Search Results

Search found 72218 results on 2889 pages for 'multiple definition error'.

Page 319/2889 | < Previous Page | 315 316 317 318 319 320 321 322 323 324 325 326  | Next Page >

  • Debootstrap Ubuntu over NFS leads to mknod I/O error

    - by Aaron B. Russell
    Hi everyone, I'm trying to prepare an Ubuntu environment for a diskless machine that will PXE boot and mount an NFS share as it's root. I've currently got another Ubuntu machine mounting the NFS share and I'm trying to debootstrap into it, but it has trouble creating devices over NFS: root@kimiko:~# mount | grep Seiuchi 192.168.0.203:/mnt/user/Seiuchi on /mnt type nfs (rw,addr=192.168.0.203) root@kimiko:~# debootstrap --arch i386 maverick /mnt http://gb.archive.ubuntu.com/ubuntu/ mknod: `/mnt/test-dev-null': Input/output error E: Cannot install into target '/mnt' mounted with noexec or nodev My NFS rule on the unRAID server is 192.168.0.201/32(rw,no_root_squash,sync). I don't have the noexec or nodev options set. I've not got much experience with NFS, so I'm probably missing something basic in the way I'm sharing this, but my attempts at Googling for an answer isn't really turning anything useful up. Does anyone have suggestions on what I might have missed or maybe relevant docs? Edit: Creating normal files (and directories) works just fine, I just can't create devices... root@kimiko:/mnt# mkdir foo root@kimiko:/mnt# cd foo root@kimiko:/mnt/foo# touch bar root@kimiko:/mnt/foo# mknod quux c 4 64 mknod: `quux': Input/output error root@kimiko:/mnt/foo# ls bar

    Read the article

  • Error when starting .Net-Application from ThinApp-Application

    - by user50209
    one of our customers uses SAP through VMWare ThinApp. In SAP there is a button that launches an .Net application from a server. When starting the .Net-application directly, there is no error. If the user tries to start the application by clicking the button in the ThinApp-Application, it displays the following errors: Microsoft Visual C++ Runtime Library R6034 An application has made an attempt to load the C runtime library incorrectly. Please contact the application's support team for more information. After clicking "OK" it displays: Microsoft Visual C++ Runtime Library Runtime Error! R6030 - CRT not initialized So, does the customer have to install some components into his ThinApp (if yes, which?) to get things working? Regards, inno ----- [EDIT] ----- @Sean: It's installed the following way: The .exe of the .Net-Application is on a mapped drive on a server. All clients have the requirements installed (.Net-framework for example) and start the .exe from the mapped drive. The ThinApp-Application tries to start this application and throws the mentioned exceptions. AFAIK there are no entry points for this application configured. What I should also mention is: The .Net-Application crashes during execution. That means, we have a debug mode implemented that shows what the application is doing. The application shows what it's doing and after some steps it crashes. The interesting point is: It's a .Net-application, not a C++ Application.

    Read the article

  • 403 Forbidden error on Mac OSX - Apache and nginx

    - by tlianza
    Hi All, There are a million questions like this on Google, but I haven't found a solution to my problem. The default Apache install on my Mac is giving 403 Forbidden errors for everything (default directory, user home directory, virtual server, etc). After sifting through the config files, I figured I'd give nginx a try. Nginx serves files fine from it's home directory, but it won't serve files from a subfolder of my user directory. I've configured a simple virtual host, and requesting index.html returns a 403-forbidden. The error message in nginx's log file is pretty clear - it can't read the file: 2011/01/04 16:13:54 [error] 96440#0: *11 open() "/Users/me/Documents/workspace/mobile/index.html" failed (13: Permission denied), client: 127.0.0.1, server: local.test.com, request: "GET /index.html HTTP/1.1", host: "local.test.com" I've opened up this directory to everyone: drwxrwxrwx 6 me admin 204B Dec 31 20:49 mobile And all the files in it: $ ls -lah mobile/ total 24 drwxrwxrwx 6 me admin 204B Dec 31 20:49 . drwxr-xr-x 71 me me 2.4K Dec 31 20:41 .. -rw-r--r--@ 1 me me 6.0K Jan 2 18:58 .DS_Store -rwxrwxrwx 1 me admin 2.1K Jan 4 14:22 index.html drwxrwxrwx 5 me admin 170B Dec 31 20:45 nbproject drwxrwxrwx 5 me admin 170B Jan 2 18:58 script And yet, I cannot figure out why the nginx process cannot read index.html. It's running as the "nobody" user, but the permissions are set such that anyone can read them.

