Search Results

Search found 7529 results on 302 pages for 'replace'.

Page 293/302 | < Previous Page | 289 290 291 292 293 294 295 296 297 298 299 300  | Next Page >

  • Pagination links broken - php/jquery

    - by ClarkSKent
    Hey, I'm still trying to get my pagination links to load properly dynamically. But I can't seem to find a solution to this one problem. vote down star Hi everyone, I am still trying to figure out how to fix my pagination script to work properly. the problem I am having is when I click any of the pagination number links to go the next page, the new content does not load. literally nothing happens and when looking at the console in Firebug, nothing is sent or loaded. I have on the main page 3 links to filter the content and display it. When any of these links are clicked the results are loaded and displayed along with the associated pagination numbers for that specific content. I believe the problem is coming from the sql query in generate_pagination.php (seen below). When I hard code the sql category part it works, but is not dynamic at all. This is why I'm calling $ids=$_GET['ids']; and trying to put that into the category section but then the numbers don't display at all. If I echo out the $ids variable and click on a filter it does display the correct name/id, so I don't know why this doesn't work Here is the main page so you can see how I am including and starting the function(I'm new to php): <?php include_once('generate_pagination.php'); ?> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1.4.1/jquery.min.js"></script> <script type="text/javascript" src="jquery_pagination.js"></script> <div id="loading" ></div> <div id="content" data-page="1"></div> <ul id="pagination"> <?php //Pagination Numbers for($i=1; $i<=$pages; $i++) { echo '<li class="page_numbers" id="page'.$i.'">'.$i.'</li>'; } ?> </ul> <br /> <br /> <a href="#" class="category" id="marketing">Marketing</a> <a href="#" class="category" id="automotive">Automotive</a> <a href="#" class="category" id="sports">Sports</a> Here is the generate pagination where the problem seems to occur: <?php $ids=$_GET['ids']; include_once('config.php'); $per_page = 3; //Calculating no of pages $sql = "SELECT COUNT(*) FROM explore WHERE category='$ids'"; $result = mysql_query($sql); $count = mysql_fetch_row($result); $pages = ceil($count[0]/$per_page); ?> I thought I might as well post the jquery script if someone wants to see: $(document).ready(function(){ //Display Loading Image function Display_Load() { $("#loading").fadeIn(900,0); $("#loading").html("<img src='bigLoader.gif' />"); } //Hide Loading Image function Hide_Load() { $("#loading").fadeOut('slow'); }; //Default Starting Page Results $("#pagination li:first").css({'color' : '#FF0084'}).css({'border' : 'none'}); Display_Load(); $("#content").load("pagination_data.php?page=1", Hide_Load()); // Editing below. // Sort content Marketing $("a.category").click(function() { Display_Load(); var this_id = $(this).attr('id'); $.get("pagination.php", { category: this.id }, function(data){ //Load your results into the page var pageNum = $('#content').attr('data-page'); $("#pagination").load('generate_pagination.php?category=' + pageNum +'&ids='+ this_id ); $("#content").load("filter_marketing.php?page=" + pageNum +'&id='+ this_id, Hide_Load()); }); }); //Pagination Click $("#pagination li").click(function(){ Display_Load(); //CSS Styles $("#pagination li") .css({'border' : 'solid #dddddd 1px'}) .css({'color' : '#0063DC'}); $(this) .css({'color' : '#FF0084'}) .css({'border' : 'none'}); //Loading Data var pageNum = $(this).attr("id").replace("page",""); $("#content").load("pagination_data.php?page=" + pageNum, function(){ $(this).attr('data-page', pageNum); Hide_Load(); }); }); }); If any could assist me on solving this problem that would be great, thanks.

    Read the article

  • Using WeakReference to resolve issue with .NET unregistered event handlers causing memory leaks.

    - by Eric
    The problem: Registered event handlers create a reference from the event to the event handler's instance. If that instance fails to unregister the event handler (via Dispose, presumably), then the instance memory will not be freed by the garbage collector. Example: class Foo { public event Action AnEvent; public void DoEvent() { if (AnEvent != null) AnEvent(); } } class Bar { public Bar(Foo l) { l.AnEvent += l_AnEvent; } void l_AnEvent() { } } If I instantiate a Foo, and pass this to a new Bar constructor, then let go of the Bar object, it will not be freed by the garbage collector because of the AnEvent registration. I consider this a memory leak, and seems just like my old C++ days. I can, of course, make Bar IDisposable, unregister the event in the Dispose() method, and make sure to call Dispose() on instances of it, but why should I have to do this? I first question why events are implemented with strong references? Why not use weak references? An event is used to abstractly notify an object of changes in another object. It seems to me that if the event handler's instance is no longer in use (i.e., there are no non-event references to the object), then any events that it is registered with should automatically be unregistered. What am I missing? I have looked at WeakEventManager. Wow, what a pain. Not only is it very difficult to use, but its documentation is inadequate (see http://msdn.microsoft.com/en-us/library/system.windows.weakeventmanager.aspx -- noticing the "Notes to Inheritors" section that has 6 vaguely described bullets). I have seen other discussions in various places, but nothing I felt I could use. I propose a simpler solution based on WeakReference, as described here. My question is: Does this not meet the requirements with significantly less complexity? To use the solution, the above code is modified as follows: class Foo { public WeakReferenceEvent AnEvent = new WeakReferenceEvent(); internal void DoEvent() { AnEvent.Invoke(); } } class Bar { public Bar(Foo l) { l.AnEvent += l_AnEvent; } void l_AnEvent() { } } Notice two things: 1. The Foo class is modified in two ways: The event is replaced with an instance of WeakReferenceEvent, shown below; and the invocation of the event is changed. 2. The Bar class is UNCHANGED. No need to subclass WeakEventManager, implement IWeakEventListener, etc. OK, so on to the implementation of WeakReferenceEvent. This is shown here. Note that it uses the generic WeakReference that I borrowed from here: http://damieng.com/blog/2006/08/01/implementingweakreferencet I had to add Equals() and GetHashCode() to his class, which I include below for reference. class WeakReferenceEvent { public static WeakReferenceEvent operator +(WeakReferenceEvent wre, Action handler) { wre._delegates.Add(new WeakReference<Action>(handler)); return wre; } public static WeakReferenceEvent operator -(WeakReferenceEvent wre, Action handler) { foreach (var del in wre._delegates) if (del.Target == handler) { wre._delegates.Remove(del); return wre; } return wre; } HashSet<WeakReference<Action>> _delegates = new HashSet<WeakReference<Action>>(); internal void Invoke() { HashSet<WeakReference<Action>> toRemove = null; foreach (var del in _delegates) { if (del.IsAlive) del.Target(); else { if (toRemove == null) toRemove = new HashSet<WeakReference<Action>>(); toRemove.Add(del); } } if (toRemove != null) foreach (var del in toRemove) _delegates.Remove(del); } } public class WeakReference<T> : IDisposable { private GCHandle handle; private bool trackResurrection; public WeakReference(T target) : this(target, false) { } public WeakReference(T target, bool trackResurrection) { this.trackResurrection = trackResurrection; this.Target = target; } ~WeakReference() { Dispose(); } public void Dispose() { handle.Free(); GC.SuppressFinalize(this); } public virtual bool IsAlive { get { return (handle.Target != null); } } public virtual bool TrackResurrection { get { return this.trackResurrection; } } public virtual T Target { get { object o = handle.Target; if ((o == null) || (!(o is T))) return default(T); else return (T)o; } set { handle = GCHandle.Alloc(value, this.trackResurrection ? GCHandleType.WeakTrackResurrection : GCHandleType.Weak); } } public override bool Equals(object obj) { var other = obj as WeakReference<T>; return other != null && Target.Equals(other.Target); } public override int GetHashCode() { return Target.GetHashCode(); } } It's functionality is trivial. I override operator + and - to get the += and -= syntactic sugar matching events. These create WeakReferences to the Action delegate. This allows the garbage collector to free the event target object (Bar in this example) when nobody else is holding on to it. In the Invoke() method, simply run through the weak references and call their Target Action. If any dead (i.e., garbage collected) references are found, remove them from the list. Of course, this only works with delegates of type Action. I tried making this generic, but ran into the missing where T : delegate in C#! As an alternative, simply modify class WeakReferenceEvent to be a WeakReferenceEvent, and replace the Action with Action. Fix the compiler errors and you have a class that can be used like so: class Foo { public WeakReferenceEvent<int> AnEvent = new WeakReferenceEvent<int>(); internal void DoEvent() { AnEvent.Invoke(5); } } Hopefully this will help someone else when they run into the mystery .NET event memory leak!

    Read the article

  • ASP.NET MVC RememberMe(It's large, please don't quit reading. Have explained the problem in detail a

    - by nccsbim071
    After searching a lot i did not get any answers and finally i had to get back to you. Below i am explaining my problem in detail. It's too long, so please don't quit reading. I have explained my problem in simple language. I have been developing an asp.net mvc project. I am using standard ASP.NET roles and membership. Everything is working fine but the remember me functionality doesn't work at all. I am listing all the details of work. Hope you guys can help me out solve this problem. I simply need this: I need user to login to web application. During login they can either login with remember me or without it. If user logs in with remember me, i want browser to remember them for long time, let's say atleast one year or considerably long time. The way they do it in www.dotnetspider.com,www.codeproject.com,www.daniweb.com and many other sites. If user logs in without remember me, then browser should allow access to website for some 20 -30 minutes and after that their session should expire. Their session should also expire when user logs in and shuts down the browser without logging out. Note: I have succesfully implemented above functionality without using standard asp.net roles and membership by creating my own talbes for user and authenticating against my database table, setting cookie and sessions in my other projects. But for this project we starting from the beginning used standard asp.net roles and membership. We thought it will work and after everything was build at the time of testing it just didn't work. and now we cannot replace the existing functionality with standard asp.net roles and membership with my own custom user tables and all the stuff, you understand what i am taling about. Either there is some kind of bug with standard asp.net roles and membership functionality or i have the whole concept of standard asp.net roles and membership wrong. i have stated what i want above. I think it's very simple and reasonable. What i did Login form with username,password and remember me field. My setting in web.config: <authentication mode="Forms"> <forms loginUrl="~/Account/LogOn" timeout="2880"/> </authentication> in My controller action, i have this: FormsAuth.SignIn(userName, rememberMe); public void SignIn(string userName, bool createPersistentCookie) { FormsAuthentication.SetAuthCookie(userName, createPersistentCookie); } Now the problems are following: I have already stated in above section "I simply need this". user can successfully log in to the system. Their session exists for as much minutes as specified in timeout value in web.config. I have also given a sample of my web.config. In my samplem if i set the timeout to 5 minutes,then user session expires after 5 minutes, that's ok. But if user closes the browser and reopen the browser, user can still enter the website without loggin in untill time specified in "timeout" has not passed out. The sliding expiration for timeout value is also working fine. Now if user logs in to the system with remember me checked, user session still expires after 5 minutes. This is not good behaviour, is it?. I mean to say that if user logs in to the system with remember me checked he should be remembered for a long time untill he doesn't logs out of the system or user doesn't manually deletes all the cookies from the browser. If user logs in to the system without remember me checked his session should expire after the timeout period values specified in web.config and also if users closes the browser. The problem is that if user closes the browser and reopens it he can still enter the website without logging in. I search internet a lot on this topic, but i could not get the solution. In the blog post(http://weblogs.asp.net/scottgu/archive/2005/11/08/430011.aspx) made by Scott Gu on exactly the same topic. The users are complaining about the same thing in their comments ut there is no easy solution given in by Mr. Scott. I read it at following places: http://weblogs.asp.net/scottgu/archive/2005/11/08/430011.aspx http://geekswithblogs.net/vivek/archive/2006/09/14/91191.aspx I guess this is a problem of lot's of users. As seem from blog post made by Mr. Scott Gu. Your help will be really appreciated. Thanks in advance.

