Search Results

Search found 23226 results on 930 pages for 'date format'.

Page 299/930 | < Previous Page | 295 296 297 298 299 300 301 302 303 304 305 306  | Next Page >

  • iphone - UIViewController header view errors

    - by Fiona
    Hi there, So to give a little background: I've an app that has a UITableViewController- (ContactDetailViewController) In this view at the top, I require a few labels and buttons, followed by a group style tableview. So I've created a nib file containing these elements. (ContactHeaderView.xib) Then in the viewDidLoad of ContactDetailViewController I've loaded this nib as the headerView. See implementation file below: #import "ContactDetailViewController.h" #import "DisplayInfoViewController.h" #import "ActionViewController.h" @implementation ContactDetailViewController @synthesize name; @synthesize date; @synthesize nextAction; @synthesize nameLabel; @synthesize usernameLabel; @synthesize nextActionTextField; @synthesize dateLabel; @synthesize contactInfoButton; @synthesize backgroundInfoButton; @synthesize actionDoneButton; - (void)viewDidLoad { [super viewDidLoad]; } - (void)didReceiveMemoryWarning { // Releases the view if it doesn't have a superview. [super didReceiveMemoryWarning]; // Release any cached data, images, etc that aren't in use. } - (void)viewDidUnload { // Release any retained subviews of the main view. // e.g. self.myOutlet = nil; } #pragma mark Table view methods - (NSInteger)numberOfSectionsInTableView:(UITableView *)tableView { return 1; } // Customize the number of rows in the table view. - (NSInteger)tableView:(UITableView *)tableView numberOfRowsInSection:(NSInteger)section { return 3; } - (UIView *) tableView:(UITableView *)tableView viewForHeaderInSection:(NSInteger)section { if (section == 0){ UIViewController *chv = [[[UIViewController alloc] initWithNibName:@"ContactHeaderView" bundle:nil] autorelease]; // self.nameLabel.text = self.name; return chv.view; }else{ return nil; } } - (CGFloat)tableView:(UITableView *)tableView heightForHeaderInSection:(NSInteger)section{ return 300.0; } // Customize the appearance of table view cells. - (UITableViewCell *)tableView:(UITableView *)tableView cellForRowAtIndexPath:(NSIndexPath *)indexPath { static NSString *CellIdentifier = @"Cell"; UITableViewCell *cell = [tableView dequeueReusableCellWithIdentifier:CellIdentifier]; if (cell == nil) { cell = [[[UITableViewCell alloc] initWithStyle:UITableViewCellStyleDefault reuseIdentifier:CellIdentifier] autorelease]; } // Set up the cell... return cell; } - (void)tableView:(UITableView *)tableView didSelectRowAtIndexPath:(NSIndexPath *)indexPath { // Navigation logic may go here. Create and push another view controller. // AnotherViewController *anotherViewController = [[AnotherViewController alloc] initWithNibName:@"AnotherView" bundle:nil]; // [self.navigationController pushViewController:anotherViewController]; // [anotherViewController release]; } /* // Override to support conditional editing of the table view. - (BOOL)tableView:(UITableView *)tableView canEditRowAtIndexPath:(NSIndexPath *)indexPath { // Return NO if you do not want the specified item to be editable. return YES; } */ - (void)dealloc { [name release]; [date release]; [nextAction release]; [nameLabel release]; [usernameLabel release]; [nextActionTextField release]; [dateLabel release]; [contactInfoButton release]; [backgroundInfoButton release]; [actionDoneButton release]; [super dealloc]; } -(IBAction)displayContactInfo:(id)sender{ DisplayInfoViewController *divc = [[DisplayInfoViewController alloc] init]; divc.textView = self.nextAction; divc.title = @"Contact Info"; [self.navigationController pushViewController:divc animated:YES]; [divc release]; } -(IBAction)displayBackgroundInfo:(id)sender{ DisplayInfoViewController *divc = [[DisplayInfoViewController alloc] init]; divc.textView = self.nextAction; divc.title = @"Background Info"; [self.navigationController pushViewController:divc animated:YES]; [divc release]; } -(IBAction)actionDone:(id)sender{ ActionViewController *avc = [[ActionViewController alloc] init]; avc.title = @"Action"; avc.nextAction = self.nextAction; [self.navigationController pushViewController:avc animated:YES]; [avc release]; } @end Here's the Header File: #import <UIKit/UIKit.h> @interface ContactDetailViewController : UITableViewController { NSString *name; NSString *date; NSString *nextAction; IBOutlet UILabel *nameLabel; IBOutlet UILabel *usernameLabel; IBOutlet UITextField *nextActionTextField; IBOutlet UILabel *dateLabel; IBOutlet UIButton *contactInfoButton; IBOutlet UIButton *backgroundInfoButton; IBOutlet UIButton *actionDoneButton; } @property (nonatomic, retain) NSString *name; @property (nonatomic, retain) NSString *date; @property (nonatomic, retain) NSString *nextAction; @property (nonatomic, retain) IBOutlet UILabel *nameLabel; @property (nonatomic, retain) IBOutlet UILabel *usernameLabel; @property (nonatomic, retain) IBOutlet UITextField *nextActionTextField; @property (nonatomic, retain) IBOutlet UILabel *dateLabel; @property (nonatomic, retain) IBOutlet UIButton *contactInfoButton; @property (nonatomic, retain) IBOutlet UIButton *backgroundInfoButton; @property (nonatomic, retain) IBOutlet UIButton *actionDoneButton; -(IBAction)displayContactInfo: (id)sender; -(IBAction)displayBackgroundInfo: (id)sender; -(IBAction)actionDone: (id)sender; @end However when I run it, I get the following error message: * Terminating app due to uncaught exception 'NSUnknownKeyException', reason: '[ setValue:forUndefinedKey:]: this class is not key value coding-compliant for the key nameLabel.' In IB I've hooked up the labels/buttons/textbox to the File's Owner (set the File's Owner Class to: ContactDetailViewController) Anyone any idea what I'm doing wrong? Regards, Fiona

