Search Results

Search found 37875 results on 1515 pages for 'version space'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 314/1515 | < Previous Page | 310 311 312 313 314 315 316 317 318 319 320 321  | Next Page >

  • Paging doesn't work in the Joomla Article Manager in the admin section

    - by SkippyFire
    I inherited a Joomla site that is having a problem with the article manager in the admin section. The pagination doesn't work! If I click the page number, forward, back, or page size, nothing happens! So I found out that someone had previously installed the iJoomla SEO plugin, but it never worked so they removed it. I think it is incompatible with the version I have. I setup a local environment with almost the same setup (I have 5.2.11 vs the servers 5.2.13) with Wamp Server, and I found that some of the session variables are missing! When dumped via print_r(), the $_SESSION variable is missing the "com_content", "global", and "com_plugins" arrays! So I guess that is the reason that paging doesn't work, because the "com_content" array looks like it has paging info in it. (maybe I'm wrong) So I'm running Version 1.5.13 on PHP Version 5.2.13 Anyone know why this would happen? Thanks in advance!

    Read the article

  • How to sort in-place using the merge sort algorithm?

    - by eSKay
    I know the question is too open. All I want is someone to tell me how to convert a normal merge sort into an in-place merge sort (or a merge sort with constant extra space overhead). All I can find (on the net) is pages saying "it is too complex" or "out of scope of this text". "The only known ways to merge in-place (without any extra space) are too complex to be reduced to practical program." (from here) Even if it is too complex, can somebody outline the basic concept of how to make the merge sort in-place?

    Read the article

  • new items on GRUB screen in ubuntu/linux

    - by artsince
    I regularly update my ubuntu (10.04), and new minor versions keep accumulating on the GRUB screen. Right now I have 5 different versions listed on the GRUB, even though I always select the latest version to work with. Am I supposed to do anything to get rid of the old version references? Do these old versions affect disk space/performance?

    Read the article

  • Send Email on GMail SMTP under medium trust

    - by Midhat
    Hi I need to send an email from my app, which will be running under medium trust. My current email sending code that works fine under full trust throws SecurityException under medium trust [SecurityException: Request for the permission of type 'System.Net.Mail.SmtpPermission, System, Version=2.0.0.0, Culture=neutral, PublicKeyToken=b77a5c561934e089' failed.] Examining my machine.config and allied files reveal that my SMTP access is restricted to Connect. <SecurityClass Name="SmtpPermission" Description="System.Net.Mail.SmtpPermission, System, Version=2.0.0.0, Culture=neutral, PublicKeyToken=b77a5c561934e089"/> and <IPermission class="SmtpPermission" version="1" Access="Connect"/> According to MSDN, Connect allows request on port 25 only. But Gmail servers work on port 587. Any workarounds? suggestions?

    Read the article

  • Adding pdb files to VSS

    - by George
    Every time I try to compile my web app, I am prompted if i want to add pdb extensioned files to VSS. I thought pdb files do not belong in VSS see a previous post. Is there any way to prevent them from being added. I cannot even logically delete them from VSS because a previous version has been logically deleted and if I were to delete the current version, the previous version would have to be purged, for which I need vss admin rights that I do not have. I just can't get a handle on how to avoid getting a million files added to VSS that prevent otehr develoeprs from compiling their solutions because they have unchecked out read only copies. Is the only solution to check them in but flip the readonly flag off locally? This is not a good option in my mind.

    Read the article

  • versioning fails for onetomany collection holder

    - by Alexander Vasiljev
    given parent entity @Entity public class Expenditure implements Serializable { ... @OneToMany(mappedBy = "expenditure", cascade = CascadeType.ALL, orphanRemoval = true) @OrderBy() private List<ExpenditurePeriod> periods = new ArrayList<ExpenditurePeriod>(); @Version private Integer version = 0; ... } and child one @Entity public class ExpenditurePeriod implements Serializable { ... @ManyToOne @JoinColumn(name="expenditure_id", nullable = false) private Expenditure expenditure; ... } While updating both parent and child in one transaction, org.hibernate.StaleObjectStateException is thrown: Row was updated or deleted by another transaction (or unsaved-value mapping was incorrect): Indeed, hibernate issues two sql updates: one changing parent properties and another changing child properties. Do you know a way to get rid of parent update changing child? The update results both in inefficiency and false positive for optimistic lock. Note, that both child and parent save their state in DB correctly. Hibernate version is 3.5.1-Final

