Search Results

Search found 10883 results on 436 pages for 'ms expression'.

Page 316/436 | < Previous Page | 312 313 314 315 316 317 318 319 320 321 322 323  | Next Page >

  • regex to format a float in php

    - by Itamar Bar-Lev
    I have a PHP function for formatting a float to a given amount of decimal points that uses number_format(), and then removes the unneeded zeros (and also the '.' if possible): $float = number_format($float, $decimalPlaces, '.', ''); for ($i = 0; $i < $decimalPlaces; $i++) { if (substr($float, strlen($float) - 1, strlen($float)) == '0') { $float = substr($float, 0, strlen($float) - 1); } } if (substr($float, strlen($float) - 1, strlen($float)) == '.') { $float = substr($float, 0, strlen($float) - 1); } Is it possible to do so more effectively with a regular expression?

    Read the article

  • fastest in-memory cache for XslCompiledTransform

    - by rudnev
    I have a set of xslt stylesheet files. I need to produce the fastest performance of XslConpiledTransform, so i want to make in-memory representation of these stylesheets. I can load them to in-memory collection as IXpathNavigable on application start, and then load each IXPAthNavigable into singleton XslCompiledTransform on each request. But this works only for styleshhets without xsl:import or xsl:include. (Xsl:import is only for files). also i can load into cache many instances of XSLCompiledTransform for each template. Is it reasonable? Are there other ways? What is the best? what are another tips for improving performance MS Xslt processor?

    Read the article

  • problem with null column

    - by Iulian
    One column in my database (of type double) has some null values. I am executing a sored procedure to get the data in my app wipDBTableAdapters.XLSFacturiTableAdapter TAFacturi = new wipDBTableAdapters.XLSFacturiTableAdapter(); var dtfacturi = TAFacturi.GetData(CodProiect); Then i try to do something like this: if (dtfacturi[i].CANTITATE == null) { //do something } this is giving a warning : The result of the expression is always 'false' since a value of type 'double' is never equal to 'null' of type 'double? However when i run my code i get the following exception: StrongTypingException The value for column 'CANTITATE' in table 'XLSFacturi' is DBNull. How am I supposed to resolve this ?

    Read the article

  • Scala 2.8: use Java annotation with an array parameter

    - by yournamehere
    I'm trying to implement an JavaEE Session Bean with Scala 2.8. Because it's a Remote Session Bean, i have to annotate it with the following Java Annotation: @Target({ElementType.TYPE}) @Retention(RetentionPolicy.RUNTIME) public @interface Remote { Class[] value() default {}; } I only found this example for scala 2.7. In Scala 2.7, its possible to define the session bean like this: @Remote {val value = Array(classOf[ITest])} class MyEJB ... How can i use this annotation the same way with Scala 2.8? I already tried many different versions, all resulting in "annotation argument needs to be a constant", "illegal start of simple expression". All of these definitions don't work: @Remote{val value = Array(classOf[PersonScalaEJB])} @Remote(val value = Array(classOf[PersonScalaEJB])) @Remote(Array(classOf[PersonScalaEJB]))

    Read the article

  • [wxWidgets] How to store wxImage into database, using C++?

    - by Thomas Matthews
    I have some wxImages and I would like to store them into a BLOB (Binary Large OBject) field in a MySQL database. There are no methods in wxImage nor wxBitmap for obtaining the binary data as an array of unsigned char so I can load into the database. My current workaround is to write the image to a temporary file, then load the BLOB field directly from the file. Is there a more efficient method to load and store a wxImage object into a MySQL BLOB field? I am using MySql C++ connector 1.05, MS Visual Studio 2008, wxWidgets and C++.

    Read the article

  • C++ defines for a 'better' Release mode build in VS

    - by darid
    I currently use the following preprocessor defines, and various optimization settings: WIN32_LEAN_AND_MEAN VC_EXTRALEAN NOMINMAX _CRT_SECURE_NO_WARNINGS _SCL_SECURE_NO_WARNINGS _SECURE_SCL=0 _HAS_ITERATOR_DEBUGGING=0 My question is what other things do fellow SOers use, add, define, in order to get a Release Mode build from VS C++ (2008,2010) to be as performant as possible? btw, I've tried PGO etc, it does help a bit but nothing that comes to parity, also I'm not using streams, the C++ i'm talking about its more like C but making use of templates and STL algorithms. As it stands now very simple code segments flop when compared to what GCC produces on say an equivalent x86 machine running linux (2.6+ kernel) using 02. Side-Note: I believe a lot of the issues relate directly to the STL version (Dinkum) provided by MS. Could people please elaborate on experiences using STLPort etc with VS C++.