    Read the article

  • GoTo statements, and alternatives (help me please im new) (VB.net)

    - by qais
    Basically I posted a code snippet on a forum asking for help and people pointed out to me that using GoTo statements is very bad programming practise so I'm just wondering, why is it bad? And also what alternative is there to use, like for example in this program ive done for homework the user has to input their date of birth and if the month/date/year are invalid or unrealistic(using if statements checking the integer inputs size, if theres any better way to do this i'd appreciate if you could tell me that also :D) then how would i be able to loop back to ask them again? heres a little extract of my code retryday: Console.WriteLine("Please enter the day you were born : ") day = Console.ReadLine If day > 31 Or day < 1 Then Console.WriteLine("Please enter a valid day") GoTo retryday End If

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • number of days in a period that fall within another period

    - by thomas
    I have 2 independent but contiguous date ranges. The first range is the start and end date for a project. Lets say start = 3/21/10 and end = 5/16/10. The second range is a month boundary (say 3/1/10 to 3/31/10, 4/1/10 to 4/30/10, etc.) I need to figure out how many days in each month fall into the first range. The answer to my example above is March = 10, April = 30, May = 16. I am trying to figure out an excel formula or VBA function that will give me this value. Any thoughts on an algorithm for this? I feel it should be rather easy but I can't seem to figure it out. I have a formula which will return TRUE/FALSE if ANY part of the month range is within the project start/end but not the number of days. That function is below. return month_start <= project_end And month_end >= project_start

    Read the article

  • Change write-host output color based on foreach if elseif outcome in Powershell