    Read the article

  • Vim configuration slow in Terminal & iTerm2 but not in MacVim

    - by Jey Balachandran
    Ideally, I want to use Vim from Terminal or iTerm2. However, it becomes unbearably slow so I had to resort to using MacVim. There is nothing wrong with MacVim, however my workflow would be much smoother if I used only Terminal/iTerm2. When its slow Loading files, in particular Rails files takes about 1 - 1.5s. Removing rails.vim decreases this time to 0.5 - 1s. In MacVim this is instantaneous. Scrolling through the rows and columns via h, j, k, l. It progressively gets slower the longer I hold down the keys. Eventually, it starts jumping rows. I have my Key Repeat set to Fast and Delay Until Repeat set to Short. After 10 - 15 minutes of usage, using plugins such as ctrlp or Command-T gets very laggy. I'd type a letter, wait 2 - 3s, then type the next. My Setup 11" MacBook Air running Mac OS X Version 10.7.3 (1.6 Ghz Intel Core 2 Duo, 4 GB DDR3) My dotfiles. > vim --version VIM - Vi IMproved 7.3 (2010 Aug 15, compiled Nov 16 2011 16:44:23) MacOS X (unix) version Included patches: 1-333 Huge version without GUI. Features included (+) or not (-): +arabic +autocmd -balloon_eval -browse ++builtin_terms +byte_offset +cindent -clientserver +clipboard +cmdline_compl +cmdline_hist +cmdline_info +comments +conceal +cryptv -cscope +cursorbind +cursorshape +dialog_con +diff +digraphs -dnd -ebcdic +emacs_tags +eval +ex_extra +extra_search +farsi +file_in_path +find_in_path +float +folding -footer +fork() -gettext -hangul_input +iconv +insert_expand +jumplist +keymap +langmap +libcall +linebreak +lispindent +listcmds +localmap -lua +menu +mksession +modify_fname +mouse -mouseshape +mouse_dec -mouse_gpm -mouse_jsbterm +mouse_netterm -mouse_sysmouse +mouse_xterm +multi_byte +multi_lang -mzscheme +netbeans_intg +path_extra -perl +persistent_undo +postscript +printer +profile +python -python3 +quickfix +reltime +rightleft +ruby +scrollbind +signs +smartindent -sniff +startuptime +statusline -sun_workshop +syntax +tag_binary +tag_old_static -tag_any_white -tcl +terminfo +termresponse +textobjects +title -toolbar +user_commands +vertsplit +virtualedit +visual +visualextra +viminfo +vreplace +wildignore +wildmenu +windows +writebackup -X11 -xfontset -xim -xsmp -xterm_clipboard -xterm_save system vimrc file: "$VIM/vimrc" user vimrc file: "$HOME/.vimrc" user exrc file: "$HOME/.exrc" fall-back for $VIM: "/usr/local/Cellar/vim/7.3.333/share/vim" Compilation: /usr/bin/llvm-gcc -c -I. -Iproto -DHAVE_CONFIG_H -DMACOS_X_UNIX -no-cpp-precomp -O3 -march=core2 -msse4.1 -w -pipe -D_FORTIFY_SOURCE=1 Linking: /usr/bin/llvm-gcc -L. -L/usr/local/lib -o vim -lm -lncurses -liconv -framework Cocoa -framework Python -lruby I've tried running without any plugins or syntax highlighting. It opens files a lot faster but still not as fast as MacVim. But the other two problems still exist. Why is my vim configuration slow? How can I improve the speed of my vim configuration within Terminal or iTerm2?

