Search Results

Search found 11924 results on 477 pages for 'openoffice org'.

Page 290/477 | < Previous Page | 286 287 288 289 290 291 292 293 294 295 296 297  | Next Page >

  • Unable to open websites that use HTTPS on linux

    - by negai
    I have the following network configuration: My PC 192.168.1.20/24 uses 192.168.1.1/24 as a gateway. Dlink-2760U router with Local address 192.168.1.1/24 has a VPN connection open with the provider using PPTP. Whenever I'm trying to open some web-sites that has some authorization (e.g. gmail.com, coursera.org), I'm getting a request timeout. This problem is observed mostly on linux (Ubuntu 12.04 and Debian 6.0), while most of such websites work correctly on windows XP. Could you please help me diagnose the problem? Could it be related to NAT + HTTPS? Thanks

    Read the article

  • How can I use target mode in Linux with USB?

    - by dash17291
    Kernel 3.5 introduces: This release includes a driver for using an IEEE-1394 connection as a SCSI transport. This enables to expose SCSI devices to other nodes on the Firewire bus, for example hard disk drives. It's a similar functionality to Firewire Target Disk Mode on many Apple computers. This release also adds a usb-gadget driver that does the same with USB. The driver supports two USB protocols are supported that is BBB or BOT (Bulk Only Transport) and UAS (USB Attached SCSI). BOT is advertised on alternative interface 0 (primary) and UAS is on alternative interface 1. Both protocols can work on USB 2.0 and USB 3.0. UAS utilizes the USB 3.0 feature called streams support. http://kernelnewbies.org/Linux_3.5 I have an Arch Linux with kernel 3.5.3-1 and wanna try out this feature.

    Read the article

  • X11 not sending windows to remote computer matlab

    - by MZimmerman6
    I am trying to set up my home desktop, running OS X Mountain Lion, to basically do a bunch of grunt work for me remotely. I have set up ssh, and am able to remotely control the computer fine, but the issue comes in when I try to run X11 apps, like MATLAB, remotely and get windows to pop up. Every time I try to bring up a new window it either opens that window on the remote computer (not the one I am using to control it), or it tells me it can't find a display. here is how I am setting up my ssh assume my matlab alias is set up properly, which it is. ssh -X username@host.org matlab -nodesktop figure; This will open the window on the computer I am SSHing into, and not on the remote one. Basically I want that window to open on the computer I am remoting from. I changed my SSH X11Forwarding and stuff to be yes in ssh_config and sshd_config. Any other suggestions?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Move and clone VirtualBox machines with filesystem commands

    - by mit
    I know of 2 ways to clone a VirtualBox machine on a linux host, one is by using the VirtualBox gui and exporting and re-importing as Appliance (in the file menu of VirtualBox). The other is by cloning only the virtual disk containers: VBoxManage clonevdi source.vdi target.vdi (Taken from http://forums.virtualbox.org/viewtopic.php?p=853#p858 ) I would have to create a new VM afterwards and use the cloned virtual disk. Is there a way I can just copy a virtual disk and the and do the rest by hand? I'd have to manually edit the ~/VirtualBox/VirtualBox.xml and insert a new disk and a new machine: Can I just make up UUIDs or how would this work? I would very much prefer this hardcore method of doing things as it allows me to freely and rapdily backup, restore, move or clone machines. Or ist there a better way to do this?

    Read the article

  • SFTP not working, but SSH is

    - by Dan
    I've had a server running CentOS for a few months now. A few days ago, I stopped being able to connect to it over SFTP. I've tried from multiple computers, OSes, clients, and internet connections. I can SSH in just fine, though. For example, Nautilus gives me this: Error: DBus error org.freedesktop.DBus.Error.NoReply: Did not receive a reply. Possible causes include: the remote application did not send a reply, the message bus security policy blocked the reply, the reply timeout expired, or the network connection was broken. Please select another viewer and try again. I was under the impression that SFTP was just pure SSH, and if one worked, the other would, and vice-versa. Clearly that's not the case, though. What could I have done wrong?

