", num); } exit(0); } void *num_mezzo_1(void *num_orig){ int cont_1; int *n_orig=(int *)num_orig; t_nums.tmp_1 = 0; for(cont_1=1; cont_1<=(*n_orig/2); cont_1++){ if((*n_orig % cont_1) == 0){ (t_nums.tmp_1)++; } } pthread_exit((void *)(&t_nums.tmp_1)); return NULL; } void *num_mezzo_2(void *num_orig){ int cont_2; int *n_orig=(int *)num_orig; t_nums.tmp_2 = 0; for(cont_2=((*n_orig/2)+1); cont_2<=*n_orig; cont_2++){ if((*n_orig % cont_2) == 0){ (t_nums.tmp_2)++; } } pthread_exit((void *)(&t_nums.tmp_2)); return NULL; } How this program works: i have to input a number and this program will calculate if it is a prime number or not (i know that it is a bad algorithm but i only need to learn pthread). The problem is that the returned values are too much big.For example if i write "12" the value of tmp tmp_1 tmp_2 into the main are 12590412 6295204 6295208.Why i got those numbers??

  Read the article

• Silverlight: Binding to a LayoutRoot value from within a DataTemplate

  - by Rosarch

  I have a DataTemplate for a ListBox, where I have several controls that bind to an item. I would also like to bind to a value on LayoutRoot.DataContext. I'm unsure of how to do this. <!--LayoutRoot is the root grid where all page content is placed--> <StackPanel x:Name="LayoutRoot" Background="Transparent"> <ListBox ItemsSource="{Binding Items}"> <ListBox.ItemTemplate> <DataTemplate> <StackPanel> <TextBlock Text="{Binding}" /> <TextBlock Text="{Binding ElementName=LayoutRoot, Path=DataContext.Foo}" /> </StackPanel> </DataTemplate> </ListBox.ItemTemplate> </ListBox> </StackPanel> public partial class MainPage : PhoneApplicationPage { public string Foo { get { return "the moon"; } } private int startIndex = 1; private IList<string> _data = new List<string>() { "foo", "bar", "baz" }; public IList<string> Items { get { return _data; } } // Constructor public MainPage() { InitializeComponent(); LayoutRoot.DataContext = this; } } This doesn't work; only the _data items are displayed. The following binding errors appear in the Debug output: System.Windows.Data Error: BindingExpression path error: 'Foo' property not found on 'foo' 'System.String' (HashCode=1502598398). BindingExpression: Path='DataContext.Foo' DataItem='System.Windows.Controls.Border' (HashCode=78299055); target element is 'System.Windows.Controls.TextBlock' (Name=''); target property is 'Text' (type 'System.String').. System.Windows.Data Error: BindingExpression path error: 'Foo' property not found on 'bar' 'System.String' (HashCode=696029481). BindingExpression: Path='DataContext.Foo' DataItem='System.Windows.Controls.Border' (HashCode=78298703); target element is 'System.Windows.Controls.TextBlock' (Name=''); target property is 'Text' (type 'System.String').. System.Windows.Data Error: BindingExpression path error: 'Foo' property not found on 'baz' 'System.String' (HashCode=696029489). BindingExpression: Path='DataContext.Foo' DataItem='System.Windows.Controls.Border' (HashCode=78298694); target element is 'System.Windows.Controls.TextBlock' (Name=''); target property is 'Text' (type 'System.String').. Do I have a syntax error somewhere? Update I'm aiming for something that looks like this: foo the moon bar the moon baz the moon Instead, all I'm getting is: foo bar baz

  Read the article

• How to find an specific key/value (property list)

  - by Bob Rivers

  Hi, I'm learning cocoa/objective-c. Right now I'm dealing with key/value coding. After reading Aaron's book and other sources, I thought that I was able to left the simple examples and try a complex one... I'm trying read iTunes property list (iTunes Music Library.xml). I would like to retrieve the tracks held by an specific playlist. Probably everybody knows it, but bellow I put a piece of the xml: <plist version="1.0"> <dict> <key>Major Version</key><integer>1</integer> ... <key>Playlists</key> <array> <dict> <key>Name</key><string>Library</string> ... <key>Playlist Items</key> <array> <dict> <key>Track ID</key><integer>10281</integer> </dict> ... </array> </dict> <dict> ... </dict> </array> </dict> </plist> As you can see, the playlists are stored as dictionaries inside an array, and the key that identifies it is inside it, not as a <key> preceding it. The problem is that I'm not able to figure out how to search for a key that is inside another one. With the following code I can find the the array in which the playlists are stored, but how to find an specific <dict>? NSDictionary *rootDict = [[NSDictionary alloc] initWithContentsOfFile:file]; NSArray *playlists = [rootDict objectForKey:@"Playlists"]; Here at Stackoverflow I found this post, but I'm not sure if iterate over the array and test it is a good idea. I'm quite sure that I could use valueForKeyPath, but I'm unable to figure out how to do it. Any help is welcome. TIA, Bob