    Read the article

  • Cygwin bash syntax error - but script run perfectly well in Ubuntu

    - by Michael Mao
    #!/bin/bash if test "$#" == "4"; then echo "$*"; else echo "args-error" >&2; fi; This little code snippet troubles me a lot when I tried to run it on both Ubuntu and Cygwin. Ubuntu runs bash version 4.0+ whereas Cygwin runs 3.2.49; But I reckon version collision shall not be the cause of this, this code runs well under fedora 10 which is also using bash version 3.+ So basically I am wondering if there is a way to code my script once and for all so there are not to have this awful issue later on. Many thanks in advance.

    Read the article

  • WebLogic Server internal server error

    - by Abhinav Pandey
    when I deploy a project in Apache Tomcat 6.0 it's working fine. When I deploy the same project in weblogic server 10.3 it's showing an error like below: Error 500--Internal Server Error javax.servlet.ServletException: [HTTP:101249][weblogic.servlet.internal.WebAppServletContext@ae43b8 - appName: '_appsdir_ab_dir', name: 'ab', context-path: '/ab', spec-version: 'null']: Servlet class FirstServlet for servlet FirstServlet could not be loaded because the requested class was not found in the classpath . java.lang.UnsupportedClassVersionError: FirstServlet : Unsupported major.minor version 51.0.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Windows 8 installer: Something Happened

    - by mcandre
    My school provides Windows 8 through MSDN. When I run the Windows 8 installer, it says: What can I do? Specs: systeminfo | findstr /B /C:"OS Name" /C:"OS Version" OS Name: Microsoft Windows 7 Professional OS Version: 6.1.7601 Service Pack 1 Build 7601 systeminfo | findstr /B /C:"System Manufacturer" /C:"System Model" System Manufacturer: Apple Inc. System Model: MacBookPro5,5 Also posted in Microsoft Community.

    Read the article

  • "Failed to find or load the registered .Net Framework Data Provider" with MySQL + ASP.NET

    - by Malachi
    How do we repair this? This question has been sort of addressed many times around the internet, but it's always a workaround. Always copying the MySql.data.dll into your bin directory, or explicitly stating what version you want. What is the "proper" approach to using DbProvderFactory for MySQL with ASP.NET? I'd like to be able to develop locally and not worry what version they have installed on the server. As it stands, if I do copy up my own version I have to make sure it's the one they use. Seems easy to break.

    Read the article

  • Fixed footer with 960.gs

    - by Oguz
    I want to create fixed footer but , is it possible with 960 gs , because I am having trouble with height of container div . I can no set it to %100. <div class="container_12" > <div class="grid_3" id="side-space"></div> <div class="grid_6"> <div id="content-box"></div> </div> <div class="grid_3" id="side-space"></div> </div>

    Read the article

  • installing libraries for cygwin

    - by Hoang
    I want to install these libraries in cygwin, how do I do it? are all of them available on cygwin environment or only on linux? g++ - the version 4.4 graphviz gnuplot plotdrop libboost version 1.38 libgsl0-dbg libgsl0-dev libgsl0ldbl

    Read the article

  • What Regex can strip e.g. "note:" and "firstName: " from the left of a string?