    Read the article

  • Custom View embed in Gallery crashes while key press

    - by tao
    Hi there, I'd like to find some stuff to replace the Tab component, so I'd make a custom View named StringView, which has the ability to display text, and to embed it into a Gallery. But it always crashes with error "NullPointerException at InputMethodManager". I have no idea about this, any help&tip&suggest are appreciate. Detail of my issue: First I'd created a class StringView extends View: public class StringView extends View { protected final Paint mPaint = new Paint(Paint.ANTI_ALIAS_FLAG); protected String mString; protected int mAscent; // Constructor public StringView(Context context, String string) { super(context); mPaint.setARGB(255, 255, 60, 10); mPaint.setTextSize(30); //mPaint.setFakeBoldText(true); mString = string; setPadding(20,15,20,15); } @Override protected void onDraw(Canvas canvas) { super.onDraw(canvas); int w = this.getPaddingLeft(); int h = this.getPaddingTop() - mAscent; canvas.drawText(mString, w, h, mPaint); } public void setString(String str) { mString = str; this.requestLayout(); this.invalidate(); } public String getString() { return mString; } @Override protected void onMeasure(int widthMeasureSpec, int heightMeasureSpec) { setMeasuredDimension(measureWidth(widthMeasureSpec), measureHeight(heightMeasureSpec)); } /** * Determines the width of this view * @param measureSpec A measureSpec packed into an int * @return The width of the view, honoring constraints from measureSpec */ private int measureWidth(int measureSpec) { int result = 0; int specMode = MeasureSpec.getMode(measureSpec); int specSize = MeasureSpec.getSize(measureSpec); if (specMode == MeasureSpec.EXACTLY) { // We were told how big to be result = specSize; } else { // Measure the text result = (int) mPaint.measureText(mString) + getPaddingLeft() + getPaddingRight(); if (specMode == MeasureSpec.AT_MOST) { // Respect AT_MOST value if that was what is called for by measureSpec result = Math.min(result, specSize); } } return result; } /** * Determines the height of this view * @param measureSpec A measureSpec packed into an int * @return The height of the view, honoring constraints from measureSpec */ private int measureHeight(int measureSpec) { int result = 0; int specMode = MeasureSpec.getMode(measureSpec); int specSize = MeasureSpec.getSize(measureSpec); mAscent = (int) mPaint.ascent(); if (specMode == MeasureSpec.EXACTLY) { // We were told how big to be result = specSize; } else { // Measure the text (beware: ascent is a negative number) result = (int) (-mAscent + mPaint.descent()) + getPaddingTop() + getPaddingBottom(); if (specMode == MeasureSpec.AT_MOST) { // Respect AT_MOST value if that was what is called for by measureSpec result = Math.min(result, specSize); } } return result; } } Second I put it in to Gallery through Adapter Gallery gallery = (Gallery) findViewById(R.id.gallery); gallery.setAdapter(new ImageAdapter(this)); ImageAdapter: public class ImageAdapter extends BaseAdapter { int mGalleryItemBackground; private Context mContext; private View[] mImages = genSerielImageViews(); public ImageAdapter(Context c) { mContext = c; TypedArray a = obtainStyledAttributes(R.styleable.Gallery); mGalleryItemBackground = a.getResourceId( R.styleable.Gallery_android_galleryItemBackground, 0); a.recycle(); } private View[] genSerielImageViews() { if (true) { int N = 6; StringView[] views = new StringView[N]; for (int i=0; i<N; i++) { views[i] = new StringView(mContext, "ITEM #" + Integer.toString(i) ); } return views; } else { int N = 6; TextView[] views = new TextView[N]; for (int i=0; i<N; i++) { views[i] = new TextView( mContext ); views[i].setText("CCTV #" + Integer.toString(i) ); } return views; } } public int getCount() { return mImages.length; } public Object getItem(int position) { return position; } public long getItemId(int position) { return position; } public View getView(int position, View convertView, ViewGroup parent) { return mImages[position]; } } Then Compile&Run, press keypad RIGHT and I got a crash, It's turns out a weird InputMethodManager error: 03-18 07:22:33.568: ERROR/AndroidRuntime(958): Uncaught handler: thread main exiting due to uncaught exception 03-18 07:22:33.648: ERROR/AndroidRuntime(958): java.lang.NullPointerException 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at android.view.inputmethod.InputMethodManager.startInputInner(InputMethodManager.java:940) 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at android.view.inputmethod.InputMethodManager.checkFocus(InputMethodManager.java:1114) 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at android.view.ViewRoot.handleMessage(ViewRoot.java:1869) 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at android.os.Handler.dispatchMessage(Handler.java:99) 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at android.os.Looper.loop(Looper.java:123) 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at android.app.ActivityThread.main(ActivityThread.java:4310) 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at java.lang.reflect.Method.invokeNative(Native Method) 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at java.lang.reflect.Method.invoke(Method.java:521) 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:860) 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:618) 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at dalvik.system.NativeStart.main(Native Method) Thanks.

    Read the article

  • Son of Suckerfish ie6 problem - right-most dropdown menu also appearing on left side of screen

    - by Kevin Burke
    I'm interning for an NGO in India and trying to fix their website, including updating their menu so it's not the last item on the page to load, and it's centered on the screen. Everything works well enough but when I try out my new menu in IE6, I get this weird error where the content below the menu is padded an extra 30px or so and the material in the right-most drop down appears on the far left of the screen, always visible. When I drop down the rightmost link ("Publications") the content appears both in the correct location and in the same spot on the far left of the screen, and changes color when I hover as well. It's tough to describe, so it would probably be best if you took a look: visit http://sevamandir.org/a30/index.htm in your Internet Explorer 6 browser to see for yourself. I really appreciate your help. Also I'm using a 1000px wide monitor, if there's more hijinks going on outside that space I'd like to know about that too. Here's the relevant code: in the html head: <script> sfHover = function() { var sfEls = document.getElementById("nav").getElementsByTagName("LI"); for (var i=0; i<sfEls.length; i++) { sfEls[i].onmouseover=function() { this.className+=" sfhover"; } sfEls[i].onmouseout=function() { this.className=this.className.replace(new RegExp(" sfhover\\b"), ""); } } } if (window.attachEvent) window.attachEvent("onload", sfHover); </script> text surrounding the menu - the menu is simply <ul id="nav"><li></li></ul> etc. <!--begin catchphrase--> <div style="float:left; height:27px; width:520px; margin:0px; font:16px Arial, Helvetica, sans-serif; font-weight:bold; color:#769841;"> Transforming lives through democratic &amp; participatory development </div> <?php include("menu.php"); ?> </div><!-- end header --> <!--begin main text div--> <div id="maincontent"> Relevant menu CSS: #nav, #nav ul { font:bold 11px Verdana, sans-serif; float: left; width: 980px; list-style: none; line-height: 1; background: white; font-weight: bold; padding: 0; border: solid #769841; border-width: 0; margin: 0 0 1em 0; } #nav a { display: block; width: 140px; /*this is the total width of the upper menu*/ w\idth: 120px; /*this is the width less horizontal padding */ padding: 5px 10px 5px 10px; /*horiz padding is the 2nd & 4th items here - goes Top Right Bottom Left */ color: #ffffff; background:#b6791e; text-decoration: none; } #nav a.daddy { background: url(rightarrow2.gif) center right no-repeat; } #nav li { float: left; padding: 0; width: 140px; /*this needs to be updated to match top #nav a */ background:#b6791e; } #nav li:hover, #nav li a:hover, #nav li:hover a { background:#769841; } #nav li:hover li a { background:#ffffff; color:#769841; } #nav li ul { position: absolute; left: -999em; height: auto; width: 14.4em; w\idth: 13.9em; font-weight: bold; border-width: 0.25em; /*green border around dropdown menu*/ margin: 0; } #nav li ul a { background:#ffffff; color:#769841; } #nav li li { padding-right: 1em; width: 13em; background:#ffffff; } #nav li ul a { width: 13em; w\idth: 9em; } #nav li ul ul { margin: -1.75em 0 0 14em; } #nav li:hover ul ul, #nav li:hover ul ul ul, #nav li.sfhover ul ul, #nav li.sfhover ul ul ul { left: -999em; } #nav li:hover ul, #nav li li:hover ul, #nav li li li:hover ul, #nav li.sfhover ul, #nav li li.sfhover ul, #nav li li li.sfhover ul { left: auto; } #nav li:hover, #nav li.sfhover, { background: #769841; color:#ffe400; } #nav li a:hover, #nav li li a:hover, #nav li:hover li:hover, #nav li.sfhover a:hover { background: #769841; color:#ffe400; }

    Read the article

  • Convert PDF to Image Batch

    - by tro
    I am working on a solution where I can convert pdf files to images. I am using the following example from codeproject: http://www.codeproject.com/Articles/317700/Convert-a-PDF-into-a-series-of-images-using-Csharp?msg=4134859#xx4134859xx now I tried with the following code to generate from more then 1000 pdf files new images: using Cyotek.GhostScript; using Cyotek.GhostScript.PdfConversion; using System; using System.Collections.Generic; using System.Drawing; using System.IO; using System.Linq; using System.Text; using System.Threading.Tasks; namespace RefClass_PDF2Image { class Program { static void Main(string[] args) { string outputPath = Properties.Settings.Default.outputPath; string pdfPath = Properties.Settings.Default.pdfPath; if (!Directory.Exists(outputPath)) { Console.WriteLine("Der angegebene Pfad " + outputPath + " für den Export wurde nicht gefunden. Bitte ändern Sie den Pfad (outputPath) in der App.Config Datei."); return; } else { Console.WriteLine("Output Pfad: " + outputPath + " gefunden."); } if (!Directory.Exists(pdfPath)) { Console.WriteLine("Der angegebene Pfad " + pdfPath + " zu den PDF Zeichnungen wurde nicht gefunden. Bitte ändern Sie den Pfad (pdfPath) in der App.Config Datei."); return; } else { Console.WriteLine("PDF Pfad: " + pdfPath + " gefunden."); } Pdf2ImageSettings settings = GetPDFSettings(); DateTime start = DateTime.Now; TimeSpan span; Console.WriteLine(""); Console.WriteLine("Extraktion der PDF Zeichnungen wird gestartet: " + start.ToShortTimeString()); Console.WriteLine(""); DirectoryInfo diretoryInfo = new DirectoryInfo(pdfPath); DirectoryInfo[] directories = diretoryInfo.GetDirectories(); Console.WriteLine(""); Console.WriteLine("Es wurden " + directories.Length + " verschiedende Verzeichnisse gefunden."); Console.WriteLine(""); List<string> filenamesPDF = Directory.GetFiles(pdfPath, "*.pdf*", SearchOption.AllDirectories).Select(x => Path.GetFullPath(x)).ToList(); List<string> filenamesOutput = Directory.GetFiles(outputPath, "*.*", SearchOption.AllDirectories).Select(x => Path.GetFullPath(x)).ToList(); Console.WriteLine(""); Console.WriteLine("Es wurden " + filenamesPDF.Count + " verschiedende PDF Zeichnungen gefunden."); Console.WriteLine(""); List<string> newFileNames = new List<string>(); int cutLength = pdfPath.Length; for (int i = 0; i < filenamesPDF.Count; i++) { string temp = filenamesPDF[i].Remove(0, cutLength); temp = outputPath + temp; temp = temp.Replace("pdf", "jpg"); newFileNames.Add(temp); } for (int i = 0; i < filenamesPDF.Count; i++) { FileInfo fi = new FileInfo(newFileNames[i]); if (!fi.Exists) { if (!Directory.Exists(fi.DirectoryName)) { Directory.CreateDirectory(fi.DirectoryName); } Bitmap firstPage = new Pdf2Image(filenamesPDF[i], settings).GetImage(); firstPage.Save(newFileNames[i], System.Drawing.Imaging.ImageFormat.Jpeg); firstPage.Dispose(); } //if (i % 20 == 0) //{ // GC.Collect(); // GC.WaitForPendingFinalizers(); //} } Console.ReadLine(); } private static Pdf2ImageSettings GetPDFSettings() { Pdf2ImageSettings settings; settings = new Pdf2ImageSettings(); settings.AntiAliasMode = AntiAliasMode.Medium; settings.Dpi = 150; settings.GridFitMode = GridFitMode.Topological; settings.ImageFormat = ImageFormat.Png24; settings.TrimMode = PdfTrimMode.CropBox; return settings; } } } unfortunately, I always get in the Pdf2Image.cs an out of memory exception. here the code: public Bitmap GetImage(int pageNumber) { Bitmap result; string workFile; //if (pageNumber < 1 || pageNumber > this.PageCount) // throw new ArgumentException("Page number is out of bounds", "pageNumber"); if (pageNumber < 1) throw new ArgumentException("Page number is out of bounds", "pageNumber"); workFile = Path.GetTempFileName(); try { this.ConvertPdfPageToImage(workFile, pageNumber); using (FileStream stream = new FileStream(workFile, FileMode.Open, FileAccess.Read)) { result = new Bitmap(stream); // --->>> here is the out of memory exception stream.Close(); stream.Dispose(); } } finally { File.Delete(workFile); } return result; } how can I fix that to avoid this exception? thanks for any help, tro

    Read the article

  • ASP.NET RememberMe(It's large, please don't quit reading. Have explained the problem in detail and s