    Read the article

  • ionice idle is ignored

    - by Ferran Basora
    I have been testing the ionice command for a while and the idle (3) mode seems to be ignored in most cases. My test is to run both command at the same time: du <big folder> ionice -c 3 du <another big folder> If I check both process in iotop I see no difference in the percentage of io utilization for each process. To provide more information about the CFQ scheduler I'm using a 3.5.0 linux kernel. I started doing this test because I'm experimenting a system lag each time a daily cron job updatedb.mlocate is executed in my Ubuntu 12.10 machine. If you check the /etc/cron.daily/mlocate file you realize that the command is executed like: /usr/bin/ionice -c3 /usr/bin/updatedb.mlocate Also, the funny thing is that whenever my system for some reason starts using swap memory, the updatedb.mlocate io process is been scheduled faster than kswapd0 process, and then my system gets stuck. Some suggestion? References: http://ubuntuforums.org/showthread.php?t=1243951&page=2 https://bugs.launchpad.net/ubuntu/+source/findutils/+bug/332790

    Read the article

  • Ubuntu Wired network(ethernet does not work)

    - by user36777
    It was working just fine, until the other day I yanked it out. The wireless works just fine on the same router. If I login to a windows 7 instance on this dual boot laptop then the ehternet works just fine. So it's not a hardware, cable or router issue. The card even gets an ip, but I can't connect to the internet. Here are the details from route, iptables, ifconfig, ping etc. Any ideas? I have been struggling with this for day, none seems to have an answer. http://pastie.org/954816

    Read the article

  • Allow Internet Access with Default Gateway on Windows 7 VPN Server

    - by Hakoda
    I have a Windows 7 box at home (which I'll refer to as Home-VPN) that runs a simple PPTP VPN server. I have a range of 2 IP address (192.168.1.10-192.168.1.11) to give out, although the server is only able to give out one concurrent connection. Ports 1723 & 47 are correctly forwarded to the server. IPv6 is disabled on both Home-VPN and the client. I setup Home-VPN just like this Youtube video: http://www.youtube.com/watch?v=1s5JxMG06L4 I can connect to it just fine but I can't access the Internet when connected to Home-VPN, all outside web servers (eg. google.com, mozilla.org, apple.com) are unreachable. I know I can uncheck "Use Default Gateway on Remote Servers" on the client side under IPv4 settings but that will route all my traffic through my current connection, rather than through the VPN, defeating the purpose of said VPN. Any ideas on how I can fix this?

    Read the article

  • get focus only by clicking the title bar of xterm

    - by sandyleo
    ...I've suffered this problem many times and so do my colleagues Sometimes after you stroked some keyboard and mouse combinations this behavior showed up : you have to click a xterm's title bar to focus on that term so that you can input, instead of any places in that window. Whatever you do, minimize, resize don't help. This only thing you can do is logout that session but all the working history will be gone(of course I can save that but it's awkward) I'm eagerly wondering is there any solutions to this? I use ctrix XenApp plugin 11.0. The other platform info: Linux 2.6.9-67.ELsmp x86_64 OS: RedHat Enterprise Linux 4.0 U6 xterm:X.Org 6.8.2(192) THanks!

    Read the article

  • how do I install an add on from zip in xbmc 12?

    - by jcollum
    http://wiki.xbmc.org/index.php?title=Add-ons#How_to_install_from_zip The wiki is pretty straighforward but those options are not present when I follow the steps in the wiki. I select this: System -- Settings -- AddOns All I see is a list of add ons like Youtube and Railscasts. There's no option for installing from a zip file like the wiki says. Pressing ".." just takes me to the list of AddOn types like "Album Information" and "Artist Information" etc. The wiki looks to be out of date.

    Read the article

  • Windows Server 2008 - Setting Up DNS and Web Server (IIS) to host personal website?

    - by Car Trader
    Okay, I have a server, (Windows Server 2008 R2 to be more precise) and I have installed PHP, MySQL, phpMyAdmin, for web hosting purposes. I have set up a static ip address internally. I have installed the role DNS and Web Server (IIS) role. I now set up my forward looking zone as my chosen domain. I set up the nameservers as ns1.domain.co.uk with my IP address which I found from whatismyip.org. However, when I type my IP address, it times out with an error (Timeout Error). Am I doing something wrong? Am I missing something? Also I have seen that most websites have multiple nameservers, which are apparently mirror IP addresses which all redirect to one IP address. Also, I can locally connect using the IP address 192.168.0.8, however, I want to put my website online/live on the internet. Can anyone help me with this? -- Regards

    Read the article

  • Can't get port forwarding to work on Ubuntu

    - by Znarkus
    I'm using my home server as NAT/router, which works well. But now I'm trying to forward port 3478, which I can't get to work. eth0 = public interface eth1 = private network $ cat /proc/sys/net/ipv4/conf/eth0/forwarding 1 $ cat /proc/sys/net/ipv4/conf/eth1/forwarding 1 Then to forward port 3478 to 10.0.0.7, I read somewhere that I should run iptables -t nat -A PREROUTING -p tcp -i eth0 --dport 3478 -j DNAT --to-destination 10.0.0.7:3478 iptables -A FORWARD -p tcp -d 10.0.0.7 --dport 3478 -m state --state NEW,ESTABLISHED,RELATED -j ACCEPT I also ran ufw allow 3478 But testing port 3478 with http://www.canyouseeme.org/ doesn't work. Any idea what I have done wrong?