    - by Edward Tanguay
    I need to strip the "label" off the front of strings, e.g. note: this is a note needs to return: note and this is a note I've produced the following code example but am having trouble with the regexes. What code do I need in the two ???????? areas below so that I get the desired results shown in the comments? using System; using System.Collections.Generic; using System.Linq; using System.Text; using System.Text.RegularExpressions; namespace TestRegex8822 { class Program { static void Main(string[] args) { List<string> lines = new List<string>(); lines.Add("note: this is a note"); lines.Add("test: just a test"); lines.Add("test:\t\t\tjust a test"); lines.Add("firstName: Jim"); //"firstName" IS a label because it does NOT contain a space lines.Add("She said this to him: follow me."); //this is NOT a label since there is a space before the colon lines.Add("description: this is the first description"); lines.Add("description:this is the second description"); //no space after colon lines.Add("this is a line with no label"); foreach (var line in lines) { Console.WriteLine(StringHelpers.GetLabelFromLine(line)); Console.WriteLine(StringHelpers.StripLabelFromLine(line)); Console.WriteLine("--"); //note //this is a note //-- //test //just a test //-- //test //just a test //-- //firstName //Jim //-- // //She said this to him: follow me. //-- //description //this is the first description //-- //description //this is the first description //-- // //this is a line with no label //-- } Console.ReadLine(); } } public static class StringHelpers { public static string GetLabelFromLine(this string line) { string label = line.GetMatch(@"^?:(\s)"); //??????????????? if (!label.IsNullOrEmpty()) return label; else return ""; } public static string StripLabelFromLine(this string line) { return ...//??????????????? } public static bool IsNullOrEmpty(this string line) { return String.IsNullOrEmpty(line); } } public static class RegexHelpers { public static string GetMatch(this string text, string regex) { Match match = Regex.Match(text, regex); if (match.Success) { string theMatch = match.Groups[0].Value; return theMatch; } else { return null; } } } }

    Read the article

  • Lost Powerpoint document somewhere between Explorer and C drive

    - by Sarah Frank
    Opened (and not saving) a Powerpoint presentation attached to an online email message. Modified the document and clicked on the Save (not Save As) and now the presentation is nowhere to be found. How do I find this document? I have run a serious search on the C drive to no avail. It's not even in the Temporary Internet Files. Computer system Windows XP Professional version 5.1.2600 Explorer version 6.0.2900

    Read the article

  • increasing amazon root volume size

    - by OCD
    I have a default amazon ec2 instance with 8GB root volume size. I am running out of space. I have: Detach the current EBS volume in AWS Management Console (Web). Create snapshot of this volume. Created a new Volume with 50G space with my snapshot. Attach the new volume back to the instance to /dev/sda1 However, when I reconnect to the account with: > df -h I can see from the management console that my new Filesystem 1K-blocks Used Available Use% Mounted on /dev/xvda1 8256952 8173624 0 100% / tmpfs 308508 40 308468 1% /dev/shm It's still not using my new volume's size, how to make this work?

    Read the article

  • Compiling SWIG library for Ruby on Mac OS X fails

    - by Stefan Schmidt
    I tried to compile the following SWIG library for Ruby and everything went smooth until the last step. /* File : computation.c */ int add(int x, int y) { return x + y; } /* File: computation.i */ %module computation extern int add(int x, int y); $ swig -ruby computation.i $ gcc -c computation.c $ gcc -c computation_wrap.c -I/opt/local/lib/ruby/1.8/i686-darwin10 $ gcc -shared computation.o computation_wrap.o -o computation.so Undefined symbols: "_rb_str_cat", referenced from: _Ruby_Format_TypeError in computation_wrap.o "_rb_exc_new3", referenced from: _SWIG_Ruby_ExceptionType in computation_wrap.o "_rb_define_class_under", referenced from: _SWIG_Ruby_define_class in computation_wrap.o _SWIG_Ruby_define_class in computation_wrap.o [...] ld: symbol(s) not found collect2: ld returned 1 exit status My configuration: $ sw_vers ProductName: Mac OS X ProductVersion: 10.6.3 BuildVersion: 10D575 $ ruby -v ruby 1.8.7 (2010-01-10 patchlevel 249) [i686-darwin10] $ swig -version SWIG Version 1.3.40 Compiled with /usr/bin/g++-4.2 [i386-apple-darwin10.3.0] $ gcc --version i686-apple-darwin10-gcc-4.2.1 (GCC) 4.2.1 (Apple Inc. build 5646)

    Read the article

  • How to safely purge in Varnish if backend is sick without losing content

    - by Highway of Life
    If the backend is sick, what is the preferable way to ensure that stale content can be retrieved from the backend when a PURGE request is made? When a PURGE request is made, whether or not the backend is sick, by default the content will be eliminated from the Varnish cache and if the backend is down, a 503 page would be served to the user until the backend comes back online to serve a new version of the content. I'd like to be able to at least serve up a stale version of the content if a new version could not be retrieved from the backend. Is this possible without installing the Softpurge Varnish Mod?