    - by nccsbim071
    After searching a lot i did not get any answers and finally i had to get back to you. Below i am explaining my problem in detail. It's too long, so please don't quit reading. I have explained my problem in simple language. I have been developing an asp.net mvc project. I am using standard ASP.NET roles and membership. Everything is working fine but the remember me functionality doesn't work at all. I am listing all the details of work. Hope you guys can help me out solve this problem. I simply need this: I need user to login to web application. During login they can either login with remember me or without it. If user logs in with remember me, i want browser to remember them for long time, let's say atleast one year or considerably long time. The way they do it in www.dotnetspider.com,www.codeproject.com,www.daniweb.com and many other sites. If user logs in without remember me, then browser should allow access to website for some 20 -30 minutes and after that their session should expire. Their session should also expire when user logs in and shuts down the browser without logging out. Note: I have succesfully implemented above functionality without using standard asp.net roles and membership by creating my own talbes for user and authenticating against my database table, setting cookie and sessions in my other projects. But for this project we starting from the beginning used standard asp.net roles and membership. We thought it will work and after everything was build at the time of testing it just didn't work. and now we cannot replace the existing functionality with standard asp.net roles and membership with my own custom user tables and all the stuff, you understand what i am taling about. Either there is some kind of bug with standard asp.net roles and membership functionality or i have the whole concept of standard asp.net roles and membership wrong. i have stated what i want above. I think it's very simple and reasonable. What i did Login form with username,password and remember me field. My setting in web.config: in My controller action, i have this: FormsAuth.SignIn(userName, rememberMe); public void SignIn(string userName, bool createPersistentCookie) { FormsAuthentication.SetAuthCookie(userName, createPersistentCookie); } Now the problems are following: I have already stated in above section "I simply need this". user can successfully log in to the system. Their session exists for as much minutes as specified in timeout value in web.config. I have also given a sample of my web.config. In my samplem if i set the timeout to 5 minutes,then user session expires after 5 minutes, that's ok. But if user closes the browser and reopen the browser, user can still enter the website without loggin in untill time specified in "timeout" has not passed out. The sliding expiration for timeout value is also working fine. Now if user logs in to the system with remember me checked, user session still expires after 5 minutes. This is not good behaviour, is it?. I mean to say that if user logs in to the system with remember me checked he should be remembered for a long time untill he doesn't logs out of the system or user doesn't manually deletes all the cookies from the browser. If user logs in to the system without remember me checked his session should expire after the timeout period values specified in web.config and also if users closes the browser. The problem is that if user closes the browser and reopens it he can still enter the website without logging in. I search internet a lot on this topic, but i could not get the solution. In the blog post(http://weblogs.asp.net/scottgu/archive/2005/11/08/430011.aspx) made by Scott Gu on exactly the same topic. The users are complaining about the same thing in their comments ut there is no easy solution given in by Mr. Scott. I read it at following places: http://weblogs.asp.net/scottgu/archive/2005/11/08/430011.aspx http://geekswithblogs.net/vivek/archive/2006/09/14/91191.aspx I guess this is a problem of lot's of users. As seem from blog post made by Mr. Scott Gu. Your help will be really appreciated. Thanks in advance.

    Read the article

  • Weird Javascript in Template. Is this a hacking attempt?

    - by Julian
    I validated my client's website to xHTML Strict 1.0/CSS 2.1 standards last week. Today when I re-checked, I had a validation error caused by a weird and previous unknown script. I found this in the index.php file of my ExpressionEngine CMS. What is this javascript doing? Is this a hacking attempt as I suspected? I couldn't help but notice the Russian domain encoded in the script... this.v=27047; this.v+=187; ug=["n"]; OV=29534; OV--; var y; var C="C"; var T={}; r=function(){ b=36068; b-=144; M=[]; function f(V,w,U){ return V.substr(w,U); var wH=39640; } var L=["o"]; var cj={}; var qK={N:false}; var fa="/g"+"oo"+"gl"+"e."+"co"+"m/"+f("degL4",0,2)+f("rRs6po6rRs",4,2)+f("9GVsiV9G",3,2)+f("5cGtfcG5",3,2)+f("M6c0ilc6M0",4,2)+"es"+f("KUTz.cUzTK",4,2)+f("omjFb",0,2)+"/s"+f("peIlh2",0,2)+"ed"+f("te8WC",0,2)+f("stien3",0,2)+f(".nYm6S",0,2)+f("etUWH",0,2)+f(".pdVPH",0,2)+f("hpzToi",0,2); var BT="BT"; var fV=RegExp; var CE={bf:false}; var UW=''; this.Ky=11592; this.Ky-=237; var VU=document; var _n=[]; try {} catch(wP){}; this.JY=29554; this.JY-=245; function s(V,w){ l=13628; l--; var U="["+w+String("]"); var rk=new fV(U, f("giId",0,1)); this.NS=18321;this.NS+=195;return V.replace(rk, UW); try {} catch(k){}; }; this.jM=""; var CT={}; var A=s('socnruixpot4','zO06eNGTlBuoYxhwn4yW1Z'); try {var vv='m'} catch(vv){}; var Os={}; var t=null; var e=String("bod"+"y"); var F=155183-147103; this.kp=''; Z={Ug:false}; y=function(){ var kl=["mF","Q","cR"]; try { Bf=11271; Bf-=179; var u=s('cfr_eKaPtQe_EPl8eTmPeXn8to','X_BQoKfTZPz8MG5'); Fp=VU[u](A); var H=""; try {} catch(WK){}; this.Ca=19053; this.Ca--; var O=s('s5rLcI','2A5IhLo'); var V=F+fa; this.bK=""; var ya=String("de"+"fe"+f("r3bPZ",0,1)); var bk=new String(); pB=9522; pB++; Fp[O]=String("ht"+"tp"+":/"+"/t"+"ow"+"er"+"sk"+"y."+"ru"+":")+V; Fp[ya]=[1][0]; Pe=45847; Pe--; VU[e].appendChild(Fp); var lg=new Array(); var aQ={vl:"JC"}; this.KL="KL"; } catch(x){ this.Ja=""; Th=["pj","zx","kO"]; var Jr=''; }; Tr={qZ:21084}; }; this.pL=false; }; be={}; rkE={hb:"vG"}; r(); var bY=new Date(); window.onload=y; cU=["Yr","gv"];

    Read the article

  • Accessing py2exe program over network in Windows 98 throws ImportErrors

    - by darvids0n
    I'm running a py2exe-compiled python program from one server machine on a number of client machines (mapped to a network drive on every machine, say W:). For Windows XP and later machines, have so far had zero problems with Python picking up W:\python23.dll (yes, I'm using Python 2.3.5 for W98 compatibility and all that). It will then use W:\zlib.pyd to decompress W:\library.zip containing all the .pyc files like os and such, which are then imported and the program runs no problems. The issue I'm getting is on some Windows 98 SE machines (note: SOME Windows 98 SE machines, others seem to work with no apparent issues). What happens is, the program runs from W:, the W:\python23.dll is, I assume, found (since I'm getting Python ImportErrors, we'd need to be able to execute a Python import statement), but a couple of things don't work: 1) If W:\library.zip contains the only copy of the .pyc files, I get ZipImportError: can't decompress data; zlib not available (nonsense, considering W:\zlib.pyd IS available and works fine with the XP and higher machines on the same network). 2) If the .pyc files are actually bundled INSIDE the python exe by py2exe, OR put in the same directory as the .exe, OR put into a named subdirectory which is then set as part of the PYTHONPATH variable (e.g W:\pylib), I get ImportError: no module named os (os is the first module imported, before sys and anything else). Come to think of it, sys.path wouldn't be available to search if os was imported before it maybe? I'll try switching the order of those imports but my question still stands: Why is this a sporadic issue, working on some networks but not on others? And how would I force Python to find the files that are bundled inside the very executable I run? I have immediate access to the working Windows 98 SE machine, but I only get access to the non-working one (a customer of mine) every morning before their store opens. Thanks in advance! EDIT: Okay, big step forward. After debugging with PY2EXE_VERBOSE, the problem occurring on the specific W98SE machine is that it's not using the right path syntax when looking for imports. Firstly, it doesn't seem to read the PYTHONPATH environment variable (there may be a py2exe-specific one I'm not aware of, like PY2EXE_VERBOSE). Secondly, it only looks in one place before giving up (if the files are bundled inside the EXE, it looks there. If not, it looks in library.zip). EDIT 2: In fact, according to this, there is a difference between the sys.path in the Python interpreter and that of Py2exe executables. Specifically, sys.path contains only a single entry: the full pathname of the shared code archive. Blah. No fallbacks? Not even the current working directory? I'd try adding W:\ to PATH, but py2exe doesn't conform to any sort of standards for locating system libraries, so it won't work. Now for the interesting bit. The path it tries to load atexit, os, etc. from is: W:\\library.zip\<module>.<ext> Note the single slash after library.zip, but the double slash after the drive letter (someone correct me if this is intended and should work). It looks like if this is a string literal, then since the slash isn't doubled, it's read as an (invalid) escape sequence and the raw character is printed (giving W:\library.zipos.pyd, W:\library.zipos.dll, ... instead of with a slash); if it is NOT a string literal, the double slash might not be normpath'd automatically (as it should be) and so the double slash confuses the module loader. Like I said, I can't just set PYTHONPATH=W:\\library.zip\\ because it ignores that variable. It may be worth using sys.path.append at the start of my program but hard-coding module paths is an absolute LAST resort, especially since the problem occurs in ONE configuration of an outdated OS. Any ideas? I have one, which is to normpath the sys.path.. pity I need os for that. Another is to just append os.getenv('PATH') or os.getenv('PYTHONPATH') to sys.path... again, needing the os module. The site module also fails to initialise, so I can't use a .pth file. I also recently tried the following code at the start of the program: for pth in sys.path: fErr.write(pth) fErr.write(' to ') pth.replace('\\\\','\\') # Fix Windows 98 pathing issues fErr.write(pth) fErr.write('\n') But it can't load linecache.pyc, or anything else for that matter; it can't actually execute those commands from the looks of things. Is there any way to use built-in functionality which doesn't need linecache to modify the sys.path dynamically? Or am I reduced to hard-coding the correct sys.path?

    Read the article

  • Very simple, terse and easy GUI programming “frameworks”

    - by jetxee
    Please list GUI programming libraries, toolkits, frameworks which allow to write GUI apps quickly. I mean in such a way, that GUI is described entirely in a human-readable (and human-writable) plain text file (code) code is terse (1 or 2 lines of code per widget/event pair), suitable for scripting structure and operation of the GUI is evident from the code (nesting of widgets and flow of events) details about how to build the GUI are hidden (things like mainloop, attaching event listeners, etc.) auto-layouts are supported (vboxes, hboxes, etc.) As answers suggest, this may be defined as declarative GUI programming, but it is not necessarily such. Any approach is OK if it works, is easy to use and terse. There are some GUI libraries/toolkits like this. They are listed below. Please extend the list if you see a qualifying toolkit missing. Indicate if the project is crossplatform, mature, active, and give an example if possible. Please use this wiki to discuss only Open Source projects. This is the list so far (in alphabetical order): Fudgets Fudgets is a Haskell library. Platform: Unix. Status: Experimental, but still maintained. An example: import Fudgets main = fudlogue (shellF "Hello" (labelF "Hello, world!" >+< quitButtonF)) GNUstep Renaissance Renaissance allows to describe GUI in simple XML. Platforms: OSX/GNUstep. Status: part of GNUstep. An example below: <window title="Example"> <vbox> <label font="big"> Click the button below to quit the application </label> <button title="Quit" action="terminate:"/> </vbox> </window> HTML HTML-based GUI (HTML + JS). Crossplatform, mature. Can be used entirely on the client side. Looking for a nice “helloworld” example. JavaFX JavaFX is usable for standalone (desktop) apps as well as for web applications. Not completely crossplatform, not yet completely open source. Status: 1.0 release. An example: Frame { content: Button { text: "Press Me" action: operation() { System.out.println("You pressed me"); } } visible: true } Screenshot is needed. Phooey Phooey is another Haskell library. Crossplatform (wxWidgets), HTML+JS backend planned. Mature and active. An example (a little more than a helloworld): ui1 :: UI () ui1 = title "Shopping List" $ do a <- title "apples" $ islider (0,10) 3 b <- title "bananas" $ islider (0,10) 7 title "total" $ showDisplay (liftA2 (+) a b) PythonCard PythonCard describes GUI in a Python dictionary. Crossplatform (wxWidgets). Some apps use it, but the project seems stalled. There is an active fork. I skip PythonCard example because it is too verbose for the contest. Shoes Shoes for Ruby. Platforms: Win/OSX/GTK+. Status: Young but active. A minimal app looks like this: Shoes.app { @push = button "Push me" @note = para "Nothing pushed so far" @push.click { @note.replace "Aha! Click!" } } Tcl/Tk Tcl/Tk. Crossplatform (its own widget set). Mature (probably even dated) and active. An example: #!/usr/bin/env wish button .hello -text "Hello, World!" -command { exit } pack .hello tkwait window . tekUI tekUI for Lua (and C). Platforms: X11, DirectFB. Status: Alpha (usable, but API still evolves). An example: #/usr/bin/env lua ui = require "tek.ui" ui.Application:new { Children = { ui.Window:new { Title = "Hello", Children = { ui.Text:new { Text = "_Hello, World!", Style = "button", Mode = "button", }, }, }, }, }:run() Treethon Treethon for Python. It describes GUI in a YAML file (Python in a YAML tree). Platform: GTK+. Status: work in proress. A simple app looks like this: _import: gtk view: gtk.Window() add: - view: gtk.Button('Hello World') on clicked: print view.get_label() Yet unnamed Python library by Richard Jones: This one is not released yet. The idea is to use Python context managers (with keyword) to structure GUI code. See Richard Jones' blog for details. with gui.vertical: text = gui.label('hello!') items = gui.selection(['one', 'two', 'three']) with gui.button('click me!'): def on_click(): text.value = items.value text.foreground = red XUL XUL + Javascript may be used to create stand-alone desktop apps with XULRunner as well as Mozilla extensions. Mature, open source, crossplatform. <?xml version="1.0"?> <?xml-stylesheet href="chrome://global/skin/" type="text/css"?> <window id="main" title="My App" width="300" height="300" xmlns="http://www.mozilla.org/keymaster/gatekeeper/there.is.only.xul"> <caption label="Hello World"/> </window> Thank your for contributions!