    Read the article

  • Help me please with this error

    - by Brandon
    I setup IIS. I moved my folder with all the files to the IIS directory. Now when I go to http://localhost/thefolder I get: An attempt was made to load a program with an incorrect format. (Exception from HRESULT: 0x8007000B) Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.BadImageFormatException: An attempt was made to load a program with an incorrect format. (Exception from HRESULT: 0x8007000B) Source Error: An unhandled exception was generated during the execution of the current web request. Information regarding the origin and location of the exception can be identified using the exception stack trace below. Stack Trace: [BadImageFormatException: An attempt was made to load a program with an incorrect format. (Exception from HRESULT: 0x8007000B)] Luxand.FSDK.ActivateLibrary(String LicenseKey) +0 FaceRecognition._Default.Page_Load(Object sender, EventArgs e) in D:\Project Details\Layne Projects\DotNet Project\FaceRecognition\FaceRecognition\Default.aspx.cs:60 System.Web.Util.CalliHelper.EventArgFunctionCaller(IntPtr fp, Object o, Object t, EventArgs e) +25 System.Web.Util.CalliEventHandlerDelegateProxy.Callback(Object sender, EventArgs e) +42 System.Web.UI.Control.OnLoad(EventArgs e) +132 System.Web.UI.Control.LoadRecursive() +66 System.Web.UI.Page.ProcessRequestMain(Boolean includeStagesBeforeAsyncPoint, Boolean includeStagesAfterAsyncPoint) +2428

    Read the article

  • Expected ')' before '*' token

    - by Danni
    So this is more of a syntax problem. I keep getting the error "Expected ')' before '*' token" on the line: #include "CDocumentObserver.h" #include "CViewPlayerDlg.h" /* * Class: CViewPlayer * */ class CViewPlayer : public wxWindow, public CDocumentObserver { public: CViewPlayer(CViewPlayerDlg *dlg); //here in CViewPLayer.h. The .cpp constructor looks like: #include "CViewPlayer.h" #include "wx/prec.h" #include "CViewPlayerDlg.h" using namespace std; BEGIN_EVENT_TABLE(CViewPlayer, wxWindow) EVT_PAINT(CViewPlayer::OnPaint) END_EVENT_TABLE() CViewPlayer::CViewPlayer(CViewPlayerDlg *dlg) : wxWindow(dlg, wxID_ANY, wxDefaultPosition, wxSize(dlg->GetDocument()->GetSize()), wxBORDER_SUNKEN), CDocumentObserver(dlg->GetDocument()), mStartTime(0), mPlayTime(0), mPlaying(false) { SetBackgroundColour(wxColour(128, 128, 128)); SetClientSize(GetDocument()->GetSize()); } What causes this error? I thought it was that something was wrong in the constructor of the .cpp but I have no idea. Dianna

    Read the article

  • Rails I18n accepts_nested_attributes_for and error_messages_for

    - by Mike
    I've got two models class SurveyResponse has_many :answers, :class_name => SurveyResponseAnswer.name accepts_nested_attributes_for :answers end class SurveyResponseAnswer belongs_to :survey_response validates_presence_of :answer_text end In my nested form if validation fails I get this error displayed on the screen: "answers answer text can't be blank" I've customized my attribute names somewhat successfully using rails I18n. It doesn't behave exactly how I would expect though. The yml file below doesn't affect how the attribute name is printed in error_messages_for en: activerecord: models: survey_response: answers: "Response" But if from script/console I try SurveyResponse.human_attribute_name("answers") I get the expected result of "Response". What I'd like to do is have the validation error message say: "Response answer text can't be blank". Any ideas what I need to fix?