  Read the article

• glReadPixels() returning non-accurate value

  - by max

  I'm trying to implement the flood fill algorithm. But glReadPixels() is returning float RGB values of a pixel which are slightly different from the actual value set by me, causing the algorithm to fail. Why is this happening? Outputting returned RGB values to check. #include<iostream> #include<GL/glut.h> using namespace std; float boundaryColor[3]={0,0,0}, interiorColor[3]={0,0,0.5}, fillColor[3]={1,0,0}; float readPixel[3]; void init(void) { glClearColor(0,0,0.5,0); glMatrixMode(GL_PROJECTION); gluOrtho2D(0,500,0,500); } void setPixel(int x,int y) { glColor3fv(fillColor); glBegin(GL_POINTS); glVertex2f(x,y); glEnd(); } void getPixel(int x, int y, float *color) { glReadPixels(x,y,1,1,GL_RGB,GL_FLOAT,color); } void floodFill(int x,int y) { getPixel(x,y,readPixel); //outputting values here to check cout<<readPixel[0]<<endl; cout<<readPixel[1]<<endl; cout<<readPixel[2]<<endl; if( readPixel[0]==interiorColor[0] && readPixel[1]==interiorColor[1] && readPixel[2]==interiorColor[2] ) { setPixel(x,y); floodFill(x+1,y); floodFill(x,y+1); floodFill(x-1,y); floodFill(x,y-1); } } void display() { glClear(GL_COLOR_BUFFER_BIT); glColor3fv(boundaryColor); glLineWidth(3); glBegin(GL_LINE_STRIP); glVertex2i(150,150); glVertex2i(150,350); glVertex2i(350,350); glVertex2i(350,150); glVertex2i(150,150); glEnd(); floodFill(200,200); glFlush(); } int main(int argc,char** argv) { glutInit(&argc,argv); glutInitDisplayMode(GLUT_SINGLE | GLUT_RGB); glutInitWindowPosition(100,100); glutInitWindowSize(500,500); glutCreateWindow("Flood fill"); init(); glutDisplayFunc(display); glutMainLoop(); }

  Read the article

• WPF Templates error - "Provide value on 'System.Windows.Baml2006.TypeConverterMarkupExtension' threw

  - by jasonk

  I've just started experimenting with WPF templates vs. styles and I'm not sure what I'm doing wrong. The goal below is to alternate the colors of the options in the menu. The code works fine with just the , but when I copy and paste/rename it for the second segment of "MenuChoiceOdd" I get the following error: Provide value on 'System.Windows.Baml2006.TypeConverterMarkupExtension' threw an exception. Sample of the code: <Window x:Class="WpfApplication1.Template_Testing" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" Title="Template_Testing" Height="300" Width="300"> <Grid> <Grid.Resources> <ControlTemplate x:Key="MenuChoiceEven"> <Border BorderThickness="1" BorderBrush="#FF4A5D80"> <TextBlock Height="Auto" HorizontalAlignment="Stretch" Margin="0" Width="Auto" FontSize="14" Foreground="SlateGray" TextAlignment="Left" AllowDrop="True" Text="{Binding Path=Content, RelativeSource={RelativeSource TemplatedParent}}"> <TextBlock.Background> <LinearGradientBrush EndPoint="0.5,1" StartPoint="0.5,0"> <GradientStop Color="White" Offset="0" /> <GradientStop Color="#FFC2CCDB" Offset="1" /> </LinearGradientBrush> </TextBlock.Background> </TextBlock> </Border> </ControlTemplate> <ControlTemplate x:Key="MenuChoiceOdd"> <Border BorderThickness="1" BorderBrush="#FF4A5D80"> <TextBlock Height="Auto" HorizontalAlignment="Stretch" Margin="0" Width="Auto" FontSize="14" Foreground="SlateGray" TextAlignment="Left" AllowDrop="True" Text="{Binding Path=Content, RelativeSource={RelativeSource TemplatedParent}}"> <TextBlock.Background> <LinearGradientBrush EndPoint="0.5,1" StartPoint="0.5,0"> <GradientStop Color="White" Offset="0" /> <GradientStop Color="##FFCBCBCB" Offset="1" /> </LinearGradientBrush> </TextBlock.Background> </TextBlock> </Border> </ControlTemplate> </Grid.Resources> <Border BorderBrush="SlateGray" BorderThickness="2" Margin="10" CornerRadius="10" Background="LightSteelBlue" Width="200"> <StackPanel Margin="4"> <TextBlock Height="Auto" HorizontalAlignment="Stretch" Margin="2,2,2,0" Name="MenuHeaderTextBlock" Text="TextBlock" Width="Auto" FontSize="16" Foreground="PaleGoldenrod" TextAlignment="Left" Padding="10" FontWeight="Bold"><TextBlock.Background><LinearGradientBrush EndPoint="0.5,1" StartPoint="0.5,0"><GradientStop Color="LightSlateGray" Offset="0" /><GradientStop Color="DarkSlateGray" Offset="1" /></LinearGradientBrush></TextBlock.Background></TextBlock> <StackPanel Height="Auto" HorizontalAlignment="Stretch" Margin="2,0,2,0" Name="MenuChoicesStackPanel" VerticalAlignment="Top" Width="Auto"> <Button Template="{StaticResource MenuChoiceEven}" Content="Test Even menu element" /> <Button Template="{StaticResource MenuChoiceOdd}" Content="Test odd menu element" /> </StackPanel> </StackPanel> </Border> </Grid> </Window> What am I doing wrong?