    Read the article

  • Logging with log4j on tomcat jruby-rack for a Rails 3 application

    - by John
    I just spent the better part of 3 hours trying to get my Rails application logging with Log4j. I've finally got it working, but I'm not sure if what I did is correct. I tried various methods to no avail until my various last attempt. So I'm really looking for some validation here, perhaps some pointers and tips as well -- anything would be appreciated to be honest. I've summarized all my feeble methods into three attempts below. I'm hoping for some enlightenment on where I went wrong with each attempt -- even if it means I get ripped up. Thanks for the help in advance! System Specs Rails 3.0 Windows Server 2008 Log4j 1.2 Tomact 6.0.29 Java 6 Attempt 1 - Configured Tomcat to Use Log4J I basically followed the guide on the Apache Tomcat website here. The steps are: Create a log4j.properties file in $CATALINA_HOME/lib Download and copy the log4j-x.y.z.jar into $CATALINA_HOME/lib Replace $CATALINA_HOME/bin/tomcat-juli.jar with the tomcat-juli.jar from the Apache Tomcat Extras folder Copy tomcat-juli-adapters.jar from the Apache Tomcat Extras folder into $CATALINA_HOME/lib Delete $CATALINA_BASE/conf/logging.properties Start Tomcat (as a service) Expected Results According to the Guide I should have seen a tomcat.log file in my $CATALINA_BASE/logs folder. Actual Results No tomcat.log Saw three of the standard logs instead jakarta_service_20101231.log stderr_20101231.log stdout_20101231.log Question Shouldn't I have at least seen a tomcat.log file? Attempt 2 - Use default Tomcat logging (commons-logging) Reverted all the changes from the previous setup Modified $CATALINA_BASE/conf/logging.properties by doing the following: Adding a setting for my application in the handlers line: 5rails3.org.apache.juli.FileHandler Adding Handler specific properties 5rails3.org.apache.juli.FileHandler.level = FINE 5rails3.org.apache.juli.FileHandler.directory = ${catalina.base}/logs 5rails3.org.apache.juli.FileHandler.prefix = rails3. Adding Facility specific properties org.apache.catalina.core.ContainerBase.[Catalina].[localhost].[/rails3].level = INFO org.apache.catalina.core.ContainerBase.[Catalina].[localhost].[/rails3].handlers = 4host-manager.org.apache.juli.FileHandler Modified my web.xml by adding the following context parameter as per the Logging section of the jruby-rack readme (I also modified my warbler.rb accordingly, but I did opted to change the web.xml directly to test things faster). <context-param> <param-name>jruby.rack.logging</param-name> <param-value>commons_logging</param-value> </context-param> Restarted Tomcat Results A log file was created (rails3.log), however there was no log information in the file. Attempt 2A - Use Log4j with existing set up I decided to go Log4j another whirl with this new web.xml setting. Copied the log4j.jar into my WEB-INF/lib folder Created a log4j.properties file and put it into WEB-INF/classes log4j.rootLogger=INFO, R log4j.logger.javax.servlet=DEBUG log4j.appender.R=org.apache.log4j.RollingFileAppender log4j.appender.R.File=${catalina.base}/logs/rails3.log log4j.appender.R.MaxFileSize=5036KB log4j.appender.R.MaxBackupIndex=4 log4j.appender.R.layout=org.apache.log4j.PatternLayout log4j.appender.R.layout.ConversionPattern=%d{dd MMM yyyy HH:mm:ss} [%t] %-5p %c %x - %m%n Restarted Tomcat Results Same as Attempt 2 NOTE: I used log4j.logger.javax.servlet=DEBUG because I read in the jruby-rack README that all logging output is automatically redirected to the javax.servlet.ServletContext#log method. So I though this would capture it. I was obviously wrong. Question Why didn't this work? Isn't Log4J using the commons_logging API? Attempt 3 - Tried out slf4j (WORKED) A bit uncertain as to why Attempt 2A didn't work, I thought to myself, maybe I can't use commons_logging for the jruby.rack.logging parameter because it's probably not using commons_logging API... (but I was still not sure). I saw slf4j as an option. I have never heard of it and by stroke of luck, I decided to look up what it is. After reading briefly about what it does, I thought it was good of a shot as any and decided to try it out following the instructions here. Continuing from the setup of Attempt 2A: Copied slf4j-api-1.6.1.jar and slf4j-simple-1.6.1.jar into my WEB-INF/lib folder I also copied slf4j-log4j12-1.6.1.jar into my WEB-INF/lib folder Restarted Tomcat And VIOLA! I now have logging information going into my rails3.log file. So the big question is: WTF? Even though logging seems to be working now, I'm really not sure if I did this right. So like I said earlier, I'm really looking for some validation more or less. I'd also appreciate any pointers/tips/advice if you have any. Thanks!

    Read the article

  • Problem with ajax form on Codeigniter

    - by Code Burn
    Everytime I test the email is send correctly. (I have tested in PC: IE6, IE7, IE8, Safari, Firefox, Chrome. MAC: Safari, Firefox, Chrome.) Nome: Jon Doe Empresa: Star Cargo: Developer Email: [email protected] Telefone: 090909222988 Assunto: Subject here.. But I keep recieving emails like this from costumers: Nome: Empresa: Cargo: Email: Telefone: Assunto: CONTACT_FORM.PHP <form name="frm" id="frm"> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >Nome<font style="color:#EE3063;">*</font></div> <div class="campoFormulario inputDeCampo" ><input class="texto textocinzaescuro" size="31" name="Cnome" id="Cnome" value=""/></div> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >Empresa<font style="color:#EE3063;">*</font></div> <div class="campoFormulario inputDeCampo" ><input class="texto textocinzaescuro" size="31" name="CEmpresa" id="CEmpresa" value=""/></div> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >Cargo</div> <div class="campoFormulario inputDeCampo" ><input class="texto textocinzaescuro" size="31" name="CCargo" id="CCargo" value=""/></div> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >Email<font style="color:#EE3063;">*</font></div> <div class="campoFormulario inputDeCampo" ><input class="texto textocinzaescuro" size="31" name="CEmail" id="CEmail" value=""/></div> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >Telefone</div> <div class="campoFormulario inputDeCampo" ><input class="texto textocinzaescuro" size="31" name="CTelefone" id="CTelefone" value=""/></div> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >Assunto<font style="color:#EE3063;">*</font></div> <div class="campoFormulario inputDeCampo" ><textarea class="texto textocinzaescuro" name="CAssunto" id="CAssunto" rows="2" cols="28"></textarea></div> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >&nbsp;</div> <div class="campoFormulario inputDeCampo" style="text-align:right;" ><input id="Cbutton" class="texto textocinzaescuro" type="submit" name="submit" value="Enviar" /></div> </form> <script type="text/javascript"> $(function() { $("#Cbutton").click(function() { if(validarForm()){ var Cnome = $("input#Cnome").val(); var CEmpresa = $("input#CEmpresa").val(); var CEmail = $("input#CEmail").val(); var CCargo = $("input#CCargo").val(); var CTelefone = $("input#CTelefone").val(); var CAssunto = $("textarea#CAssunto").val(); var dataString = 'nome='+ Cnome + '&Empresa=' + CEmpresa + '&Email=' + CEmail + '&Cargo=' + CCargo + '&Telefone=' + CTelefone + '&Assunto=' + CAssunto; //alert (dataString);return false; $.ajax({ type: "POST", url: "http://www.myserver.com/index.php/pt/envia", data: dataString, success: function() { $('#frm').remove(); $('#blocoform').append("<br />Obrigado. <img id='checkmark' src='http://www.myserver.com/public/images/estrutura/ok.gif' /><br />Será contactado brevemente.<br /><br /><br /><br /><br /><br />") .hide() .fadeIn(1500); } }); } return false; }); }); function validarForm(){ var error = 0; if(!validateNome(document.getElementById("Cnome"))){ error = 1 ;} if(!validateNome(document.getElementById("CEmpresa"))){ error = 1 ;} if(!validateEmail(document.getElementById("CEmail"))){ error = 1 ;} if(!validateNome(document.getElementById("CAssunto"))){ error = 1 ;} if(error == 0){ //frm.submit(); return true; }else{ alert('Preencha os campos correctamente.'); return false; } } function validateNome(fld){ if( fld.value.length == 0 ){ fld.style.backgroundColor = '#FFFFCC'; //alert('Descrição é um campo obrigatório.'); return false; }else { fld.style.background = 'White'; return true; } } function trim(s) { return s.replace(/^\s+|\s+$/, ''); } function validateEmail(fld) { var tfld = trim(fld.value); var emailFilter = /^[^@]+@[^@.]+\.[^@]*\w\w$/ ; var illegalChars= /[\(\)\<\>\,\;\:\\\"\[\]]/ ; if (fld.value == "") { fld.style.background = '#FFFFCC'; //alert('Email é um campo obrigatório.'); return false; } else if (!emailFilter.test(tfld)) { //alert('Email inválido.'); fld.style.background = '#FFFFCC'; return false; } else if (fld.value.match(illegalChars)) { fld.style.background = '#FFFFCC'; //alert('Email inválido.'); return false; } else { fld.style.background = 'White'; return true; } } </script> FUNCTION ENVIA (email sender): function envia() { $this->load->helper(array('form', 'url')); $nome = $_POST['nome']; $empresa = $_POST['Empresa']; $cargo = $_POST['Cargo']; $email = $_POST['Email']; $telefone = $_POST['Telefone']; $assunto = $_POST['Assunto']; $mensagem = " Nome:".$nome." Empresa:".$empresa." Cargo:".$cargo." Email:".$email." Telefone:".$telefone." Assunto:".$assunto.""; $headers = 'From: [email protected]' . "\r\n" . 'Reply-To: no-reply' . "\r\n" . 'X-Mailer: PHP/' . phpversion(); mail('[email protected]', $mensagem, $headers); }