    - by Emo
    I'm trying to change the color of write-host output based on the lastrunoutcome property of SQL Server jobs in Powershell....as in...if a job was successfull, the output of lastrunoutcome is "Success" in green....if failed, then "Failed" in red. I have the script working to get the desired job status...I just don't know how to change the colors. Here's what I have so far: # Check for failed SQL jobs on multiple servers [reflection.assembly]::LoadWithPartialName("Microsoft.SqlServer.Smo") | out-null foreach ($svr in get-content "C:\serverlist2.txt") { $a = get-date $BegDate = (Get-Date $a.AddDays(-1) -f d) + " 12:00:00 AM" $BegDateTrans = [system.datetime]$BegDate write-host $svr $srv=New-Object "Microsoft.SqlServer.Management.Smo.Server" "$svr" $srv.jobserver.jobs | where-object {$_.lastrundate -ge $BegDateTrans -and $_.Name -notlike "????????-????-????-????-????????????"} | format-table name,lastrunoutcome,lastrundate -autosize foreach ($_.lastrunoutcome in $srv.jobserver.jobs) { if ($_.lastrunoutcome = 0) { -forgroundcolor red } else {} } } This seems to be the closest I've gotten...but it's giving me an error of ""LastRunOutcome" is a ReadOnly property." Any help would be greatly appreciated! Thanks! Emo

    Read the article

  • TableView - iVar reset when returning from details view

    - by iFloh
    Hi, anyone knows what I need to do to retain my TableView iVars whilst pushing a details view onto the navigation stack? I have an array and a date defined as iVars and the array is retained, whilst the date is not. I checked whether there may be an autorelease hidden somewhere but there are no obvious ones. The properties are defined as nonatomic, retain. I use custom NSDate category methods to determine specific dates at stages. These use NSDateComponents, NSRange and NSCalendar, for example: - (NSDate *)lastDayOfMonth: { NSCalendar *tmpCal = [NSCalendar currentCalendar]; NSDateComponents *tmpDateComponents = [tmpCal components:NSYearCalendarUnit | NSMonthCalendarUnit | NSEraCalendarUnit | NSWeekCalendarUnit | NSWeekdayOrdinalCalendarUnit fromDate:self]; NSRange tmpRange = [tmpCal rangeOfUnit:NSDayCalendarUnit inUnit:NSMonthCalendarUnit forDate:[tmpCal dateFromComponents:tmpDateComponents]]; [tmpDateComponents setDay:tmpRange.length]; [tmpDateComponents setHour:23]; [tmpDateComponents setMinute:59]; [tmpDateComponents setSecond:59]; return [[NSCalendar currentCalendar] dateFromComponents:tmpDateComponents]; } could they somehow be the reason?

    Read the article

  • Convert any currency string to double

    - by James
    I need to store multiple currencies in SQL server. I understand that SQL won't support all different types of currencies (unless I store it as a string, but I don't want to do that). My idea was to convert all the values from their currency format to a standard double and store that instead. Then just re-format based on the culture info when displaying. However, I have tried doing something like e.g. var cultureInfo = new System.Globalization.CultureInfo("en-US"); double plain = return Double.Parse("$20,000.00", cultureInfo); This doesn't ever seem to work it always throws a FormatException. Even removing the currency symbol and just trying to do this based on the number alone does the same thing. This is just an example I want to support pretty much any type of currency. Is there a standard way of stripping out currency and getting the value as a double?

    Read the article

  • json encodes aray

    - by Stan Forrest
    Okay I have been struggling with this for hours. What I am doing is creating array of what I call objects that can be moved around on a calendar. Below is my code $year = date('Y'); $month = date('m'); echo json_encode(array( array( 'id' => 111, 'title' => "Event3", 'start' => "$year-$month-10", 'url' => "http://domain.com/" ), array( 'id' => 222, 'title' => "Event2", 'start' => "$year-$month-20", 'end' => "$year-$month-22", 'url' => "http://domain.com/" ) )); Now here is my problem. I need to loop through a mysql database to retrieve the information for each object. For some reason I can't get this to work. Please help Thanks Stan

    Read the article

  • Documentation of a software project

    - by anijhaw
    I am working with a team that works on a very large software project, we have tons of Documentation that is written in MS WORD format with nohyperlinked indexes, no search ability. Everyday we waste our time trying to find the exact document or reference. I was thinking if there was way or even a professional tool that would convert all this into a wiki format and maybe with a little manual (painful) help be organised into something that improves the accessibility. I use Google Desktop Search to make my life a little easier but its not the best solution I just want to know if any of you faced similar problems and possible solutions to this issue.