    Read the article

  • Almost every Inkscape extension yields an error in Mac OS X

    - by andyvn22
    I've run the latest few versions of Inkscape (currently landed on "0.47+devel"), and have been having trouble with the Extensions menu. So far, in every version of Inkscape I've tried, nearly every extension yields the following error: The fantastic lxml wrapper for libxml2 is required by inkex.py and therefore this extension. Please download and install the latest version from http://cheeseshop.python.org/pypi/lxml/, or install it through your package manager by a command like: sudo apt-get install python-lxml I've tried the instructions listed there, of course, with no effect. I've also found many references to this issue on fora, in bug trackers, etc., and as such also tried: sudo easy_install lxml cd /Applications/Inkscape.app/Contents/Resources/lib mv libxml2.2.dylib libxml2.2.dylib.old ln -s /usr/lib/libxml2.dylib and a few similar solutions. Nothing has produced any change in Inkscape's behavior. Does anyone know A) what's really going on here? Because from what I gather the error is not describing the actual problem. And of course B) a simple solution? I need those features! :)

    Read the article

  • How to apply a free third party CA and set up Tomcat SSL with it

    - by lenny
    These days I tried to apply a free third pary CA ( www.cacert.org & www.freeca.cn ) and then set up Tomcat SSL with the CA. My purpose is to eliminate the "Certificate Error" page when accessing https://... from a client browser. But it's a little hard for me to get around it. My steps to apply a free CA, from www.freeca.cn I used keytool to generate a cer file with command: keytool -genkey ... // Generate a key keytool -certreq ... // Generate a cert file and then I got some code from the cert file, and paste onto www.freeca.cn to generate a cer file. Then I imported the cer file keytool -import -alias abc -file MyABC.cer -keystore mykeystorefile.store And then I set up the mykeystorefile.store into tomcat /conf/server.xml, but it didn't work, sill pop "Certificate Error" page when trying to access https://.... Can someone help me? Thanks

    Read the article

  • PLESK PostFix Error Local in maillog, how to troubleshoot

    - by RCNeil
    I'm using the PHP mail() function, using PostFix, on CentOS6, Plesk 10.4, and my email is not getting delivered to a particular address. My personal GMail and Yahoo email addresses receive email from my server fine and do not produce errors. After a wonderful suggestion on here, I checked my mail logs, and this is the error I see : Apr 10 10:26:29 ######### postfix/qmgr[8323]: 19EA21827: from= <[email protected]>, size=645, nrcpt=1 (queue active) Apr 10 10:26:29 ######### postfix-local[8331]: postfix-local: [email protected], [email protected], dirname=/var/qmail/mailnames Apr 10 10:26:29 ######### postfix-local[8331]: cannot chdir to mailname dir name: No such file or directory Apr 10 10:26:29 ######### postfix-local[8331]: Unknown user: [email protected] Apr 10 10:26:29 ######### postfix/pipe[8330]: 19EA21827: to=<[email protected]>, relay=plesk_virtual, delay=0.15, delays=0.11/0/0/0.04, dsn=2.0.0, status=sent (delivered via plesk_virtual service) Apr 10 10:26:29 ######### postfix/qmgr[8323]: 19EA21827: removed [email protected] is the name I've declared in php.ini for sendmail_from = "[email protected]" sendmail_path = "/usr/sbin/sendmail -t -f [email protected]" and the recipient is supposed to be [email protected]. Is this an error on my side or the recipients? Can I address this on my server? Many thanks SF.

    Read the article

  • Configure IIS Web Site for alternate Port and receive Access Permission error

    - by Andrew J. Brehm
    When I configure IIS to run a Web site on Port 1414, I get the following error: --------------------------- Internet Information Services (IIS) Manager --------------------------- The process cannot access the file because it is being used by another process. (Exception from HRESULT: 0x80070020) However, as according to netstat the port is not in use. Completely aside from IIS, I wrote a test program (just to open the port and test it): TcpListener tcpListener; tcpListener = new TcpListener(IPAddress.Any, port); try { tcpListener.Start(); Console.WriteLine("Press \"q\" key to quit."); ConsoleKeyInfo key; do { key = Console.ReadKey(); } while (key.KeyChar != 'q'); } catch (Exception ex) { Console.WriteLine(ex.Message); } tcpListener.Stop(); The result was an exception and the following ex.Message: An attempt was made to access a socket in a way forbidden by its access permissions The port was available but its "access permissions" are not allowing me access. This remains after several restarts. The port is not reserved or in use as far as I know and while IIS says it is in use, netstat and my test program say it is not and my test program receives the error that I am not allowed to access the port. The test program ran elevated. The IIS Site is running MQSeries, but the MQ listener also cannot start on port 1414 because of this issue. A quick search of my registry found nothing interesting for port 1414. What are socket access permissions and how can I correct mine to allow access?