    Read the article

  • How to upgrade Nginx?

    - by jwerre
    I'm on Ububtu and I'm trying upgrade Nginx 1.0.5 to the latest version 1.2.6. Here's what I did and what didn't work. $ nginx -v nginx: nginx version: nginx/1.0.5 $ curl -O http://nginx.org/download/nginx-1.2.6.tar.gz $ tar xvzf nginx-1.2.6.tar.gz $ cd nginx-1.2.6/ $ ./configure $ make && sudo make install $ nginx -v nginx: nginx version: nginx/1.0.5 <<< still old version!!! Any ideas would be much appreciated. Thanks.

    Read the article

  • Subdomain returns error when restarting Apache

    - by xXx
    I try to install a subdomain on my dedicated server. I made a new DNS rules to point my sub domain to the IP of my serv. After reading this Subdomain on apache i tried to add new rules on Apache : NameVirtualHost *:80 <VirtualHost *:80> ServerName tb.mysite.org DocumentRoot /home/mysite/wwww/tb/ <Directory "/home/mysite/wwww/tb/"> AllowOverride All Allow from all </Directory> </VirtualHost> Then i restart Apache but it returns sudo /etc/init.d/apache2 restart * Restarting web server apache2 Warning: DocumentRoot [/home/mysite/wwww/tb/] does not exist [Wed Jun 27 10:32:58 2012] [warn] NameVirtualHost *:80 has no VirtualHosts ... waiting Warning: DocumentRoot [/home/mysite/wwww/tb/] does not exist [Wed Jun 27 10:32:59 2012] [warn] NameVirtualHost *:80 has no VirtualHosts the tb/ folder is existing, don't why Apache can't find it... And it says that NameVirtualHost:80 has no VirtualHosts...

    Read the article

  • tomcat processParameters complains about "invalid chunk ignored"

    - by cgicgi
    I am hosting a software system running under tomcat for quite a number of customers. Some of these send invalid URLs as request. These URLs may contain "&=" or "&&", which is not within the http specs. Now my tomcat complains about the following: "08.09.2010 12:36:04 org.apache.tomcat.util.http.Parameters processParameters WARNING: Parameters: Invalid chunk '' ignored." It is no problem, as is doesn't affect the operation in any way. Only problem ist that the tomcat/logs/catalina.out is growing with every single request. In the net you can find suggestions like: - Fix your URLs (which I can't, as it is the customers who send them) - Raise tomcats log level to ERROR (which I don't want to do, as it would suppress INFO like "INFO: Reloading context [/ContextName]" and other stuff you want to know. - Redirect the log to the application log (which won't solve the problem, as the message will flood just another log) Does anyone know how to solve the problem at its ROOT, which means: Tell tomcat not to complain about invalid request parameters any longer

    Read the article

  • Setting Environment Variable for Tomcat 6 Servlet

    - by amaevis
    I'm using Ubuntu's default installation of Tomcat 6. I'm deploying a ROOT.war, and trying to set an environment variable specific to it, i.e. accessible from System.getenv() in the Servlet.init(config). According to the docs (http://tomcat.apache.org/tomcat-6.0-doc/config/context.html), I can specify this in a Context element in conf/Catalina/localhost/ROOT.xml. I've created that with these contents: <Context> <Environment name="FOO" value="bar" type="java.lang.String" override="false"/> </Context> And I've deployed the webapp as usual, i.e. to webapps/ROOT.war. Server.getenv("FOO") in the Servlet.init(config) still returns null. What am I missing?

    Read the article

  • Is there a way to use something like RewriteRule ... [PT] for an external URL?

    - by nbolton
    I have a non-apache web server running on port 8000, but this cannot be accessed from behind corporate firewalls. So, I would like to use my apache 2 server as a proxy to this other web server. I've tried using: RewriteEngine On RewriteRule /.* http://buildbot.synergy-foss.org:8000/builders/ [PT] ... but this does not work; I get: Bad Request Your browser sent a request that this server could not understand. However, it worked fine with [R]. Update: Also, when using ProxyPass, I get this error: Forbidden You don't have permission to access / on this server.