    Read the article

  • What logic operator to use, as3?

    - by VideoDnd
    What operator or expression can I use that will fire on every number, including zero? I want a logic operator that will fire with ever number it receives. My animations pause at zero. This skips on zero if (numberThing> 0); This skips on 9 if (numberThing>> 0); This jitters 'fires quickly and goes back on count' if (numberThing== 0); EXPLANATION I'm catching split string values in a logic function, and feeding them to a series of IF, ELSE IF statements. I'm using this with a timer, so I can measure the discrepency. CODE • I GET VALUES FROM TIMER • STRING GOES TO TEXTFIELD 'substr' • NUMBER TRIGGERS TWEENS 'parseInt' • Goes to series of IF and ELSE IF statements

    Read the article

  • How to delete data in DB efficiently using LinQ to NHibernate (one-shot-delete)

    - by kastanf
    Hello, producing software for customers, mostly using MS SQL but some Oracle, a decision was made to plunge into Nhibernate (and C#). The task is to delete efficiently e.g. 10 000 rows from 100 000 and still stay sticked to ORM. I've tried named queries - link already, IQuery sql = s.GetNamedQuery("native-delete-car").SetString(0, "Kirsten"); sql.ExecuteUpdate(); but the best I have ever found seems to be: using (ITransaction tx = _session.BeginTransaction()) { try { string cmd = "delete from Customer where Id < GetSomeId()"; var count = _session.CreateSQLQuery(cmd).ExecuteUpdate(); ... Since it may not get into dB to get all complete rows before deleting them. My questions are: If there is a better way for this kind of delete. If there is a possibility to get the Where condition for Delete like this: Having a select statement (using LinQ to NHibernate) = which will generate appropriate SQL for DB = we get that Where condition and use it for Delete. Thanks :-)

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How to use Visual Studio debugger visualizers built against a different framework version?

    - by michielvoo
    I compiled the ExpressionTreeVisualizer project found in the Visual Studio 2010 samples but when I try to use it in a .NET 3.5 project I get the exception below: Could not load file or assembly 'file:///C:\Program Files (x86)\Microsoft\Visual Studio 2010\Common7\Packages\Debugger\Visualizers\ExpressionTreeVisualizer.dll' or one of its dependencies. This assembly is built by a runtime newer than the currently loaded runtime and cannot be loaded. The sample project had the TargetFrameworkVersion set to v4.0 and after changing it to v3.5 and building it now works in my project. I changed the source code and project file and rebuilt it so that I now have two expression tree visualizers, one for v3.5 projects and one for v4.0 projects. Is there a better way? Thanks!

    Read the article

  • How to check when Shell32.Folder.CopyHere() is finished

    - by Jelle Capenberghs
    I need to unzip en zip some files in my application using Shell32. Right now, I use srcFolder.CopyHere(destFolder.Items()) to achieve this. However, my next line of code requires the newly made ZIP-file. But since the CopyHere method is Async, how can I check when it in finished? Right now I use a Thread.Sleep for around 500 ms which is enough for my computer to finish creating the ZIP file, but it's not good code imo. Any ideas? More info/code can be provided if necessary.

    Read the article

  • from C to assembly

    - by lego69
    how can I get assembly code from C program I used this recommendation and I use something like this -c -fmessage-length=0 -O2 -S in Eclipse, but I've got an error, thanks in advance for any help I have this error **** Internal Builder is used for build **** gcc -O0 -g3 -Wall -c -fmessage-length=0 -O2 -S -oatam.o ..\atam.c gcc -oatam.exe atam.o D:\technion\2sem\matam\eclipse\eclipse\mingw\bin\..\lib\gcc\mingw32\3.4.5\..\..\..\..\mingw32\bin\ld.exe:atam.o: file format not recognized; treating as linker script D:\technion\2sem\matam\eclipse\eclipse\mingw\bin\..\lib\gcc\mingw32\3.4.5\..\..\..\..\mingw32\bin\ld.exe:atam.o:1: syntax error collect2: ld returned 1 exit status Build error occurred, build is stopped Time consumed: 281 ms.

    Read the article

  • How do I open a web browser from a .NET Program? Process.Start() isn't working?