    Read the article

  • Server Error in '/' Application (ASP.NET)

    - by baeltazor
    Hi All I just setup up member ship roles and registration on my website with visual web developer using the tutorial on msdn. It works perfectly locally, but when i uploaded it to my server, I get the following page: "Server Error in '/' Application. -------------------------------------------------------------------------------- Configuration Error Description: An error occurred during the processing of a configuration file required to service this request. Please review the specific error details below and modify your configuration file appropriately. Parser Error Message: The connection name 'LocalSqlServer' was not found in the applications configuration or the connection string is empty. Source Error: [No relevant source lines] Source File: machine.config Line: 160 -------------------------------------------------------------------------------- Version Information: Microsoft .NET Framework Version:2.0.50727.4200; ASP.NET Version:2.0.50727.4016 " Does anybody know why I'm seeing this and how I may go about fixinf this? Any help is greatly appreciated. Thank you Bael. EDIT: I have just looked at my web.config file after reading the following line in the error message: "The connection name 'LocalSqlServer' was not found in the applications configuration or the connection string is empty." ... And have noticed that the following element is completely empty: <connectionStrings/> // Is this one supposed to be empty? if not what should go here? In the error it implies it shouldn't be empty. Also, I don't know where I should place LocalSqlServer LATEST EDIT After changing DataSource to LocalHost i get the following error: Server Error in '/JTS' Application. -------------------------------------------------------------------------------- A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: Named Pipes Provider, error: 40 - Could not open a connection to SQL Server) Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.Data.SqlClient.SqlException: A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: Named Pipes Provider, error: 40 - Could not open a connection to SQL Server) Source Error: An unhandled exception was generated during the execution of the current web request. Information regarding the origin and location of the exception can be identified using the exception stack trace below. Stack Trace: [SqlException (0x80131904): A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: Named Pipes Provider, error: 40 - Could not open a connection to SQL Server)] System.Data.SqlClient.SqlInternalConnection.OnError(SqlException exception, Boolean breakConnection) +4849015 System.Data.SqlClient.TdsParser.ThrowExceptionAndWarning(TdsParserStateObject stateObj) +194 System.Data.SqlClient.TdsParser.Connect(ServerInfo serverInfo, SqlInternalConnectionTds connHandler, Boolean ignoreSniOpenTimeout, Int64 timerExpire, Boolean encrypt, Boolean trustServerCert, Boolean integratedSecurity, SqlConnection owningObject) +4862333 System.Data.SqlClient.SqlInternalConnectionTds.AttemptOneLogin(ServerInfo serverInfo, String newPassword, Boolean ignoreSniOpenTimeout, Int64 timerExpire, SqlConnection owningObject) +90 System.Data.SqlClient.SqlInternalConnectionTds.LoginNoFailover(String host, String newPassword, Boolean redirectedUserInstance, SqlConnection owningObject, SqlConnectionString connectionOptions, Int64 timerStart) +342 System.Data.SqlClient.SqlInternalConnectionTds.OpenLoginEnlist(SqlConnection owningObject, SqlConnectionString connectionOptions, String newPassword, Boolean redirectedUserInstance) +221 System.Data.SqlClient.SqlInternalConnectionTds..ctor(DbConnectionPoolIdentity identity, SqlConnectionString connectionOptions, Object providerInfo, String newPassword, SqlConnection owningObject, Boolean redirectedUserInstance) +189 System.Data.SqlClient.SqlConnectionFactory.CreateConnection(DbConnectionOptions options, Object poolGroupProviderInfo, DbConnectionPool pool, DbConnection