    Read the article

  • Cannot open some websites

    - by Jayashree
    Hi all, I have a very specific problem. We have a wifi router at home which supports three laptops and a desktop. For the past month or so, I've been unable to open a number of websites on our HP desktop, Dell laptop and my Macbook. These include everything connected with http://wordpress.org and several others. The page simply refuses to load. I can't access some other websites as well. I've tried everything. We've rebooted the router, deleted all the cookies/download history, but nothing works. I've tried accessing these websites on IE, Chrome, Firefox and Safari. Strangely, when friends use their laptops on the same wifi connection, the websites open just fine. What do I do? I'm getting desperate here. Jayashree

    Read the article

  • FreeBSD Jail own network stack with vimage

    - by bodokaiser
    I want to throw all services from the host system and put them in jails. Unfortunatly this doesn't work for file sharing (e.g. nfsd) because the jails don't have there own network stack by default. I know read something about vimage which would solve this issue. See more in this thread: http://forums.freebsd.org/showthread.php?t=9006 The use of vimage with raw jails should use moreorless but the use with vimage and ezjail makes it hard. Does anyone have experience about this topic and wants to share it? Regards

    Read the article

  • Running JBoss 6 with Runit / daemontools or other process supervision framework

    - by Alex Recarey
    I'm tying to use runit to daemonize JBoss. I use the /opt/jboss-6.1.0.Final/bin/run.sh script to start the server. When I do so from the comandline, JBoss does not detach (which is what we want), and will also shut down when CTRL+C is pressed. In theory a perfect candidate to use runit on. Everything works fine except when I try to get runit to shut down JBoss. When I issue the command sv stop jboss nothing happens. Runit thinks the process is stopped but jboss continues to run normally. I'm not doing anything special with the run script. This is my runit run script: #!/bin/sh exec 2>&1 exec /opt/jboss-6.1.0.Final/bin/run.sh -c standard -b 0.0.0.0 Looking at the jboss_init_redhat.sh script, the start section does mention ./bin/run.sh but the stop section has the following text: JBOSS_CMD_STOP=${JBOSS_CMD_STOP:-"java -classpath $JBOSSCP org.jboss.Shutdown --shutdown"} Any ideas of what I could try?

    Read the article

  • ubuntu 9.10 on an external usb drive: grub1 does not work

    - by Toc
    I have installed Ubuntu on a partition of my external usb drive. Since I had problems with grub2, I have uninstalled it and installed grub1. But then the usb drive didn't boot anymore, and I am forced to the limited shell of grub1. If I write manually kernel (hd0,4)/vmlinuz-2.6.31-15-generic root=/dev/sdb4 ro quiet splash initrd (hd0,4)/boot/initrd.img-2.6.31-15-generic boot then Ubuntu is loaded, but if I execute the commands root (hd0,4) setup (hd0) as explained at http://www.gnu.org/software/grub/manual/html_node/Installing-GRUB-natively.html#Installing-GRUB-natively, next time I boot from usb I am forced again to the grub limited shell. How can I restore a working grub?

    Read the article

  • RUNIT - created first service directory, "sv start testrun" does not work

    - by Veseliq
    I'm pretty new to runit. I installed it on a Ubuntu host. What I did: 1) created a dir testrun in /etc/sv 2) created a script run in /etc/sv/testrun/run, the script content: #! /bin/bash exec /root/FP/annotate-output python /root/FP/test.py | logger -t svtest 3) If I call directly /etc/sv/testrun/run it executes successfully 4) I run sv start testrun (or sv run testrun, sv restart testrun), all of them end up with the same error msg: fail: sv: unable to change to service directory: file does not exist Any ideas what am I doing wrong? I'm new to runit and base all my actions on the information found here: http://smarden.org/runit/

    Read the article

  • problem with accessing a php page

    - by EquinoX
    So I have a info.php page which is located on the folder /var/www/nginx-default, however when I go to my ip address/info.php, it always redirects me to this site: http://www.iana.org/domains/example/ is this because I have a virtual host that I called example? Here is my config for the example website: server { listen 80; server_name www.example.com; rewrite ^/(.*) http://example.com/$1 permanent; } server { listen 80; server_name example.com; access_log /var/www/example.com/logs/access.log; error_log /var/www/example.com/logs/error.log; location / { root /var/www/example.com/public/; index index.html; } } The way I access this site is by changing my /var/hosts in my macbook so that example.com is mapped to my server IP address... however now when I do xxx.xxx.xxx.xxx/info.php.. it redirects me to that site I posted above

    Read the article

  • Ubuntu Wired network(ethernet does not work)

    - by badnaam
    It was working just fine, until the other day I yanked it out. The wireless works just fine on the same router. If I login to a windows 7 instance on this dual boot laptop then the ehternet works just fine. So it's not a hardware, cable or router issue. The card even gets an ip, but I can't connect to the internet. Here are the details from route, iptables, ifconfig, ping etc. Any ideas? I have been struggling with this for day, none seems to have an answer. http://pastie.org/954816

    Read the article

< Previous Page | 286 287 288 289 290 291 292 293 294 295 296 297  | Next Page >