    - by Scott Whitlock
    I have a URL and I want to launch it in the default browser. I've tried two methods: Process.Start("http://stackoverflow.com"); ... and the one detailed in this other question using ShellExecute. In both cases I get the error: Windows cannot find 'http://stackoverflow.com'. Make sure you typed the name correctly, and then try again. It shouldn't be trying to open it as a file though... from what I understand, it should recognize it as a URL and open it in the default browser. What am I missing? By the way: OS = Vista, and .NET = 3.5 EDIT: According to this MS KB article, since Process.Start sets the UseShellExecute by default, it should launch the default browser.

    Read the article

  • How to regex match a string of alnums and hyphens, but which doesn't begin or end with a hyphen?

    - by Shahar Evron
    I have some code validating a string of 1 to 32 characters, which may contain only alpha-numerics and hyphens ('-') but may not begin or end with a hyphen. I'm using PCRE regular expressions & PHP (albeit the PHP part is not really important in this case). Right now the pseudo-code looks like this: if (match("/^[\p{L}0-9][\p{L}0-9-]{0,31}$/u", string) and not match("/-$/", string)) print "success!" That is, I'm checking first that the string is of right contents, doesn't being with a '-' and is of the right length, and then I'm running another test to see that it doesn't end with a '-'. Any suggestions on merging this into a single PCRE regular expression? I've tried using look-ahead / look-behind assertions but couldn't get it to work.

    Read the article

  • What HTTP headers do I need to stream an ASF file?

    - by SoaperGEM
    I have a simple PHP script that will either serve up a streaming ASF file or not, depending on whether you're logged in and have access to the file. It basically does this: <?php header('Content-Type: video/x-ms-asf'); header('Content-Disposition: inline; filename="file.asf"'); readfile('file.asf'); ?> This already works fine in Firefox; when you navigate to this file it starts the video streaming right away. But Internet Explorer is a different story. When I go to this link in IE, it consistently tries to download the file as if it were an attachment rather than streaming it in the browser. What I am missing that IE's getting hung up on?

    Read the article

  • jQuery 1.4.x and the @ symbol

    - by David
    I used to use this script for jquery email obfuscation: $(".replaceAt").replaceWith("@"); $(".obfuscate").each(function () { $(this).attr("href", "mailto:"+$(this).text()); }); <a class="obfuscate">name<span class="replaceAt">-AT-</span>server.com</a> But with jQuery 1.4.x, I now get this error: uncaught exception: Syntax error, unrecognized expression: @ Looking this up on the net, it looks like jQuery thinks that the @ is a special character. I tried to "\@" it and a few other things with not luck. I'm not enough of a jQuery ninja to know how to fix this. Any ideas?

    Read the article

  • Globbing with MinGW on Windows

    - by Neil Butterworth
    I have an application built with the MinGW C++ compiler that works something like grep - acommand looks something like this: myapp -e '.*' *.txt where the thing that comes after the -e switch is a regex, and the thing after that is file name pattern. It seems that MinGW automatically expands (globs in UNIX terms) the command line so my regex gets mangled. I can turn this behaviour off, I discovered, by setting the global variable _CRT_glob to zero. This will be fine for bash and other sensible shell users, as the shell will expand the file pattern. For MS cmd.exe users however, it looks like I will have to expand the file pattern myself. So my question - does anyone know of a globbing library (or facility in MinGW) to do partial command line expansion? I'm aware of the _setargv feature of the Windows CRT, but that expands the full command line. Please note I've seen this question, but it really does not address partial expansion.

    Read the article

  • MSSQL Search Proper Names Full Text Index vs LIKE + SOUNDEX

    - by Matthew Talbert
    I have a database of names of people that has (currently) 35 million rows. I need to know what is the best method for quickly searching these names. The current system (not designed by me), simply has the first and last name columns indexed and uses "LIKE" queries with the additional option of using SOUNDEX (though I'm not sure this is actually used much). Performance has always been a problem with this system, and so currently the searches are limited to 200 results (which still takes too long to run). So, I have a few questions: Does full text index work well for proper names? If so, what is the best way to query proper names? (CONTAINS, FREETEXT, etc) Is there some other system (like Lucene.net) that would be better? Just for reference, I'm using Fluent NHibernate for data access, so methods that work will with that will be preferred. I'm using MS SQL 2008 currently.

