Search Results

Search found 29101 results on 1165 pages for 'open basedir'.

Page 325/1165 | < Previous Page | 321 322 323 324 325 326 327 328 329 330 331 332  | Next Page >

  • Excel 2010 Access to path is denied temp

    - by Chris Anderson
    I am using excel data reader to read data from an excel file. FileStream stream = File.Open(filePath, FileMode.Open, FileAccess.Read); //1. Reading from a binary Excel file ('97-2003 format; *.xls) IExcelDataReader excelReader = ExcelReaderFactory.CreateBinaryReader(stream); //2. Reading from a OpenXml Excel file (2007 format; *.xlsx) IExcelDataReader excelReader = ExcelReaderFactory.CreateOpenXmlReader(stream); http://exceldatareader.codeplex.com/ This reads excel 1997-2003 format and excel 2007 format on my local machine and when we move it to our test server. However, when moved to production, it works for excel 97-2003 files, but when I try to read 2007 files I receive the following error: Access to the path 'C:\Documents and Settings\PORTALS03\ASPNET\LOCALS~1\Temp\TMP_Z129388041687919815' is denied. How is it possible that the 97-2003 excel file can be read but the 2007 files throw access is denied?

    Read the article

  • "Look" of page changes a bit after uploading it to IIS - looks good on computer same IE8

    - by J Smith
    No it's not a path issue...or else the site won't have a design. The website looks fine if I open it with IE8 in my computer. But after I upload it to IIS 6.0 two things change on positioning. I see a rendering problem. But if I open it with IE 8.0 on my machine it looks good, but opening it when uploaded to IIS , it changes a bit. Same exact files. Same browser, same computer. The only different thing is that it has been uploaded to IIS. IT has no programming in aspx whatsoever just .html .css and .js

    Read the article

  • Python - Converting CSV to Objects - Code Design

    - by victorhooi
    Hi, I have a small script we're using to read in a CSV file containing employees, and perform some basic manipulations on that data. We read in the data (import_gd_dump), and create an Employees object, containing a list of Employee objects (maybe I should think of a better naming convention...lol). We then call clean_all_phone_numbers() on Employees, which calls clean_phone_number() on each Employee, as well as lookup_all_supervisors(), on Employees. import csv import re import sys #class CSVLoader: # """Virtual class to assist with loading in CSV files.""" # def import_gd_dump(self, input_file='Gp Directory 20100331 original.csv'): # gd_extract = csv.DictReader(open(input_file), dialect='excel') # employees = [] # for row in gd_extract: # curr_employee = Employee(row) # employees.append(curr_employee) # return employees # #self.employees = {row['dbdirid']:row for row in gd_extract} # Previously, this was inside a (virtual) class called "CSVLoader". # However, according to here (http://tomayko.com/writings/the-static-method-thing) - the idiomatic way of doing this in Python is not with a class-fucntion but with a module-level function def import_gd_dump(input_file='Gp Directory 20100331 original.csv'): """Return a list ('employee') of dict objects, taken from a Group Directory CSV file.""" gd_extract = csv.DictReader(open(input_file), dialect='excel') employees = [] for row in gd_extract: employees.append(row) return employees def write_gd_formatted(employees_dict, output_file="gd_formatted.csv"): """Read in an Employees() object, and write out each Employee() inside this to a CSV file""" gd_output_fieldnames = ('hrid', 'mail', 'givenName', 'sn', 'dbcostcenter', 'dbdirid', 'hrreportsto', 'PHFull', 'PHFull_message', 'SupervisorEmail', 'SupervisorFirstName', 'SupervisorSurname') try: gd_formatted = csv.DictWriter(open(output_file, 'w', newline=''), fieldnames=gd_output_fieldnames, extrasaction='ignore', dialect='excel') except IOError: print('Unable to open file, IO error (Is it locked?)') sys.exit(1) headers = {n:n for n in gd_output_fieldnames} gd_formatted.writerow(headers) for employee in employees_dict.employee_list: # We're using the employee object's inbuilt __dict__ attribute - hmm, is this good practice? gd_formatted.writerow(employee.__dict__) class Employee: """An Employee in the system, with employee attributes (name, email, cost-centre etc.)""" def __init__(self, employee_attributes): """We use the Employee constructor to convert a dictionary into instance attributes.""" for k, v in employee_attributes.items(): setattr(self, k, v) def clean_phone_number(self): """Perform some rudimentary checks and corrections, to make sure numbers are in the right format. Numbers should be in the form 0XYYYYYYYY, where X is the area code, and Y is the local number.""" if self.telephoneNumber is None or self.telephoneNumber == '': return '', 'Missing phone number.' else: standard_format = re.compile(r'^\+(?P<intl_prefix>\d{2})\((?P<area_code>\d)\)(?P<local_first_half>\d{4})-(?P<local_second_half>\d{4})') extra_zero = re.compile(r'^\+(?P<intl_prefix>\d{2})\(0(?P<area_code>\d)\)(?P<local_first_half>\d{4})-(?P<local_second_half>\d{4})') missing_hyphen = re.compile(r'^\+(?P<intl_prefix>\d{2})\(0(?P<area_code>\d)\)(?P<local_first_half>\d{4})(?P<local_second_half>\d{4})') if standard_format.search(self.telephoneNumber): result = standard_format.search(self.telephoneNumber) return '0' + result.group('area_code') + result.group('local_first_half') + result.group('local_second_half'), '' elif extra_zero.search(self.telephoneNumber): result = extra_zero.search(self.telephoneNumber) return '0' + result.group('area_code') + result.group('local_first_half') + result.group('local_second_half'), 'Extra zero in area code - ask user to remediate. ' elif missing_hyphen.search(self.telephoneNumber): result = missing_hyphen.search(self.telephoneNumber) return '0' + result.group('area_code') + result.group('local_first_half') + result.group('local_second_half'), 'Missing hyphen in local component - ask user to remediate. ' else: return '', "Number didn't match recognised format. Original text is: " + self.telephoneNumber class Employees: def __init__(self, import_list): self.employee_list = [] for employee in import_list: self.employee_list.append(Employee(employee)) def clean_all_phone_numbers(self): for employee in self.employee_list: #Should we just set this directly in Employee.clean_phone_number() instead? employee.PHFull, employee.PHFull_message = employee.clean_phone_number() # Hmm, the search is O(n^2) - there's probably a better way of doing this search? def lookup_all_supervisors(self): for employee in self.employee_list: if employee.hrreportsto is not None and employee.hrreportsto != '': for supervisor in self.employee_list: if supervisor.hrid == employee.hrreportsto: (employee.SupervisorEmail, employee.SupervisorFirstName, employee.SupervisorSurname) = supervisor.mail, supervisor.givenName, supervisor.sn break else: (employee.SupervisorEmail, employee.SupervisorFirstName, employee.SupervisorSurname) = ('Supervisor not found.', 'Supervisor not found.', 'Supervisor not found.') else: (employee.SupervisorEmail, employee.SupervisorFirstName, employee.SupervisorSurname) = ('Supervisor not set.', 'Supervisor not set.', 'Supervisor not set.') #Is thre a more pythonic way of doing this? def print_employees(self): for employee in self.employee_list: print(employee.__dict__) if __name__ == '__main__': db_employees = Employees(import_gd_dump()) db_employees.clean_all_phone_numbers() db_employees.lookup_all_supervisors() #db_employees.print_employees() write_gd_formatted(db_employees) Firstly, my preamble question is, can you see anything inherently wrong with the above, from either a class design or Python point-of-view? Is the logic/design sound? Anyhow, to the specifics: The Employees object has a method, clean_all_phone_numbers(), which calls clean_phone_number() on each Employee object inside it. Is this bad design? If so, why? Also, is the way I'm calling lookup_all_supervisors() bad? Originally, I wrapped the clean_phone_number() and lookup_supervisor() method in a single function, with a single for-loop inside it. clean_phone_number is O(n), I believe, lookup_supervisor is O(n^2) - is it ok splitting it into two loops like this? In clean_all_phone_numbers(), I'm looping on the Employee objects, and settings their values using return/assignment - should I be setting this inside clean_phone_number() itself? There's also a few things that I'm sorted of hacked out, not sure if they're bad practice - e.g. print_employee() and gd_formatted() both use __dict__, and the constructor for Employee uses setattr() to convert a dictionary into instance attributes. I'd value any thoughts at all. If you think the questions are too broad, let me know and I can repost as several split up (I just didn't want to pollute the boards with multiple similar questions, and the three questions are more or less fairly tightly related). Cheers, Victor