    Read the article

  • MYSQL : First and last record of a grouped record (aggregate functions)

    - by Jimmy
    I am trying to do fectch the first and the last record of a 'grouped' record. More precisely, I am doing a query like this SELECT MIN(low_price), MAX(high_price), open, close FROM symbols WHERE date BETWEEN(.. ..) GROUP BY YEARWEEK(date) but I'd like to get the first and the last record of the group. It could by done by doing tons of requests but I have a quite large table. Is there a [low processing time if possible] way to do this with MySQL?

    Read the article

  • JQuery "Any Row" Picker

    - by Eli
    Hi All, I'm looking for a generic "Row Picker" for JQuery. We've all seen the cool "Picker" tools like date pickers, color pickers, time pickers, etc, where you click in a text box and a little calendar or color palate or clock or something comes up. You select something (like a date) and the text box is then populated with a value. I really need an all-purpose "row picker" where you can populate something (a table, divs, etc) with some rows of data (say a list of timezones). This would be linked to a text field and would pop up when the user clicks in the field. They would click a row (say a timezone), and the timezone id would be passed back to the field. Anyone know of anything that does this? Thanks!

    Read the article

  • Iterating Oracle collections of objects with out exploding them

    - by Scott Bailey
    I'm using Oracle object data types to represent a timespan or period. And I've got to do a bunch of operations that involve working with collections of periods. Iterating over collections in SQL is significantly faster than in PL/SQL. CREATE TYPE PERIOD AS OBJECT ( beginning DATE, ending DATE, ... some member functions...); CREATE TYPE PERIOD_TABLE AS TABLE OF PERIOD; -- sample usage SELECT <<period object>>.contains(period2) FROM TABLE(period_table1) t The problem is that the TABLE() function explodes the objects into scalar values, and I really need the objects instead. I could use the scalar values to recreate the objects but this would incur the overhead of re-instantiating the objects. And the period is designed to be subclassed so there would be additional difficulty trying to figure out what to initialize it as. Is there another way to do this that doesn't destroy my objects?

    Read the article

  • Associated models in Rails?

    - by dannymcc
    Hi Everyone, In my rails application I have two models called Kases and Notes. They work in the same way comments do with blog posts, I.e. each Kase entry can have multiple notes attached to it. I have got everything working, but for some reason I cannot get the destroy link to work for the Notes. I think I am overlooking something that is different with associated models to standard models. Notes Controller class NotesController < ApplicationController # POST /notes # POST /notes.xml def create @kase = Kase.find(params[:kase_id]) @note = @kase.notes.create!(params[:note]) respond_to do |format| format.html { redirect_to @kase } format.js end end end Kase Model class Kase < ActiveRecord::Base validates_presence_of :jobno has_many :notes Note Model class Note < ActiveRecord::Base belongs_to :kase end In the Kase show view I call a partial within /notes called _notes.html.erb: Kase Show View <div id="notes"> <h2>Notes</h2> <%= render :partial => @kase.notes %> <% form_for [@kase, Note.new] do |f| %> <p> <h3>Add a new note</h3> <%= f.text_field :body %><%= f.submit "Add Note" %> </p> <% end %> </div> /notes/_note.html.erb <% div_for note do %> <div id="sub-notes"> <p> <%= h(note.body) %><br /> <span style="font-size:smaller">Created <%= time_ago_in_words(note.created_at) %> ago on <%= note.created_at %></span> </p> <%= link_to "Remove Note", kase_path(@kase), :confirm => 'Are you sure?', :method => :delete, :class => 'important' %> </div> <% end %> As you can see, I have a Remove Note destroy link, but that destroys the entire Kase the note is associated with. How do I make the destroy link remove only the note? <%= link_to "Remove Note", kase_path(@kase), :confirm => 'Are you sure?', :method => :delete, :class => 'important' %> Any help would, as always, be greatly appreciated! Thanks, Danny

    Read the article

  • How can I put rows of MySQL data under the appropriate titles using PHP?