    Read the article

  • How To Make NHibernate Automatically change an "Updated" column

    - by IanT8
    I am applying NHibernate to an existing project, where tables and columns are already defined and fixed. The database is MS-SQL-2008. NHibernate 2.1.2 Many tables have a column of type timestamp named "ReplicationID", and also a column of type datetime named "UpdatedDT". I understand I might be able to use the element of the mapping file to describe the "ReplicationID" column which will allow NHibernate to manage that column. Is it possible to make NHibernate automatically update the UpdatedDT column when the row is updated? I suppose I could try mapping the UpdatedDT property to be of type timestamp, but that have other side effects.

    Read the article

  • How to convert an arbitrary object to String with JSTL? (calling toString())

    - by hstoerr
    Is there any way to call toString() on an object with the JSTL? (I need the String representation of an enum as index in a map in a JSP EL expression.) I hoped something like ${''+object} would work like in java, but JSTL isn't that nice, and there does not seem to be any function that does it. Clarification: I have a variable somemap that maps Strings to Strings, and I have a variable someenum that is an enumeration. I'd like to do something like ${somemap[someenum.toString()]}. (Of course .toString() does not work, but what does?)

    Read the article

  • SQLce Select query problem

    - by DieHard
    Wrote a Truck show Contest voting app, financial etc using sqlite. decided to write backup app for show day using ce 3.5. Created db moved to data directory, created tables configured dgridviews all is well. Entered some test data started management studio 08 ran select query against table and got null returns. Started app from vs studio and found that test data is gone. Re entered data ran query in MS data gone again. If I use VS Studio can start and enter data, close app restart and data is still there, seems only when using outside tool on select query data deletes. I don't know ce that well but this cannot be right. select * from votes = delete * from votes??????????????

    Read the article

  • Delphi 2010: whatever happened to TRTTIConstructor?

    - by conciliator
    I've got two questions (of which at least one is regarding RTTI in D2010 and dynamic instancing) I was reading what appears to be the foils for a conference talk by Barry Kelly, and found on p. 13 something that looked really interesting: TRTTIConstructor.Invoke. In an adjacent bullet point, on finds "Dynamically construct instances without needing virtual constructors and metaclasses". This seems like a great feature (and exactly what I need, btw)! However, when I look in the D2010 docs (ms-help://embarcadero.rs2010/vcl/Rtti.html), I can't find it. Did it get revoked? What is the minimal way of creating an instance of a class, provided the class name is stored in a string?

    Read the article

  • Documentation of a software project

    - by anijhaw
    I am working with a team that works on a very large software project, we have tons of Documentation that is written in MS WORD format with nohyperlinked indexes, no search ability. Everyday we waste our time trying to find the exact document or reference. I was thinking if there was way or even a professional tool that would convert all this into a wiki format and maybe with a little manual (painful) help be organised into something that improves the accessibility. I use Google Desktop Search to make my life a little easier but its not the best solution I just want to know if any of you faced similar problems and possible solutions to this issue.

    Read the article

  • Replace text in string with delimeters using Regex

    - by user1057735
    I have a string something like, string str = "(50%silicon +20%!(20%Gold + 80%Silver)| + 30%Alumnium)"; I need a Regular Expression which would Replace the contents in between ! and | with an empty string. The result should be (50%silicon +20% + 30%Alumnium). If the string contains something like (with nested delimiters): string str = "(50%silicon +20%!(80%Gold + 80%Silver + 20%!(20%Iron + 80%Silver)|)| + 30%Alumnium)"; The result should be (50%silicon +20% + 30%Alumnium) - ignoring the nested delimiters. I've tried the following Regex, but it doesn't ignore the nesting: Regex.Replace(str , @"!.+?\|", "", RegexOptions.IgnoreCase);

    Read the article

  • Visual Studio bug ~ can anyone duplicate?

    - by drachenstern
    In Visual Studio 2010 Pro (Version 10.0.30319.1 RTMRel), I noticed tonight that for some reason I kept getting a wider window for quick find, but thought I was losing my mind. So I exited, restarted, etc to verify. Here's my repro steps Open existing project (I don't think it matters which one) Press ctrlf and give it something to search for (?) Press enter Press ctrlf Press enter goto 4 Can you reproduce a slowly expanding quick find window? Do I have some sort of wacky bugged out system? I'ld obviously like to submit a bug report to MS if this is indeed a viable repro.

    Read the article

< Previous Page | 312 313 314 315 316 317 318 319 320 321 322 323  | Next Page >