  Read the article

• Enable button based on TextBox value (WPF)

  - by zendar

  This is MVVM application. There is a window and related view model class. There is TextBox, Button and ListBox on form. Button is bound to DelegateCommand that has CanExecute function. Idea is that user enters some data in text box, presses button and data is appended to list box. I would like to enable command (and button) when user enters correct data in TextBox. Things work like this now: CanExecute() method contains code that checks if data in property bound to text box is correct. Text box is bound to property in view model UpdateSourceTrigger is set to PropertyChanged and property in view model is updated after each key user presses. Problem is that CanExecute() does not fire when user enters data in text box. It doesn't fire even when text box lose focus. How could I make this work? Edit: Re Yanko's comment: Delegate command is implemented in MVVM toolkit template and when you create new MVVM project, there is Delegate command in solution. As much as I saw in Prism videos this should be the same class (or at least very similar). Here is XAML snippet: ... <UserControl.Resources> <views:CommandReference x:Key="AddObjectCommandReference" Command="{Binding AddObjectCommand}" /> </UserControl.Resources> ... <TextBox Text="{Binding ObjectName, UpdateSourceTrigger=PropertyChanged}"> </TextBox> <Button Command="{StaticResource AddObjectCommandReference}">Add</Button> ... View model: // Property bound to textbox public string ObjectName { get { return objectName; } set { objectName = value; OnPropertyChanged("ObjectName"); } } // Command bound to button public ICommand AddObjectCommand { get { if (addObjectCommand == null) { addObjectCommand = new DelegateCommand(AddObject, CanAddObject); } return addObjectCommand; } } private void AddObject() { if (ObjectName == null || ObjectName.Length == 0) return; objectNames.AddSourceFile(ObjectName); OnPropertyChanged("ObjectNames"); // refresh listbox } private bool CanAddObject() { return ObjectName != null && ObjectName.Length > 0; } As I wrote in the first part of question, following things work: property setter for ObjectName is triggered on every keypress in textbox if I put return true; in CanAddObject(), command is active (button to) It looks to me that binding is correct. Thing that I don't know is how to make CanExecute() fire in setter of ObjectName property from above code. Re Ben's and Abe's answers: CanExecuteChanged() is event handler and compiler complains: The event 'System.Windows.Input.ICommand.CanExecuteChanged' can only appear on the left hand side of += or -= there are only two more members of ICommand: Execute() and CanExecute() Do you have some example that shows how can I make command call CanExecute(). I found command manager helper class in DelegateCommand.cs and I'll look into it, maybe there is some mechanism that could help. Anyway, idea that in order to activate command based on user input, one needs to "nudge" command object in property setter code looks clumsy. It will introduce dependencies and one of big points of MVVM is reducing them. Is it possible to solve this problem by using dependency properties?

  Read the article

< Previous Page | 280 281 282 283 284 285 286 287 288 289 290 291  | Next Page >