    - by sfarbota
    I have the following MySQL table structure: num field company phone website 1 Gas abcd 123456789 abcd.com 2 Water efgh 987654321 efgh.com 3 Water ijkl 321654987 ijkl.com 4 Heat mnop 987654321 mnop.com 5 Gas qrst 123789654 qrst.com ... Is it possible with PHP (maybe using some mixture of GROUP_BY and ORDER_BY) to echo the data to the screen in the following format: Gas: abcd qrst 123456789 123789654 abcd.com qrst.com Water: efgh ijkl 987654321 321654987 efgh.com ijkl.com Heat: mnop 321654987 mnop.com The exact format of it isn't important. I just need for the different rows of data to be listed under the appropriate field with none of the fields repeated. I've been trying to figure this out for a while now, but I'm new to PHP and I can't seem to figure out how to do this, if it's even possible, or if there's a better way to organize my data to make it easier.

    Read the article

  • Prepare and import data into existing database

    - by Álvaro G. Vicario
    I maintain a PHP application with SQL Server backend. The DB structure is roughly this: lot === lot_id (pk, identify) lot_code building ======== buildin_id (pk, identity) lot_id (fk) inspection ========== inspection_id (pk, identify) building_id (fk) date inspector result The database already has lots and buildings and I need to import some inspections. Key points are: It's a one-time initial load. Data comes in an Excel file. The Excel data is unaware of DB autogenerated IDs: inspections must be linked to buildings through their lot_code What are my options to do such data load? date inspector result lot_code ========== =========== ======== ======== 31/12/2009 John Smith Pass 987654X 28/02/2010 Bill Jones Fail 123456B

    Read the article

  • SQL: Find difference between dates with grouping

    - by ajbeaven
    I have a problem that seems similar to this fellow - I just want to display the data slightly differently. I'm pretty terrible with SQL so can't modify it to suit, but perhaps someone else can. My table looks similar to this (date format is dd/mm/yyyy): ID User Date_start Role 1 Andy 01/04/2010 A 2 Andy 10/04/2010 B 3 Andy 20/04/2010 A 4 John 02/05/2010 A I want to show the total number of days that anyone was in a certain role. Users stay in the role until there is another entry into the table. Users can only be in one role at a time. So the summary data would look like this (assuming that the date is 04/05/2010): A: 26 days B: 10 days Thanks for any help :)

    Read the article

  • Stop method not working

    - by avoq
    Hi everyone , can anybody tell me why the following code doesn't work properly? I want to play and stop an audio file. I can do the playback but whenever I click the stop button nothing happens. Here's the code : Thank you. .................. import java.io.*; import javax.sound.sampled.*; import javax.swing.*; import java.awt.event.*; public class SoundClipTest extends JFrame { final JButton button1 = new JButton("Play"); final JButton button2 = new JButton("Stop"); int stopPlayback = 0; // Constructor public SoundClipTest() { button1.setEnabled(true); button2.setEnabled(false); // button play button1.addActionListener( new ActionListener(){ public void actionPerformed(ActionEvent e){ button1.setEnabled(false); button2.setEnabled(true); play(); }// end actionPerformed }// end ActionListener );// end addActionListener() // button stop button2.addActionListener( new ActionListener(){ public void actionPerformed( ActionEvent e){ //Terminate playback before EOF stopPlayback = 1; }//end actionPerformed }//end ActionListener );//end addActionListener() this.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); this.setTitle("Test Sound Clip"); this.setSize(300, 200); JToolBar bar = new JToolBar(); bar.add(button1); bar.add(button2); bar.setOrientation(JToolBar.VERTICAL); add("North", bar); add("West", bar); setVisible(true); } void play() { try { final File inputAudio = new File("first.wav"); // First, we get the format of the input file final AudioFileFormat.Type fileType = AudioSystem.getAudioFileFormat(inputAudio).getType(); // Then, we get a clip for playing the audio. final Clip c = AudioSystem.getClip(); // We get a stream for playing the input file. AudioInputStream ais = AudioSystem.getAudioInputStream(inputAudio); // We use the clip to open (but not start) the input stream c.open(ais); // We get the format of the audio codec (not the file format we got above) final AudioFormat audioFormat = ais.getFormat(); c.start(); if (stopPlayback == 1 ) {c.stop();} } catch (UnsupportedAudioFileException e) { e.printStackTrace(); } catch (IOException e) { e.printStackTrace(); } catch (LineUnavailableException e) { e.printStackTrace(); } }// end play public static void main(String[] args) { //new SoundClipTest().play(); new SoundClipTest(); } }