    Read the article

  • IIS 6 302, 401 Error

    - by lvandiest
    I'm having some problems accessing an ASP.NET website hosted on an internal iis 6 server that I am maintaining. Some users can get to the site, others (including myself can't). The app has Windows Authentication mode set in the web.config file, and Integrated Windows Authentication checked in the Website properties. Anonymous access is not checked. In the IIS logs, I see 2 lines when I make a request for the site's default page (Default.aspx). The first is a 401.2 error, and the 2nd is a 302.0 error. I've tried switching around as many security settings as I can think of, but had no luck yet. Can someone please help? I'm mainly a programmer, but have done a little IIS administration, so it is probably something quite simple I am missing. -- here are the log entries for my request to Default.aspx 2011-01-11 21:17:35 10.100.1.6 GET /MonthEndInventory/Default.aspx - 80 - 10.100.1.111 Mozilla/4.0+(compatible;+MSIE+7.0;+Windows+NT+6.1;+Trident/4.0;+SLCC2;+.NET+CLR+2.0.50727;+.NET+CLR+3.5.30729;+.NET+CLR+3.0.30729;+Media+Center+PC+6.0;+OfficeLiveConnector.1.4;+OfficeLivePatch.1.3;+.NET+CLR+1.1.4322;+Tablet+PC+2.0;+.NET4.0C;+.NET4.0E;+InfoPath.3;+MS-RTC+LM+8) 401 2 2148074254 2011-01-11 21:17:35 10.100.1.6 GET /MonthEndInventory/Default.aspx - 80 DOMAIN\myuserid 10.100.1.111 Mozilla/4.0+(compatible;+MSIE+7.0;+Windows+NT+6.1;+Trident/4.0;+SLCC2;+.NET+CLR+2.0.50727;+.NET+CLR+3.5.30729;+.NET+CLR+3.0.30729;+Media+Center+PC+6.0;+OfficeLiveConnector.1.4;+OfficeLivePatch.1.3;+.NET+CLR+1.1.4322;+Tablet+PC+2.0;+.NET4.0C;+.NET4.0E;+InfoPath.3;+MS-RTC+LM+8) 302 0 0

    Read the article

  • Multiple schema validation in Java

    - by user279554
    Hi, I am trying to do multiple schema validation in Java. I don't understand where I am doing wrong. Any help will be appreciated. abc.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:xn="project-xml-r4j_another.xsd"> <xsd:import namespace="project-xml-r4j_another.xsd"/> <xsd:element name="abc" type="abc"> </xsd:element> <xsd:complexType name="abc"> <xsd:sequence> <xsd:element name="test" type="test" minOccurs="0" maxOccurs="1"> </xsd:element> <!--<xsd:element name="proj" type="xn:proj"/>--> </xsd:sequence> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> <xsd:complexType name="test"> <xsd:attribute name="id" type="xsd:ID" use="required"></xsd:attribute> <xsd:attribute name="value" use="required"> <xsd:simpleType> <xsd:restriction base="xsd:string"> <xsd:maxLength value="100" /> </xsd:restriction> </xsd:simpleType> </xsd:attribute> </xsd:complexType> </xsd:schema> project-xml-r4j_another.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" targetNamespace="project-xml-r4j_another.xsd" xmlns="project-xml-r4j_another.xsd" elementFormDefault="qualified" attributeFormDefault="unqualified"> <xsd:element name="proj" type="proj"> <xsd:annotation> <xsd:documentation> The project is the root tag of a project-xml. </xsd:documentation> </xsd:annotation> </xsd:element> <xsd:complexType name="proj"> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> </xsd:schema> Test case package test; import java.io.File; import java.io.IOException; import javax.xml.XMLConstants; import javax.xml.transform.Source; import javax.xml.transform.stream.StreamSource; import javax.xml.validation.Schema; import javax.xml.validation.SchemaFactory; import javax.xml.validation.Validator; import org.apache.log4j.Logger; import org.junit.Test; import org.xml.sax.SAXException; import org.xml.sax.SAXParseException; import org.xml.sax.helpers.DefaultHandler; import com.ericsson.ccrtool.core.project.projectxml.InvalidProjectXmlException; public class TestSchema { private static final Logger logger = Logger.getLogger(TestSchema.class); static final String W3C_XML_SCHEMA = XMLConstants.W3C_XML_SCHEMA_NS_URI; @Test public void test() { System.out.println("TestSchema.test()"); try { SchemaFactory schemaFactory = SchemaFactory.newInstance(W3C_XML_SCHEMA); // create a grammar object. Source [] source = { new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\abc.xsd")), new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\project-xml-r4j.xsd"))}; Schema schemaGrammar = schemaFactory.newSchema(source); Validator schemaValidator = schemaGrammar.newValidator(); schemaValidator.setErrorHandler(new MessageHandler()); // validate xml instance against the grammar. schemaValidator.validate(new StreamSource("C:\\jaydeep\\Ericsson\\R5B\\project_tmmk17cells_xnaveen_project-xml.xml")); } catch (SAXException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } catch (IOException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } } class MessageHandler extends DefaultHandler { private String errMessage = ""; @Override public void warning(SAXParseException e) { logger.info("Warning Line " + e.getLineNumber() + ": " + e.getMessage()); } @Override public void error(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } @Override public void fatalError(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } } } Thanks, Jaydeep