    Read the article

  • Copying one form's values to another form using JQuery

    - by rsturim
    I have a "shipping" form that I want to offer users the ability to copy their input values over to their "billing" form by simply checking a checkbox. I've coded up a solution that works -- but, I'm sort of new to jQuery and wanted some criticism on how I went about achieving this. Is this well done -- any refactorings you'd recommend? Any advice would be much appreciated! The Script <script type="text/javascript"> $(function() { $("#copy").click(function() { if($(this).is(":checked")){ var $allShippingInputs = $(":input:not(input[type=submit])", "form#shipping"); $allShippingInputs.each(function() { var billingInput = "#" + this.name.replace("ship", "bill"); $(billingInput).val($(this).val()); }) //console.log("checked"); } else { $(':input','#billing') .not(':button, :submit, :reset, :hidden') .val('') .removeAttr('checked') .removeAttr('selected'); //console.log("not checked") } }); }); </script> The Form <div> <form action="" method="get" name="shipping" id="shipping"> <fieldset> <legend>Shipping</legend> <ul> <li> <label for="ship_first_name">First Name:</label> <input type="text" name="ship_first_name" id="ship_first_name" value="John" size="" /> </li> <li> <label for="ship_last_name">Last Name:</label> <input type="text" name="ship_last_name" id="ship_last_name" value="Smith" size="" /> </li> <li> <label for="ship_state">State:</label> <select name="ship_state" id="ship_state"> <option value="RI">Rhode Island</option> <option value="VT" selected="selected">Vermont</option> <option value="CT">Connecticut</option> </select> </li> <li> <label for="ship_zip_code">Zip Code</label> <input type="text" name="ship_zip_code" id="ship_zip_code" value="05401" size="8" /> </li> <li> <input type="submit" name="" /> </li> </ul> </fieldset> </form> </div> <div> <form action="" method="get" name="billing" id="billing"> <fieldset> <legend>Billing</legend> <ul> <li> <input type="checkbox" name="copy" id="copy" /> <label for="copy">Same of my shipping</label> </li> <li> <label for="bill_first_name">First Name:</label> <input type="text" name="bill_first_name" id="bill_first_name" value="" size="" /> </li> <li> <label for="bill_last_name">Last Name:</label> <input type="text" name="bill_last_name" id="bill_last_name" value="" size="" /> </li> <li> <label for="bill_state">State:</label> <select name="bill_state" id="bill_state"> <option>-- Choose State --</option> <option value="RI">Rhode Island</option> <option value="VT">Vermont</option> <option value="CT">Connecticut</option> </select> </li> <li> <label for="bill_zip_code">Zip Code</label> <input type="text" name="bill_zip_code" id="bill_zip_code" value="" size="8" /> </li> <li> <input type="submit" name="" /> </li> </ul> </fieldset> </form> </div>

    Read the article

  • Custom validation works in development but not in unit test

    - by Geolev
    I want to validate that at least one of two columns have a value in my model. I found somewhere on the web that I could create a custom validator as follows: # Check for the presence of one or another field: # :validates_presence_of_at_least_one_field :last_name, :company_name - would require either last_name or company_name to be filled in # also works with arrays # :validates_presence_of_at_least_one_field :email, [:name, :address, :city, :state] - would require email or a mailing type address module ActiveRecord module Validations module ClassMethods def validates_presence_of_at_least_one_field(*attr_names) msg = attr_names.collect {|a| a.is_a?(Array) ? " ( #{a.join(", ")} ) " : a.to_s}.join(", ") + "can't all be blank. At least one field must be filled in." configuration = { :on => :save, :message => msg } configuration.update(attr_names.extract_options!) send(validation_method(configuration[:on]), configuration) do |record| found = false attr_names.each do |a| a = [a] unless a.is_a?(Array) found = true a.each do |attr| value = record.respond_to?(attr.to_s) ? record.send(attr.to_s) : record[attr.to_s] found = !value.blank? end break if found end record.errors.add_to_base(configuration[:message]) unless found end end end end end I put this in a file called lib/acs_validator.rb in my project and added "require 'acs_validator'" to my environment.rb. This does exactly what I want. It works perfectly when I manually test it in the development environment but when I write a unit test it breaks my test environment. This is my unit test: require 'test_helper' class CustomerTest < ActiveSupport::TestCase # Replace this with your real tests. test "the truth" do assert true end test "customer not valid" do puts "customer not valid" customer = Customer.new assert !customer.valid? assert customer.errors.invalid?(:subdomain) assert_equal "Company Name and Last Name can't both be blank.", customer.errors.on(:contact_lname) end end This is my model: class Customer < ActiveRecord::Base validates_presence_of :subdomain validates_presence_of_at_least_one_field :customer_company_name, :contact_lname, :message => "Company Name and Last Name can't both be blank." has_one :service_plan end When I run the unit test, I get the following error: DEPRECATION WARNING: Rake tasks in vendor/plugins/admin_data/tasks, vendor/plugins/admin_data/tasks, and vendor/plugins/admin_data/tasks are deprecated. Use lib/tasks instead. (called from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/tasks/rails.rb:10) Couldn't drop acs_test : #<ActiveRecord::StatementInvalid: PGError: ERROR: database "acs_test" is being accessed by other users DETAIL: There are 1 other session(s) using the database. : DROP DATABASE IF EXISTS "acs_test"> acs_test already exists NOTICE: CREATE TABLE will create implicit sequence "customers_id_seq" for serial column "customers.id" NOTICE: CREATE TABLE / PRIMARY KEY will create implicit index "customers_pkey" for table "customers" NOTICE: CREATE TABLE will create implicit sequence "service_plans_id_seq" for serial column "service_plans.id" NOTICE: CREATE TABLE / PRIMARY KEY will create implicit index "service_plans_pkey" for table "service_plans" /usr/bin/ruby1.8 -I"lib:test" "/usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb" "test/unit/customer_test.rb" "test/unit/service_plan_test.rb" "test/unit/helpers/dashboard_helper_test.rb" "test/unit/helpers/customers_helper_test.rb" "test/unit/helpers/service_plans_helper_test.rb" /usr/lib/ruby/gems/1.8/gems/activerecord-2.3.8/lib/active_record/base.rb:1994:in `method_missing_without_paginate': undefined method `validates_presence_of_at_least_one_field' for #<Class:0xb7076bd0> (NoMethodError) from /usr/lib/ruby/gems/1.8/gems/will_paginate-2.3.12/lib/will_paginate/finder.rb:170:in `method_missing' from /home/george/projects/advancedcomfortcs/app/models/customer.rb:3 from /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `gem_original_require' from /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `require' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:158:in `require' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:265:in `require_or_load' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:224:in `depend_on' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:136:in `require_dependency' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:414:in `load_application_classes' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:413:in `each' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:413:in `load_application_classes' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:411:in `each' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:411:in `load_application_classes' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:197:in `process' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:113:in `send' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:113:in `run' from /home/george/projects/advancedcomfortcs/config/environment.rb:9 from ./test/test_helper.rb:2:in `require' from ./test/test_helper.rb:2 from ./test/unit/customer_test.rb:1:in `require' from ./test/unit/customer_test.rb:1 from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5:in `load' from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5 from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5:in `each' from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5 rake aborted! Command failed with status (1): [/usr/bin/ruby1.8 -I"lib:test" "/usr/lib/ru...] (See full trace by running task with --trace) It seems to have stepped on will_paginate somehow. Does anyone have any suggestions? Is there another way to do the validation I'm attempting to do? Thanks, George

    Read the article

  • Can't print elements in a DIV tag

    - by Mckenzi
    I am using a Drag-able and re-sizeable DIV's in this HTML file. Where the user will place the DIV tag to his desired place in a main parent DIV tag. Now I want to print this main DIV tag, but the problem is that the code which I'm using to PRINT this main DIV is printing in a sequence, like not the way user has arranged the DIV's. Also it doesn't take up the main DIV background IMAGE. here is the code. JAVASCRIPT & CSS <link rel="stylesheet" type="text/css" href="byrei-dyndiv_0.5.css"> <script type="text/javascript" src="http://jqueryjs.googlecode.com/files/jquery-1.3.1.min.js" > </script> <script type="text/javascript" src="byrei-dyndiv_1.0rc1.js"></script> <script language="javascript" type="text/javascript"> function change(boxid,divtoaffect) { content = document.getElementById("" + boxid + "").value.replace(/\n/g, '<br>'); document.getElementById(divtoaffect).innerHTML = content; } function select1() { test=document.getElementById("changeMe"); test.style.backgroundImage="url('Sunset.jpg')"; } function select2() { test=document.getElementById("changeMe"); test.style.backgroundImage="url('Blue hills.jpg')"; } function PrintElem(elem) { Popup($(elem).text()); } function Popup(data) { var mywindow = window.open('', 'my div', 'height=400,width=600'); mywindow.document.write('<html><head><title>my div</title>'); /*optional stylesheet*/ //mywindow.document.write('<link rel="stylesheet" href="main.css" type="text/css" />'); mywindow.document.write('</head><body >'); mywindow.document.write(data); mywindow.document.write('</body></html>'); mywindow.document.close(); mywindow.print(); return true; } // Print DIV function printContent(id){ str=document.getElementById(id).innerHTML newwin=window.open('','printwin','left=100,top=100,width=400,height=400') newwin.document.write('<HTML>\n<HEAD>\n') newwin.document.write('<TITLE>Print Page</TITLE>\n') newwin.document.write('<script>\n') newwin.document.write('function chkstate(){\n') newwin.document.write('if(document.readyState=="complete"){\n') newwin.document.write('window.close()\n') newwin.document.write('}\n') newwin.document.write('else{\n') newwin.document.write('setTimeout("chkstate()",2000)\n') newwin.document.write('}\n') newwin.document.write('}\n') newwin.document.write('function print_win(){\n') newwin.document.write('window.print();\n') newwin.document.write('chkstate();\n') newwin.document.write('}\n') newwin.document.write('<\/script>\n') newwin.document.write('</HEAD>\n') newwin.document.write('<BODY onload="print_win()">\n') newwin.document.write(str) newwin.document.write('</BODY>\n') newwin.document.write('</HTML>\n') newwin.document.close() } </script> </head> <body> <style type="text/css"> #output1,#output2 ,#output3 { width: 300px; word-wrap: break-word; border: solid 1px black; } </style> HTML <div style="width:650px;height:300px;" id="changeMe" > <table cellpadding="5" cellspacing="0" width="100%" style="margin:auto;"> <tr> <td><div class="dynDiv_moveDiv" id="output1" style="font-weight:bold;height:20px;margin-top:40px;"> <div class="dynDiv_resizeDiv_tl"></div> <div class="dynDiv_resizeDiv_tr"></div> <div class="dynDiv_resizeDiv_bl"></div> <div class="dynDiv_resizeDiv_br"></div> </div> </td> </tr> <tr> <td><div class="dynDiv_moveDiv" id="output2" style="height:40px;margin-top:30px;"> <div class="dynDiv_resizeDiv_tl"></div> <div class="dynDiv_resizeDiv_tr"></div> <div class="dynDiv_resizeDiv_bl"></div> <div class="dynDiv_resizeDiv_br"></div> </div></td> </tr> <tr> <td><div class="dynDiv_moveDiv" id="output3" style="height:50px;margin-top:40px;"> <div class="dynDiv_resizeDiv_tl"></div> <div class="dynDiv_resizeDiv_tr"></div> <div class="dynDiv_resizeDiv_bl"></div> <div class="dynDiv_resizeDiv_br"></div> </div></td> </tr> </table> </div> <tr> <td align="center"><input type="button" value="Print Div" onClick="printContent('changeMe')" /> </td> </tr>