owningConnection) +185 System.Data.ProviderBase.DbConnectionFactory.CreatePooledConnection(DbConnection owningConnection, DbConnectionPool pool, DbConnectionOptions options) +31 System.Data.ProviderBase.DbConnectionPool.CreateObject(DbConnection owningObject) +433 System.Data.ProviderBase.DbConnectionPool.UserCreateRequest(DbConnection owningObject) +66 System.Data.ProviderBase.DbConnectionPool.GetConnection(DbConnection owningObject) +499 System.Data.ProviderBase.DbConnectionFactory.GetConnection(DbConnection owningConnection) +65 System.Data.ProviderBase.DbConnectionClosed.OpenConnection(DbConnection outerConnection, DbConnectionFactory connectionFactory) +117 System.Data.SqlClient.SqlConnection.Open() +122 System.Web.DataAccess.SqlConnectionHolder.Open(HttpContext context, Boolean revertImpersonate) +87 System.Web.DataAccess.SqlConnectionHelper.GetConnection(String connectionString, Boolean revertImpersonation) +221 System.Web.Security.SqlMembershipProvider.GetPasswordWithFormat(String username, Boolean updateLastLoginActivityDate, Int32& status, String& password, Int32& passwordFormat, String& passwordSalt, Int32& failedPasswordAttemptCount, Int32& failedPasswordAnswerAttemptCount, Boolean& isApproved, DateTime& lastLoginDate, DateTime& lastActivityDate) +815 System.Web.Security.SqlMembershipProvider.CheckPassword(String username, String password, Boolean updateLastLoginActivityDate, Boolean failIfNotApproved, String& salt, Int32& passwordFormat) +105 System.Web.Security.SqlMembershipProvider.CheckPassword(String username, String password, Boolean updateLastLoginActivityDate, Boolean failIfNotApproved) +42 System.Web.Security.SqlMembershipProvider.ValidateUser(String username, String password) +78 System.Web.UI.WebControls.Login.AuthenticateUsingMembershipProvider(AuthenticateEventArgs e) +60 System.Web.UI.WebControls.Login.OnAuthenticate(AuthenticateEventArgs e) +119 System.Web.UI.WebControls.Login.AttemptLogin() +115 System.Web.UI.WebControls.Login.OnBubbleEvent(Object source, EventArgs e) +101 System.Web.UI.Control.RaiseBubbleEvent(Object source, EventArgs args) +37 System.Web.UI.WebControls.Button.OnCommand(CommandEventArgs e) +118 System.Web.UI.WebControls.Button.RaisePostBackEvent(String eventArgument) +166 System.Web.UI.WebControls.Button.System.Web.UI.IPostBackEventHandler.RaisePostBackEvent(String eventArgument) +10 System.Web.UI.Page.RaisePostBackEvent(IPostBackEventHandler sourceControl, String eventArgument) +13 System.Web.UI.Page.RaisePostBackEvent(NameValueCollection postData) +36 System.Web.UI.Page.ProcessRequestMain(Boolean includeStagesBeforeAsyncPoint, Boolean includeStagesAfterAsyncPoint) +1565 -------------------------------------------------------------------------------- Version Information: Microsoft .NET Framework Version:2.0.50727.4927; ASP.NET Version:2.0.50727.4927

    Read the article

  • How do I use a command line tool to install .net 4 to IIS

    - by tehp
    I'm trying to deploy my WCF RIA services application to our in-house server for testing. I've been following the instructions and comments from this blog site: http://timheuer.com/blog/archive/2009/12/10/tips-to-deploy-ria-services-troubleshoot.aspx At the end someone points to this question: http://stackoverflow.com/questions/1528324/how-to-solve-a-http-error-404-3-not-found-error I've been trying to run that same tool with .net 4.0 but it keeps giving me an error: [Warning]The HTTP namespace reservation already exists. I am running the version of the exe that I found inside of C:\Windows\Microsoft.NET\Framework\v4.0.21006 There is also C:\Windows\Microsoft.NET\Framework\v3.0\Windows Communication Foundation that has (what I assume is) the same exe in it, and I can use it just fine. I've tried to un-install the 3.0 version before installing the 4.0 version, but I am still getting the same warning and failure. Has anyone successfully done this with .net 4.0?

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 310 311 312 313 314 315 316 317 318 319 320 321  | Next Page >