    Read the article

  • Windows 7 - system error 5 problem

    - by ianhobson
    My wife has just had a new computer for Christmas (with an upgrade from VISTA to Windows 7), and has joined the home network. We are using a mix of WindowsXP and Ubuntu boxes linked via a switch. We are all in the same workgroup. (No domain). Internet access, DHCP, and DNS server is an SME server that thinks it is domain controller (although we are not using a domain). I need to run a script to back up my wife's machine (venus). In the past the script creates a share on a machine with lots of space (leda), and then executes the line. PSEXEC \\venus -u admin -p adminpassword -c -f d:\Progs\snapshot.exe C: \\leda\Venus\C-drive.SNA With the wife's old XP machine, this would run the sysinternals utility, copy shapshot,exe to her machine and run it, which would then back up her C: drive to the share on leda. I cannot get this to work with Windows 7, nor can I link through to the C$ share on her machine. This gives me a permissions error (system error 5). The admin account is a full admin account. And yes - I do know the password. The ordinary shares on her machine work fine! I guess I'm missing something that Microsoft have built into Windows 7 - but what? The machine is running Windows 7 business, with windows firewall, AVG anti virus, and all the crap-ware you get with a new PC removed. Thanks

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Why does eclipse break when the .project file is hidden?

    - by Tommy
    Why does eclipse break with the error "Could not write file: M:\workspaces\eclipse\project.project. M:\workspaces\eclipse\project.project (Access is denied)" when the .project file is hidden (on the Windows file system)? Note: This happens w/ other files as well. Steps to Reproduce: 1. Install the latest eclipse, I am using eclipse-jee-galileo-SR2-win32.zip. (Not sure if it happens in other versions) 2. Create a project. 3. Browse to the project in windows explorer, find the .project file. 4. Right click - properties 5. Under Attributes check hidden. 6. In eclipse, open the .project file, make a change and try to save. 7. After you get the error, uncheck the hidden box and save again.

    Read the article

  • Terminate on instance "std::runtime_error" Hiphop-Php

    - by boundless08
    I have successfully built Hiphop-Php on an ubuntu server 12.04 LTS but when I run the command: $HPHP_HOME/src/hphp/hphp test.php This error occurs: terminate called after throwing an instance of 'std::runtime_error' what(): locale::facet::_S_create_c_locale name not valid Aborted (core dumped) The same error occured during the make command but I used sudo make and it dealt with that, but using sudo on the above just removes the Aborted (core dumped). This is happening on a remote server, but I have done the exact same before testing on a VM. I even got root access, as I thought that could help, but it's done nothing. Just so you know I built with USE_HHVM=0, I need the code unreadable and the bytecode format does this, but the VM I built was as well, I'm just stumped! Thanks in advance.

    Read the article

  • strerror_r returns trash when I manually set errno during testing

    - by Robert S. Barnes
    During testing I have a mock object which sets errno = ETIMEDOUT; The object I'm testing sees the error and calls strerror_r to get back an error string: if (ret) { if (ret == EAI_SYSTEM) { char err[128]; strerror_r(errno, err, 128); err_string.assign(err); } else { err_string.assign(gai_strerror(ret)); } return ret; } I don't understand why strerror_r is returning trash. I even tried calling strerror_r(ETIMEDOUT, err, 128) directly and still got trash. I must be missing something. It seems I'm getting the gnu version of the function not the posix one, but that shouldn't make any difference in this case.