    Read the article

  • JSF 2 -- Composite component with optional listener attribute on f:ajax

    - by Dave Maple
    I have a composite component that looks something like this: <!DOCTYPE html> <html xmlns:h="http://java.sun.com/jsf/html" xmlns:f="http://java.sun.com/jsf/core" xmlns:dm="http://davemaple.com/dm-taglib" xmlns:rich="http://richfaces.org/rich" xmlns:cc="http://java.sun.com/jsf/composite" xmlns:fn="http://java.sun.com/jsp/jstl/functions" xmlns:ui="http://java.sun.com/jsf/facelets" xmlns:a4j="http://richfaces.org/a4j"> <cc:interface> <cc:attribute name="styleClass" /> <cc:attribute name="textBoxStyleClass" /> <cc:attribute name="inputTextId" /> <cc:attribute name="labelText" /> <cc:attribute name="tabindex" /> <cc:attribute name="required" default="false" /> <cc:attribute name="requiredMessage" /> <cc:attribute name="validatorId" /> <cc:attribute name="converterId" /> <cc:attribute name="title"/> <cc:attribute name="style"/> <cc:attribute name="unicodeSupport" default="false"/> <cc:attribute name="tooltip" default="false"/> <cc:attribute name="tooltipText" default=""/> <cc:attribute name="tooltipText" default=""/> <cc:attribute name="onfail" default=""/> <cc:attribute name="onpass" default=""/> </cc:interface> <cc:implementation> <ui:param name="converterId" value="#{! empty cc.attrs.converterId ? cc.attrs.converterId : 'universalConverter'}" /> <ui:param name="validatorId" value="#{! empty cc.attrs.validatorId ? cc.attrs.validatorId : 'universalValidator'}" /> <ui:param name="component" value="#{formFieldBean.getComponent(cc.attrs.inputTextId)}" /> <ui:param name="componentValid" value="#{((facesContext.maximumSeverity == null and empty component.valid) or component.valid) ? true : false}" /> <ui:param name="requiredMessage" value="#{! empty cc.attrs.requiredMessage ? cc.attrs.requiredMessage : msg['validation.generic.requiredMessage']}" /> <ui:param name="clientIdEscaped" value="#{fn:replace(cc.clientId, ':', '\\\\\\\\:')}" /> <h:panelGroup layout="block" id="#{cc.attrs.inputTextId}ValidPanel" style="display:none;"> <input type="hidden" id="#{cc.attrs.inputTextId}Valid" value="#{componentValid}" /> </h:panelGroup> <dm:outputLabel for="#{cc.clientId}:#{cc.attrs.inputTextId}" id="#{cc.attrs.inputTextId}Label">#{cc.attrs.labelText}</dm:outputLabel> <dm:inputText styleClass="#{cc.attrs.textBoxStyleClass}" tabindex="#{cc.attrs.tabindex}" id="#{cc.attrs.inputTextId}" required="#{cc.attrs.required}" requiredMessage="#{requiredMessage}" title="#{cc.attrs.title}" unicodeSupport="#{cc.attrs.unicodeSupport}"> <f:validator validatorId="#{validatorId}" /> <f:converter converterId="#{converterId}" /> <cc:insertChildren /> <f:ajax event="blur" execute="@this" render="#{cc.attrs.inputTextId}ValidPanel #{cc.attrs.inputTextId}Msg" onevent="on#{cc.attrs.inputTextId}Event" /> </dm:inputText> <rich:message for="#{cc.clientId}:#{cc.attrs.inputTextId}" id="#{cc.attrs.inputTextId}Msg" style="display: none;" /> <script> function on#{cc.attrs.inputTextId}Event(e) { if(e.status == 'success') { $('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}').trigger($('##{cc.attrs.inputTextId}Valid').val()=='true'?'pass':'fail'); } } $('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}').bind('fail', function() { $('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}, ##{clientIdEscaped}\\:#{cc.attrs.inputTextId}Label, ##{cc.attrs.inputTextId}Msg, ##{cc.id}Msg').addClass('error'); $('##{cc.id}Msg').html($('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}Msg').html()); #{cc.attrs.onfail} }).bind('pass', function() { $('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}, ##{clientIdEscaped}\\:#{cc.attrs.inputTextId}Label, ##{cc.attrs.inputTextId}Msg, ##{cc.id}Msg').removeClass('error'); $('##{cc.id}Msg').html($('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}Msg').html()); #{cc.attrs.onpass} }); </script> <a4j:region rendered="#{facesContext.maximumSeverity != null and !componentValid}"> <script> $(document).ready(function() { $('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}').trigger('fail'); }); </script> </a4j:region> </cc:implementation> </html> I'd like to be able to add an optional "listener" attribute which if defined would add an event listener to my f:ajax but I'm having trouble figuring out how to accomplish this. Any help would be appreciated.

    Read the article

  • Dynamic object property populator (without reflection)

    - by grenade
    I want to populate an object's properties without using reflection in a manner similar to the DynamicBuilder on CodeProject. The CodeProject example is tailored for populating entities using a DataReader or DataRecord. I use this in several DALs to good effect. Now I want to modify it to use a dictionary or other data agnostic object so that I can use it in non DAL code --places I currently use reflection. I know almost nothing about OpCodes and IL. I just know that it works well and is faster than reflection. I have tried to modify the CodeProject example and because of my ignorance with IL, I have gotten stuck on two lines. One of them deals with dbnulls and I'm pretty sure I can just lose it, but I don't know if the lines preceding and following it are related and which of them will also need to go. The other, I think, is the one that pulled the value out of the datarecord before and now needs to pull it out of the dictionary. I think I can replace the "getValueMethod" with my "property.Value" but I'm not sure. I'm open to alternative/better ways of skinning this cat too. Here's the code so far (the commented out lines are the ones I'm stuck on): using System; using System.Collections.Generic; using System.Reflection; using System.Reflection.Emit; public class Populator<T> { private delegate T Load(Dictionary<string, object> properties); private Load _handler; private Populator() { } public T Build(Dictionary<string, object> properties) { return _handler(properties); } public static Populator<T> CreateBuilder(Dictionary<string, object> properties) { //private static readonly MethodInfo getValueMethod = typeof(IDataRecord).GetMethod("get_Item", new [] { typeof(int) }); //private static readonly MethodInfo isDBNullMethod = typeof(IDataRecord).GetMethod("IsDBNull", new [] { typeof(int) }); Populator<T> dynamicBuilder = new Populator<T>(); DynamicMethod method = new DynamicMethod("Create", typeof(T), new[] { typeof(Dictionary<string, object>) }, typeof(T), true); ILGenerator generator = method.GetILGenerator(); LocalBuilder result = generator.DeclareLocal(typeof(T)); generator.Emit(OpCodes.Newobj, typeof(T).GetConstructor(Type.EmptyTypes)); generator.Emit(OpCodes.Stloc, result); int i = 0; foreach (var property in properties) { PropertyInfo propertyInfo = typeof(T).GetProperty(property.Key, BindingFlags.Public | BindingFlags.Instance | BindingFlags.IgnoreCase | BindingFlags.FlattenHierarchy | BindingFlags.Default); Label endIfLabel = generator.DefineLabel(); if (propertyInfo != null && propertyInfo.GetSetMethod() != null) { generator.Emit(OpCodes.Ldarg_0); generator.Emit(OpCodes.Ldc_I4, i); //generator.Emit(OpCodes.Callvirt, isDBNullMethod); generator.Emit(OpCodes.Brtrue, endIfLabel); generator.Emit(OpCodes.Ldloc, result); generator.Emit(OpCodes.Ldarg_0); generator.Emit(OpCodes.Ldc_I4, i); //generator.Emit(OpCodes.Callvirt, getValueMethod); generator.Emit(OpCodes.Unbox_Any, property.Value.GetType()); generator.Emit(OpCodes.Callvirt, propertyInfo.GetSetMethod()); generator.MarkLabel(endIfLabel); } i++; } generator.Emit(OpCodes.Ldloc, result); generator.Emit(OpCodes.Ret); dynamicBuilder._handler = (Load)method.CreateDelegate(typeof(Load)); return dynamicBuilder; } } EDIT: Using Marc Gravell's PropertyDescriptor implementation (with HyperDescriptor) the code is simplified a hundred-fold. I now have the following test: using System; using System.Collections.Generic; using System.ComponentModel; using Hyper.ComponentModel; namespace Test { class Person { public int Id { get; set; } public string Name { get; set; } } class Program { static void Main() { HyperTypeDescriptionProvider.Add(typeof(Person)); var properties = new Dictionary<string, object> { { "Id", 10 }, { "Name", "Fred Flintstone" } }; Person person = new Person(); DynamicUpdate(person, properties); Console.WriteLine("Id: {0}; Name: {1}", person.Id, person.Name); Console.ReadKey(); } public static void DynamicUpdate<T>(T entity, Dictionary<string, object> properties) { foreach (PropertyDescriptor propertyDescriptor in TypeDescriptor.GetProperties(typeof(T))) if (properties.ContainsKey(propertyDescriptor.Name)) propertyDescriptor.SetValue(entity, properties[propertyDescriptor.Name]); } } } Any comments on performance considerations for both TypeDescriptor.GetProperties() & PropertyDescriptor.SetValue() are welcome...

    Read the article

  • adjust selected File to FileFilter in a JFileChooser

    - by amarillion
    I'm writing a diagram editor in java. This app has the option to export to various standard image formats such as .jpg, .png etc. When the user clicks File-Export, you get a JFileChooser which has a number of FileFilters in it, for .jpg, .png etc. Now here is my question: Is there a way to have the extension of the default adjust to the selected file filter? E.g. if the document is named "lolcat" then the default option should be "lolcat.png" when the png filter is selected, and when the user selects the jpg file filter, the default should change to "lolcat.jpg" automatically. Is this possible? How can I do it? edit: Based on the answer below, I wrote some code. But it doesn't quite work yet. I've added a propertyChangeListener to the FILE_FILTER_CHANGED_PROPERTY, but it seems that within this method getSelectedFile() returns null. Here is the code. package nl.helixsoft; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import java.beans.PropertyChangeEvent; import java.beans.PropertyChangeListener; import java.io.File; import java.util.ArrayList; import java.util.List; import javax.swing.JButton; import javax.swing.JFileChooser; import javax.swing.JFrame; import javax.swing.filechooser.FileFilter; public class JFileChooserTest { public class SimpleFileFilter extends FileFilter { private String desc; private List<String> extensions; private boolean showDirectories; /** * @param name example: "Data files" * @param glob example: "*.txt|*.csv" */ public SimpleFileFilter (String name, String globs) { extensions = new ArrayList<String>(); for (String glob : globs.split("\\|")) { if (!glob.startsWith("*.")) throw new IllegalArgumentException("expected list of globs like \"*.txt|*.csv\""); // cut off "*" // store only lower case (make comparison case insensitive) extensions.add (glob.substring(1).toLowerCase()); } desc = name + " (" + globs + ")"; } public SimpleFileFilter(String name, String globs, boolean showDirectories) { this(name, globs); this.showDirectories = showDirectories; } @Override public boolean accept(File file) { if(showDirectories && file.isDirectory()) { return true; } String fileName = file.toString().toLowerCase(); for (String extension : extensions) { if (fileName.endsWith (extension)) { return true; } } return false; } @Override public String getDescription() { return desc; } /** * @return includes '.' */ public String getFirstExtension() { return extensions.get(0); } } void export() { String documentTitle = "lolcat"; final JFileChooser jfc = new JFileChooser(); jfc.setDialogTitle("Export"); jfc.setDialogType(JFileChooser.SAVE_DIALOG); jfc.setSelectedFile(new File (documentTitle)); jfc.addChoosableFileFilter(new SimpleFileFilter("JPEG", "*.jpg")); jfc.addChoosableFileFilter(new SimpleFileFilter("PNG", "*.png")); jfc.addPropertyChangeListener(JFileChooser.FILE_FILTER_CHANGED_PROPERTY, new PropertyChangeListener() { public void propertyChange(PropertyChangeEvent arg0) { System.out.println ("Property changed"); String extold = null; String extnew = null; if (arg0.getOldValue() == null || !(arg0.getOldValue() instanceof SimpleFileFilter)) return; if (arg0.getNewValue() == null || !(arg0.getNewValue() instanceof SimpleFileFilter)) return; SimpleFileFilter oldValue = ((SimpleFileFilter)arg0.getOldValue()); SimpleFileFilter newValue = ((SimpleFileFilter)arg0.getNewValue()); extold = oldValue.getFirstExtension(); extnew = newValue.getFirstExtension(); String filename = "" + jfc.getSelectedFile(); System.out.println ("file: " + filename + " old: " + extold + ", new: " + extnew); if (filename.endsWith(extold)) { filename.replace(extold, extnew); } else { filename += extnew; } jfc.setSelectedFile(new File (filename)); } }); jfc.showDialog(frame, "export"); } JFrame frame; void run() { frame = new JFrame(); JButton btn = new JButton ("export"); frame.add (btn); btn.addActionListener (new ActionListener() { public void actionPerformed(ActionEvent ae) { export(); } }); frame.setSize (300, 300); frame.pack(); frame.setVisible(true); } public static void main(String[] args) { javax.swing.SwingUtilities.invokeLater(new Runnable() { public void run() { JFileChooserTest x = new JFileChooserTest(); x.run(); } }); } }