    Read the article

  • ERD-CLASS design

    - by Mahesh
    Hello guyz,i am new to daatbase and class diagram.I just get scenarios from internet and try to develop ERD and Class Diagram for them.But the following scenario has caused me some problems, and i am not sure about my design. "Whenever an employee fills leave application form, the leave application should be appeared for approval to his/her team leader. Team Leader has the option to change the date of requested leave and to approve or reject the leave. Employee also has the option to change date of previously unapproved leaves or to cancel any of unapproved leave. In case of team leader, he can approve his own leaves. Management should be able to create categories of leaves like (Casual, Sick, Planned work, etc) and should be able to adjust the days allocated to each type of leave". I have identified these as entities for ERD 1) Employee(I think i dont need to make entity for Technical lead,since he is an employee) 2) LeaveHistory 3) LeaveCategory Plz correct me if the system need more classes or entities

    Read the article

  • Are there any modern platforms with non-IEEE C/C++ float formats?

    - by Patrick Niedzielski
    Hi all, I am writing a video game, Humm and Strumm, which requires a network component in its game engine. I can deal with differences in endianness easily, but I have hit a wall in attempting to deal with possible float memory formats. I know that modern computers have all a standard integer format, but I have heard that they may not all use the IEEE standard for floating-point integers. Is this true? While certainly I could just output it as a character string into each packet, I would still have to convert to a "well-known format" of each client, regardless of the platform. The standard printf() and atod() would be inadequate. Please note, because this game is a Free/Open Source Software program that will run on GNU/Linux, *BSD, and Microsoft Windows, I cannot use any proprietary solutions, nor any single-platform solutions. Cheers, Patrick

    Read the article

  • Find missing birth days in Apple Addressbook

    - by Felix Ogg
    I am trying to clean the holes out of my Mac address book. As a first step I want to ask all my friends for their birth day, to be able to congratulate them with cheesy Hallmark cards. I need a "group" in my address book, to mailmerge personalized messages from. This is the Applescript I came up with: tell application "Address Book" make new group with properties {name:"No Birthday"} set birthdayPeople to (get every person whose birth date is greater than date "Monday, January 1, 1900 12:00:00 AM") repeat with i from 1 to number of items in people set thePerson to item i of people if not (birthdayPeople contains thePerson) then add thePerson to group "No Birthday" end if end repeat save end tell It breaks, but from the error messages I cannot deduce what is wrong: Result: error "Can’t make «class azf4» id \"05F770BA-7492-436B-9B58-E24F494702F8:ABPerson\" of application \"Address Book\" into type vector." number -1700 from «class azf4» id "05F770BA-7492-436B-9B58-E24F494702F8:ABPerson" to vector (BTW: Did I mention this is my first AppleScript code, EVER? So, if this code can be simplified, or made more elegant, that is welcome too.)

    Read the article

  • Calculate hours difference in datetime

    - by ScG
    I have a series of datetime values. I want to select records with a difference of 2 or more hours between them. 2010-02-11 08:55:00.000 2010-02-11 10:45:00.000 2010-02-11 10:55:00.000 2010-02-11 12:55:00.000 2010-02-11 14:52:00.000 2010-02-11 16:55:00.000 2010-02-11 17:55:00.000 2010-02-11 23:55:00.000 2010-02-12 00:55:00.000 2010-02-12 02:55:00.000 Expected (The next date compared is with the last date that qualified for the 2 hr difference): 2010-02-11 08:55:00.000 2010-02-11 10:55:00.000 2010-02-11 12:55:00.000 2010-02-11 16:55:00.000 2010-02-11 23:55:00.000 2010-02-12 02:55:00.000 I am using SQL 2005 or 2008

    Read the article

< Previous Page | 295 296 297 298 299 300 301 302 303 304 305 306  | Next Page >