    Read the article

  • boost::dynamic_pointer_cast with const pointer not working ?

    - by ereOn
    Hi, Let's say I have two classes, A and B, where B is a child class of A. I also have the following function: void foo(boost::shared_ptr<const A> a) { boost::shared_ptr<const B> b = boost::dynamic_pointer_cast<const B>(a); // Error ! } Compilation with gcc gives me the following errors: C:\Boost\include/boost/smart_ptr/shared_ptr.hpp: In constructor 'boost::shared_ptr< <template-parameter-1-1> >::shared_ptr(const boost::shared_ptr<Y>&, boost::detail::dynamic_cast_tag) [with Y = const A, T = const B]': C:\Boost\include/boost/smart_ptr/shared_ptr.hpp:522: instantiated from 'boost::shared_ptr<X> boost::dynamic_pointer_cast(const boost::shared_ptr<U>&) [with T = const B, U = const A]' src\a.cpp:10: instantiated from here C:\Boost\include/boost/smart_ptr/shared_ptr.hpp:259: error: cannot dynamic_cast 'r->boost::shared_ptr<const A>::px' (of type 'const class A* const') to type 'const class B*' (source type is not polymorphic) What could possibly be wrong ? Thank you.

    Read the article

  • GWT application throws an exception when run on Google Chrome with compiler output style set to 'OBF

    - by Elifarley
    I'd like to know if you guys have faced the same problem I'm facing, and how you are dealing with it. Sometimes, a small and harmless change in a Java class ensues strange errors at runtime. These errors only happen if BOTH conditions below are true: 2) the application is run on Google Chrome, and 1) the GWT JavaScript compiler output style is set to 'OBF'. So, running the application on Firefox or IE always works. Running with the output style set to 'pretty' or 'detailed' always works, even on Google Chrome. Here's an example of error message that I got: "((TypeError): Property 'top' of object [object DOMWindow] is not a function stack" And here's what I have: - GWT 1.5.3 - GXT 1.2.4 - Google Chrome 4 and 5 - Windows XP In order to get rid of this Heisenbug, I have to either deploy my application without obfuscation or endure a time-consuming trial-and-error process in which I re-implement the change in slightly different ways and re-run the application, until the GWT compiler is happy with my code. Would you have a better idea on how to avoid this?

    Read the article

  • live search with Jquery

    - by user272899
    Hello! I am trying to implement a live search on my site. I am using a script somebody has already created. http://www.reynoldsftw.com/2009/03/live-mysql-database-search-with-jquery/ I have got the Jquery, css, html working correctly but am having troubles with the php. I need to change it to contain my database information but everytime I do I recieve an error: Warning: mysql_fetch_array() expects parameter 1 to be resource, boolean given in C:\wamp\www\search.php on line 33 These are the details of my database: database name: development table name: links Columns: id, sitename, siteurl, description, category This is the php script <?php $dbhost = "localhost"; $dbuser = "root"; $dbpass = "password"; $dbname = "links"; $conn = mysql_connect($dbhost, $dbuser, $dbpass) or die ('Error connecting to mysql'); mysql_select_db($dbname); if(isset($_GET['query'])) { $query = $_GET['query']; } else { $query = ""; } if(isset($_GET['type'])) { $type = $_GET['type']; } else { $query = "count"; } if($type == "count") { $sql = mysql_query("SELECT count(url_id) FROM urls WHERE MATCH(url_url, url_title, url_desc) AGAINST('$query' IN BOOLEAN MODE)"); $total = mysql_fetch_array($sql); $num = $total[0]; echo $num; } if($type == "results") { $sql = mysql_query("SELECT url_url, url_title, url_desc FROM urls WHERE MATCH(url_url, url_title, url_desc) AGAINST('$query' IN BOOLEAN MODE)"); while($array = mysql_fetch_array($sql)) { $url_url = $array['url_url']; $url_title = $array['url_title']; $url_desc = $array['url_desc']; echo "<div class=\"url-holder\"><a href=\"" . $url_url . "\" class=\"url-title\" target=\"_blank\">" . $url_title . "</a> <div class=\"url-desc\">" . $url_desc . "</div></div>"; } } mysql_close($conn); ?> Can anybody help me input this database info correctly? I have tried many times but keep getting an error. Thanks in advance.