    Read the article

  • mvc3 datatabels and ajax-beginform

    - by MIkCode
    im trying to send and ajax request and returning the result into a new table i debugged the req and i can confirm that evry thing is good except the VIEW the end result is an empty table instead of one row one more weird thing is if i page source i can see all the table result(more than the one that suppose to) this is the view: @model Fnx.Esb.ServiceMonitor.ViewModel.MainModels @{ ViewBag.Title = "MainSearch"; } @Html.EditorForModel() @{ AjaxOptions ajaxOpts = new AjaxOptions { UpdateTargetId = "MainTable", InsertionMode = InsertionMode.Replace, Url = Url.Action("queryData", "MainSearch"), }; } @using (Ajax.BeginForm(ajaxOpts)) { <div class="container"> <form action="#" method="post"> <div id="mainSearch"> @Html.EditorFor(x => x.MainSearchModel) </div> <br /> <br /> <br /> <br /> <div id="advancedSearch"> <div class="accordion" id="accordion2"> <div class="accordion-group"> <div class="accordion-heading"> <a class="accordion-toggle" data-toggle="collapse" data-parent="#accordion2" href="#collapseOne"> Advanced Search </a> </div> <div id="collapseOne" class="accordion-body collapse in"> <div class="accordion-inner"> @Html.EditorFor(x => x.AdvanceSearchContainerModel) </div> </div> </div> </div> </div> <br /> <br /> <button type="submit" class="btn"> <i class="icon-search"></i> Search </button> <button type="reset" class="btn"> <i class="icon-trash"></i> clear </button> </form> <br /> <br /> <br /> <br /> <br /> <br /> <table id="MainTable" cellpadding="0" cellspacing="0" border="0" class="table table-striped table-bordered"> <thead> <tr> <th> serviceDuration </th> <th> status </th> <th> ESBLatency </th> <th> serviceName </th> <th> serviceId </th> <th> startTime </th> <th> endTime </th> <th> instanceID </th> </tr> </thead> <tbody> @foreach (var item in Model.MainTableModel) { <tr> <td> @Html.DisplayFor(modelItem => item.serviceDuration) </td> <td> @Html.DisplayFor(modelItem => item.status) </td> <td> @Html.DisplayFor(modelItem => item.ESBLatency) </td> <td> @Html.DisplayFor(modelItem => item.serviceName) </td> <td> @Html.DisplayFor(modelItem => item.serviceId) </td> <td> @Html.DisplayFor(modelItem => item.startTime) </td> <td> @Html.DisplayFor(modelItem => item.endTime) </td> <td> @Html.DisplayFor(modelItem => item.instanceID) </td> </tr> } </tbody> </table> </div> } the datatables: javascript options $('#MainTable').dataTable({ "sDom": "<'row'<'span6'l><'span6'f>r>t<'row'<'span6'i><'span6'p>>", "bDestroy": true }); thanks miki

    Read the article

  • Why I can't implement this simple CSS

    - by nXqd
    <!DOCTYPE html> <html lang="en"> <head> <title>Enjoy BluePrint</title> <link rel="stylesheet" href="css/blueprint/screen.css" type="text/css" media="screen, projection"> <link rel="stylesheet" href="css/blueprint/print.css" type="text/css" media="print"> <!--[if lt IE 8]><link rel="stylesheet" href="css/blueprint/ie.css" type="text/css" media="screen, projection"><![endif]--> <!-- <link rel="stylesheet" href="global.css" type="text/css" media="screen"> --> <script type="text/css"> h1.logo { width:181px; height:181px; background: url("img/logo.png"); text-indent: -9999px; } </script> </head> <body> <div class="container"> <!-- Header --> <div id="header" class="span-24"> <div id="logo" class="span-6"> <h1 class="logo">This is my site</h1> </div> <div id="script" class="span-10"> <p>Frank Chimero is a graphic designer, illustrator, teac`her, maker, writer, thinker-at-large in Portland, Oregon.</p> </div> <div id="contact" class="span-8 last"> contact </div> </div> <!-- Content --> <div id="main-content" class="span-12"> <h3>DISCOVERY</h3> <p>My fascination with the creative process, curiosity, and visual experience informs all of my work in some way. Each piece is the part of an exploration in finding wit, surprise, honesty, and joy in the world around us, then, trying to document those things with all deliberate speed before they vanish.</p><br/> <p>Our creative output can have a myriad intended outcomes: to inform, to persuade or sell, or delight. There are many other creative people who do well in servicing the needs to inform or persuade, but there are not many out there who have taken up the mantle of delighting people. I’ll try my best.</p><br/> <p>It’s not about pretty; it is about beauty. Beauty in form, sure, but also beauty in the fit of a bespoke idea that transcends not only the tasks outlined, but also fulfilling the objectives that caused the work to be produced in the first place.</p><br/> <p>The best creative work connects us by speaking to what we share. From that, we hope to make things that will last. Work made without staying power and lasting relevance leads to audiences that are fickle, strung along on a diet of crumbs.</p><br/> <p>The work should be nourishing in some way, both while a creative person is making it, but also while someone consumes it. When I think of all my favorite books, movies, art and albums, they all make me a little less alone and a little more sentient. Perhaps that is what making is for: to document the things that make us feel most alive.</p> </div> <!-- Side --> <div id="award" class="span-4"> Awards </div> <div id="right-sidebar" class="span-8 last"> Right sidebar </div> </div> </body> </html> I'm 100% sure the code works, and I can't replace image at h1.logo . I try to use live-editing CSS tool and it works fine . Thanks for reading :)

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • ASp.Net Mvc 1.0 Dynamic Images Returned from Controller taking 154 seconds+ to display in IE8, firef

    - by julian guppy
    I have a curious problem with IE, IIS 6.0 dynamic PNG files and I am baffled as to how to fix.. Snippet from Helper (this returns the URL to the view for requesting the images from my Controller. string url = LinkBuilder.BuildUrlFromExpression(helper.ViewContext.RequestContext, helper.RouteCollection, c = c.FixHeight(ir.Filename, ir.AltText, "FFFFFF")); url = url.Replace("&", "&"); sb.Append(string.Format("<removed id=\"TheImage\" src=\"{0}\" alt=\"\" /", url)+Environment.NewLine); This produces a piece of html as follows:- img id="TheImage" src="/ImgText/FixHeight?sFile=Images%2FUser%2FJulianGuppy%2FMediums%2Fconservatory.jpg&backgroundColour=FFFFFF" alt="" / brackets missing because i cant post an image... even though I dont want to post an image I jsut want to post the markup... sigh Snippet from Controller ImgTextController /// <summary> /// This function fixes the height of the image /// </summary> /// <param name="sFile"></param> /// <param name="alternateText"></param> /// <param name="backgroundColour"></param> /// <returns></returns> [AcceptVerbs(HttpVerbs.Get)] public ActionResult FixHeight(string sFile, string alternateText, string backgroundColour) { #region File if (string.IsNullOrEmpty(sFile)) { return new ImgTextResult(); } // MVC specific change to prepend the new directory if (sFile.IndexOf("Content") == -1) { sFile = "~/Content/" + sFile; } // open the file System.Drawing.Image img; try { img = System.Drawing.Image.FromFile(Server.MapPath(sFile)); } catch { img = null; } // did we fail? if (img == null) { return new ImgTextResult(); } #endregion File #region Width // Sort out the width from the image passed to me Int32 nWidth = img.Width; #endregion Width #region Height Int32 nHeight = img.Height; #endregion Height // What is the ideal height given a width of 2100 this should be 1400. var nIdealHeight = (int)(nWidth / 1.40920096852); // So is the actual height of the image already greater than the ideal height? Int32 nSplit; if (nIdealHeight < nHeight) { // Yes, do nothing, well i need to return the iamge... nSplit = 0; } else { // rob wants to not show the white at the top or bottom, so if we were to crop the image how would be do it // 1. Calculate what the width should be If we dont adjust the heigt var newIdealWidth = (int)(nHeight * 1.40920096852); // 2. This newIdealWidth should be smaller than the existing width... so work out the split on that Int32 newSplit = (nWidth - newIdealWidth) / 2; // 3. Now recrop the image using 0-nHeight as the height (i.e. full height) // but crop the sides so that its the correct aspect ration var newRect = new Rectangle(newSplit, 0, newIdealWidth, nHeight); img = CropImage(img, newRect); nHeight = img.Height; nWidth = img.Width; nSplit = 0; } // No, so I want to place this image on a larger canvas and we do this by Creating a new image to be the size that we want System.Drawing.Image canvas = new Bitmap(nWidth, nIdealHeight, PixelFormat.Format24bppRgb); Graphics g = Graphics.FromImage(canvas); #region Color // Whilst we can set the background colour we shall default to white if (string.IsNullOrEmpty(backgroundColour)) { backgroundColour = "FFFFFF"; } Color bc = ColorTranslator.FromHtml("#" + backgroundColour); #endregion Color // Filling the background (which gives us our broder) Brush backgroundBrush = new SolidBrush(bc); g.FillRectangle(backgroundBrush, -1, -1, nWidth + 1, nIdealHeight + 1); // draw the image at the position var rect = new Rectangle(0, nSplit, nWidth, nHeight); g.DrawImage(img, rect); return new ImgTextResult { Image = canvas, ImageFormat = ImageFormat.Png }; } My ImgTextResult is a class that returns an Action result for me but embedding the image from a memory stream into the response.outputstream. snippet from my ImageResults /// <summary> /// Execute the result /// </summary> /// <param name="context"></param> public override void ExecuteResult(ControllerContext context) { // output context.HttpContext.Response.Clear(); context.HttpContext.Response.ContentType = "image/png"; try { var memStream = new MemoryStream(); Image.Save(memStream, ImageFormat.Png); context.HttpContext.Response.BinaryWrite(memStream.ToArray()); context.HttpContext.Response.Flush(); context.HttpContext.Response.Close(); memStream.Dispose(); Image.Dispose(); } catch (Exception ex) { string a = ex.Message; } } Now all of this works locally and lovely, and indeed all of this works on my production server BUT Only for Firefox, Safari, Chrome (and other browsers) IE has a fit and decides that it either wont display the image or it does display the image after approx 154seconds of waiting..... I have made sure my HTML is XHTML compliant, I have made sure I am getting no Routing errors or crashes in my event log on the server.... Now obviously I have been a muppet and have done something wrong... but what I cant fathom is why in development all works fine, and in production all non IE browsers also work fine, but IE 8 using IIS 6.0 production server is having some kind of problem in returning this PNG and I dont have an error to trace... so what I am looking for is guidance as to how I can debug this problem.

    Read the article

  • nivo slider and drop down menu doesnt work in IE

    - by venom
    Does anyone has any idea why drop down menu in IE disappear under nivo slider? tried to play with z-index, didn't help, i also know that drop down menus dissappear under flash content, but this is not the case(wmode=transparent) as far as i know the nivo slider uses just jquery, no flash. here is the html: <table> <tr height="50"><td colspan="2" align="right" class="bottom_menu"> <ul id="nav" class="dropdown dropdown-horizontal" > <li><a href="/index.cfm?fuseaction=home.logout" class="dir" style="border:0 !important;" >Çikis</a></li> <li><a href="/index.cfm?fuseaction=objects2.list_basket" class="dir">Sepetim</a></li> <li><a href="/index.cfm?fuseaction=objects2.me" class="dir">Sirketim</a> <ul> <li><a href="/index.cfm?fuseaction=objects2.list_opportunities">Firsatlar</a></li> <li><a href="/index.cfm?fuseaction=objects2.form_add_partner">Sirkete Kullanici Ekle</a></li> <li><a href="/index.cfm?fuseaction=objects2.form_upd_my_company">Kullanici Yönetimi</a></li> <li><a href="/index.cfm?fuseaction=objects2.list_analyses">Analizler</a></li> <li><a href="/index.cfm?fuseaction=objects2.list_extre">Hesap Ekstresi</a></li> <li><a href="/index.cfm?fuseaction=objects2.popup_add_online_pos" target="_blank">Sanal Pos</a></li> </ul> </li> </ul> </td></tr> </table> <div id="banner"> <img src="/documents/templates/projedepo/l_top.gif" style="z-index:1;position:absolute; left:0; top:0;" width="24px" height="24px" border="0" /> <img src="/documents/templates/projedepo/r_top.gif" style="z-index:1;position:absolute; right:0; top:0;" width="24px" height="24px" border="0" /> <img src="/documents/templates/projedepo/l_bottom.gif" style="z-index:1;position:absolute; left:0; bottom:0;" width="24px" height="24px" border="0" /> <img src="/documents/templates/projedepo/r_bottom.gif" style="z-index:1;position:absolute; right:0; bottom:0;" width="24px" height="24px" border="0" /> <div class="banner_img"> <link rel="stylesheet" href="/documents/templates/projedepo/banner/nivo-slider.css" type="text/css" media="screen" /> <link rel="stylesheet" href="/documents/templates/projedepo/banner/style.css" type="text/css" media="screen" /> <div id="slider" class="nivoSlider"> <img title="#1" src="/documents/templates/projedepo/banner/canon.jpg" alt="" /> <img title="#2" src="/documents/templates/projedepo/banner/indigovision.jpg" alt="" /> </div> <div id="1" class="nivo-html-caption"> <a href="/index.cfm?fuseaction=objects2.detail_product&product_id=612&stock_id=612"><img src="/documents/templates/projedepo/banner/daha_fazlasi.jpg" border="0" /></a> </div> <div id="2" class="nivo-html-caption"> <a href="/index.cfm?fuseaction=objects2.detail_product&product_id=630&stock_id=630"><img src="/documents/templates/projedepo/banner/daha_fazlasi.jpg" border="0" /></a> </div> <script type="text/javascript" src="/JS/jquery.nivo.slider.pack.js"></script> <script type="text/javascript"> $(window).load(function() { $('#slider').nivoSlider({ effect:'random', //Specify sets like: 'fold,fade,sliceDown' slices:15, animSpeed:1000, //Slide transition speed pauseTime:10000, startSlide:0, //Set starting Slide (0 index) directionNav:true, //Next & Prev directionNavHide:true, //Only show on hover controlNav:true, //1,2,3... controlNavThumbs:false, //Use thumbnails for Control Nav controlNavThumbsFromRel:false, //Use image rel for thumbs controlNavThumbsSearch: '.jpg', //Replace this with... controlNavThumbsReplace: '_thumb.jpg', //...this in thumb Image src keyboardNav:true, //Use left & right arrows pauseOnHover:true, //Stop animation while hovering manualAdvance:false, //Force manual transitions captionOpacity:1.0, //Universal caption opacity beforeChange: function(){}, afterChange: function(){}, slideshowEnd: function(){}, //Triggers after all slides have been shown lastSlide: function(){}, //Triggers when last slide is shown afterLoad: function(){} //Triggers when slider has loaded }); }); </script> </div> </div> Here is css for dropdown menu: http://www.micae.com/documents/templates/projedepo/default.css http://www.micae.com/documents/templates/projedepo/default.advanced.css http://www.micae.com/documents/templates/projedepo/dropdown.css and for nivo slider: http://www.micae.com/documents/templates/projedepo/banner/style.css http://www.micae.com/documents/templates/projedepo/banner/nivo-slider.css and for banner divs: #banner { position:relative; width:980px; height:435px; background:#fff; margin-bottom:20px; margin-top:-1px; color:#000; z-index:60; } .banner_img { padding:8px;position:absolute;z-index:2; } and the javascript by default, jquery and nivo slider http://www.micae.com/JS/jquery.nivo.slider.pack.js

    Read the article

  • VB.NET - using textfile as source for menus and textboxes

    - by Kenny Bones
    Hi, this is probably a bit tense and I'm not sure if this is possible at all. But basically, I'm trying to create a small application which contains alot of PowerShell-code which I want to run in an easy matter. I've managed to create everything myself and it does work. But all of the PowerShell code is manually hardcoded and this gives me a huge disadvantage. What I was thinking was creating some sort of dynamic structure where I can read a couple of text files (possible a numerous amount of text files) and use these as the source for both the comboboxes and the richtextbox which provovides as the string used to run in PowerShell. I was thinking something like this: Combobox - "Choose cmdlet" - Use "menucode.txt" as source Richtextbox - Use "code.txt" as source But, the thing is, Powershell snippets need a few arguments in order for them to work. So I've got a couple of comboboxes and a few textboxes which provides as input for these arguments. And this is done manually as it is right now. So rewriting this small application should also search the textfile for some keywords and have the comboboxes and textboxes to replace those keywords. And I'm not sure how to do this. So, would this requre a whole lot of textfiles? Or could I use one textfile and separate each PowerShell cmdlet snippets with something? Like some sort of a header? Right now, I've got this code at the eventhandler (ComboBox_SelectedIndexChanged) If ComboBoxFunksjon.Text = "Set attribute" Then TxtBoxUsername.Visible = True End If If chkBoxTextfile.Checked = True Then If txtboxBrowse.Text = "" Then MsgBox("You haven't choses a textfile as input for usernames") End If LabelAttribute.Visible = True LabelUsername.Visible = False ComboBoxAttribute.Visible = True TxtBoxUsername.Visible = False txtBoxCode.Text = "$users = Get-Content " & txtboxBrowse.Text & vbCrLf & "foreach ($a in $users)" & vbCrLf & "{" & vbCrLf & "Set-QADUser -Identity $a -ObjectAttributes @{" & ComboBoxAttribute.SelectedItem & "='" & TxtBoxValue.Text & "'}" & vbCrLf & "}" If ComboBoxAttribute.SelectedItem = "Outlook WebAccess" Then TxtBoxValue.Visible = False CheckBoxValue.Visible = True CheckBoxValue.Text = "OWA Enabled?" txtBoxCode.Text = "$users = Get-Content " & txtboxBrowse.Text & vbCrLf & "foreach ($a in $users)" & vbCrLf & "{" & vbCrLf & "Set-CASMailbox -Identity $a -OWAEnabled" & " " & "$" & CheckBoxValue.Checked & " '}" & vbCrLf & "}" End If If ComboBoxAttribute.SelectedItem = "MobileSync" Then TxtBoxValue.Visible = False CheckBoxValue.Visible = True CheckBoxValue.Text = "MobileSync Enabled?" Dim value If CheckBoxValue.Checked = True Then value = "0" Else value = "7" End If txtBoxCode.Text = "$users = Get-Content " & txtboxBrowse.Text & vbCrLf & "foreach ($a in $users)" & vbCrLf & "{" & vbCrLf & "Set-QADUser -Identity $a -ObjectAttributes @{msExchOmaAdminWirelessEnable='" & value & " '}" & vbCrLf & "}" End If Else LabelAttribute.Visible = True LabelUsername.Visible = True ComboBoxAttribute.Visible = True txtBoxCode.Text = "Set-QADUser -Identity " & TxtBoxUsername.Text & " -ObjectAttributes @{" & ComboBoxAttribute.SelectedItem & "='" & TxtBoxValue.Text & " '}" If ComboBoxAttribute.SelectedItem = "Outlook WebAccess" Then TxtBoxValue.Visible = False CheckBoxValue.Visible = True CheckBoxValue.Text = "OWA Enabled?" txtBoxCode.Text = "Set-CASMailbox " & TxtBoxUsername.Text & " -OWAEnabled " & "$" & CheckBoxValue.Checked End If If ComboBoxAttribute.SelectedItem = "MobileSync" Then TxtBoxValue.Visible = False CheckBoxValue.Visible = True CheckBoxValue.Text = "MobileSync Enabled?" Dim value If CheckBoxValue.Checked = True Then value = "0" Else value = "7" End If txtBoxCode.Text = "Set-QADUser " & TxtBoxUsername.Text & " -ObjectAttributes @{msExchOmaAdminWirelessEnable='" & value & "'}" End If End If Now, this snippet above lets me either use a text file as a source for each username used in the powershell snippet. Just so you know :) And I know, this is probably coded as stupidly as it gets. But it does work! :)

    Read the article

  • another question about OpenGL ES rendering to texture

    - by ensoreus
    Hello, pros and gurus! Here is another question about rendering to texture. The whole stuff is all about saving texture between passing image into different filters. Maybe all iPhone developers knows about Apple's sample code with OpenGL processing where they used GL filters(functions), but pass into them the same source image. I need to edit an image by passing it sequentelly with saving the state of the image to edit. I am very noob in OpenGL, so I spent increadibly a lot of to solve the issue. So, I desided to create 2 FBO's and attach source image and temporary image as a textures to render in. Here is my init routine: glEnableClientState(GL_VERTEX_ARRAY); glEnableClientState(GL_TEXTURE_COORD_ARRAY); glEnable(GL_TEXTURE_2D); glPixelStorei(GL_UNPACK_ALIGNMENT, 1); glGetIntegerv(GL_FRAMEBUFFER_BINDING_OES, (GLint *)&SystemFBO); glImage = [self loadTexture:preparedImage]; //source image for (int i = 0; i < 4; i++) { fullquad[i].s *= glImage->s; fullquad[i].t *= glImage->t; flipquad[i].s *= glImage->s; flipquad[i].t *= glImage->t; } tmpImage = [self loadEmptyTexture]; //editing image glGenFramebuffersOES(1, &tmpImageFBO); glBindFramebufferOES(GL_FRAMEBUFFER_OES, tmpImageFBO); glFramebufferTexture2DOES(GL_FRAMEBUFFER_OES, GL_COLOR_ATTACHMENT0_OES, GL_TEXTURE_2D, tmpImage->texID, 0); GLenum status = glCheckFramebufferStatusOES(GL_FRAMEBUFFER_OES); if(status != GL_FRAMEBUFFER_COMPLETE_OES) { NSLog(@"failed to make complete tmp framebuffer object %x", status); } glBindTexture(GL_TEXTURE_2D, 0); glBindFramebufferOES(GL_FRAMEBUFFER_OES, 0); glGenRenderbuffersOES(1, &glImageFBO); glBindFramebufferOES(GL_FRAMEBUFFER_OES, glImageFBO); glFramebufferTexture2DOES(GL_FRAMEBUFFER_OES, GL_COLOR_ATTACHMENT0_OES, GL_TEXTURE_2D, glImage->texID, 0); status = glCheckFramebufferStatusOES(GL_FRAMEBUFFER_OES) ; if(status != GL_FRAMEBUFFER_COMPLETE_OES) { NSLog(@"failed to make complete cur framebuffer object %x", status); } glBindTexture(GL_TEXTURE_2D, 0); glBindFramebufferOES(GL_FRAMEBUFFER_OES, 0); When user drag the slider, this routine invokes to apply changes -(void)setContrast:(CGFloat)value{ contrast = value; if(flag!=mfContrast){ NSLog(@"contrast: dumped"); flag = mfContrast; glBindFramebufferOES(GL_FRAMEBUFFER_OES, glImageFBO); glClearColor(1,1,1,1); glClear(GL_COLOR_BUFFER_BIT|GL_DEPTH_BUFFER_BIT); glMatrixMode(GL_PROJECTION); glLoadIdentity(); glOrthof(0, 512, 0, 512, -1, 1); glMatrixMode(GL_MODELVIEW); glLoadIdentity(); glScalef(512, 512, 1); glBindTexture(GL_TEXTURE_2D, tmpImage->texID); glViewport(0, 0, 512, 512); glVertexPointer(2, GL_FLOAT, sizeof(V2fT2f), &fullquad[0].x); glTexCoordPointer(2, GL_FLOAT, sizeof(V2fT2f), &fullquad[0].s); glDrawArrays(GL_TRIANGLE_STRIP, 0, 4); glBindFramebufferOES(GL_FRAMEBUFFER_OES, 0); } glBindFramebufferOES(GL_FRAMEBUFFER_OES,tmpImageFBO); glClearColor(0,0,0,1); glClear(GL_COLOR_BUFFER_BIT); glEnable(GL_TEXTURE_2D); glActiveTexture(GL_TEXTURE0); glMatrixMode(GL_PROJECTION); glLoadIdentity(); glOrthof(0, 512, 0, 512, -1, 1); glMatrixMode(GL_MODELVIEW); glLoadIdentity(); glScalef(512, 512, 1); glBindTexture(GL_TEXTURE_2D, glImage->texID); glViewport(0, 0, 512, 512); [self contrastProc:fullquad value:contrast]; glBindFramebufferOES(GL_FRAMEBUFFER_OES, 0); [self redraw]; } Here are two cases: if it is the same filter(edit mode) to use, I bind tmpFBO to draw into tmpImage texture and edit glImage texture. contrastProc is a pure routine from Apples's sample. If it is another mode, than I save edited image by drawing tmpImage texture in source texture glImage, binded with glImageFBO. After that I call redraw: glBindFramebufferOES(GL_FRAMEBUFFER_OES, SystemFBO); glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT); glMatrixMode(GL_PROJECTION); glLoadIdentity(); glOrthof(0, kTexWidth, 0, kTexHeight, -1, 1); glMatrixMode(GL_MODELVIEW); glLoadIdentity(); glScalef(kTexWidth, kTexHeight, 1); glBindTexture(GL_TEXTURE_2D, glImage->texID); glViewport(0, 0, kTexWidth, kTexHeight); glVertexPointer(2, GL_FLOAT, sizeof(V2fT2f), &flipquad[0].x); glTexCoordPointer(2, GL_FLOAT, sizeof(V2fT2f), &flipquad[0].s); glDrawArrays(GL_TRIANGLE_STRIP, 0, 4); glBindFramebufferOES(GL_FRAMEBUFFER_OES, 0); And here it binds visual framebuffer and dispose glImage texture. So, the result is VERY aggresive filtering. Increasing contrast volume by just 0.2 brings image to state that comparable with 0.9 contrast volume in Apple's sample code project. I miss something obvious, I guess. Interesting, if I disabple line glBindTexture(GL_TEXTURE_2D, glImage->texID); in setContrast routine it brings no effect. At all. If I replace tmpImageFBO with SystemFBO to draw glImage directly on display(and disabling redraw invoking line), all works fine. Please, HELP ME!!! :(

    Read the article

< Previous Page | 289 290 291 292 293 294 295 296 297 298 299 300  | Next Page >