    Read the article

  • Error C2491 on C source with Visual studio 8

    - by Tobia
    i'm really noob in C. I just need to compile a ANSI C source to get a dll. During compilation i get this error: C2491: 'SelectML': definition of dllimport function not allowed Where SelectML is a public function with this definition: int CALLINGCONV SelectML(WORD fid, int nSlot) { WORD SW; int x; BYTE pSend[2]; pSend[0]=(BYTE)((fid&0xff00)>>8); pSend[1]=(BYTE)(fid&0x00ff); x=SendAPDUML(hCards[nSlot],APDU_SELECT,2,0,pSend,0,&SW); if (x!=C_OK) return x; if (SW!=0x9000) return SW; return C_OK; } I'm sure the C source is good, maybe it is just a Visual Studio configuration...

    Read the article

  • Zend Framework ErrorController not working on live site?

    - by firecall
    My site is set up pretty much as per the Zend Quickstart guide. The default ErrorController works locally using MAMP. But now I've deployed it to my live site I get a blank page and a "500 Internal Server Error" according to FireBug when I go to an action that doesnt exist. On my local server I get a 404 and a nicely formatted error page. Any ideas anyone? I dont really know where to begin looking. I'm confused :/ Thanks.

    Read the article

  • the name 'controlname' does not exist in the current context

    - by zohair
    Hi, I have a web application that I'm working on(ASP.NET2.0 with C#)[Using VS2005]. Everything was working fine, and all of a sudden I get the error: Error 1 The name 'Label1' does not exist in the current context and 43 others of the sort for each time that I used a control in my codebehind of the page. This is only happening for 1 page. And it's as if the codebehind isn't recognizing the controls. Another interesting thing is that the intellisense isn't picking up any of the controls either.. I have tried to clean the solution file, delete the obj file, exclude the files from the project then re-add them, close VS and restart it, and even restart my computer, but none of these have worked. Please Help. Thank you

    Read the article

  • FTP - 530 Sorry, the maximum number of clients...?

    - by aSeptik
    Hi All! i know this is not a properly code question, but who of you don't use an FTP client!? ;-) Ok my problem is that my FTP work great, exept when i upload files on a particular client server! on this server happen that some files are uploaded fine and others not, they stop while uploading at half of it's size, then this error is displayed: 530 Sorry, the maximum number of clients (4) from your host are already connected. Unable to make a connection. Please try again. Obviously this is not true, i'm the only one that is uploading! Anyone had the same experience with this!? PS: i have tried many different FTP, all display the same error or just hung up! Thank's

    Read the article

  • How to export SQL Server data from corrupted database (with disk write error)

    - by damitamit
    IT realised there was a disk write error on our production SQL Server 2005 and hence was causing the backups to fail. By the time they had realised this the nightly backup was old, so were not able to just restore the backup on another server. The database is still running and being used constantly. However DBCC CheckDB fails. Also the SQL Server backup task fails, Copy Database fails, Export Data Wizard fails. However it seems all the data can be read from the tables (i.e using bcp etc) Another observation I have made is that the Transaction Log is nearly double the size of the Database. (Does that mean all the changes arent being written to the MDF?) What would be the best plan of attack to get the database to a state where backups are working and the data is safe? Take the database offline and use the MDF/LDF to somehow create the database on another sql server? Export the data from the database using bcp. Create the database (use the Generate Scripts function on the corrupt db to create the schema on the new db) on another sql server and use bcp again to import the data. Some other option that is the right course of action in this situation? The IT manager says the data is safe as if the server fails, the data can be restored from the mdf/ldf. I'm not sure so insisted that we start exporting the data each night as a failsafe (using bcp for example). IT are also having issues on the hardware side of things as supposedly the disk error in on a virtualized disk and can't be rebuilt like a normal raid array (or something like that). Please excuse my use of incorrect terminology and incorrect assumptions on how Sql Server operates. I'm the application developer and have been called to help (as it seems IT know less about SQL Server than I do). Many Thanks, Amit

    Read the article

< Previous Page | 315 316 317 318 319 320 321 322 323 324 325 326  | Next Page >