    Read the article

  • Create an assembly in memory

    - by Jared I
    I'd like to create an assembly in memory, using an using the classes in Reflection.Emit Currently, I can create the assembly and get it's bytes using something like AssemblyBuilder builder = AppDomain.CurrentDomain.DefineDynamicAssembly(..., AssemblyBuilderAccess.Save); ... create the assembly ... builder.Save(targetFileName); using(FileStream fs = File.Open(targetFileName, FileMode.Open)) { ... read the bytes from the file stream ... } However, it does so by creating a file on the local filesystem. I don't actually need the file, just the bytes that would be in the file. Is it possible to create the assembly without writing any files?

    Read the article

  • Sharepoint checkin/checkout

    - by Prashanth
    We have a sharepoint based application that uses a custom database for storing metadata/files (which could also be on a file share) My question is how can the standard file checkin/check out option in document library be customized? The javascript file ows.js in the layouts folder contains the functions that provide checkin/check out/ open file functionality. Behind the scenes it relies on a combination of HTTP Post/GET methods + SOAP + an activeX control to achieve the desired functionality. Customizing these javascript function seems tedious/error prone. Note that we have a web service that exposes endpoints, for retrieving necessary file information/data from the backend. The difficulty is in integrating it with the sharepoint js functions, due to lack of proper documentation. (Also the js functions might change over different versions of sharepoint) Also is it possible to create files/open files etc from the cache area on the client machine from server side code?

    Read the article

  • Access Denied Java FileWriter / FileInputStream

    - by Matt
    My program downloads a websites source code, modifies it, creates the file, and then reuploads it through the FTP. However, I receive the following error when trying to open the created file: java.io.FileNotFoundException: misc.html (Access is denied) at java.io.FileInputStream.open(Native Method) at java.io.FileInputStream.<init>(Unknown Source) at Manipulator.uploadSource(Manipulator.java:63) at Start.addPicture(Start.java:130) at Start$2.actionPerformed(Start.java:83) at javax.swing.AbstractButton.fireActionPerformed(Unknown Source) at javax.swing.AbstractButton$Handler.actionPerformed(Unknown Source) at javax.swing.DefaultButtonModel.fireActionPerformed(Unknown Source) at javax.swing.DefaultButtonModel.setPressed(Unknown Source) at javax.swing.plaf.basic.BasicButtonListener.mouseReleased(Unknown Source) at java.awt.Component.processMouseEvent(Unknown Source) at javax.swing.JComponent.processMouseEvent(Unknown Source) at java.awt.Component.processEvent(Unknown Source) at java.awt.Container.processEvent(Unknown Source) at java.awt.Component.dispatchEventImpl(Unknown Source) at java.awt.Container.dispatchEventImpl(Unknown Source) at java.awt.Component.dispatchEvent(Unknown Source) at java.awt.LightweightDispatcher.retargetMouseEvent(Unknown Source) at java.awt.LightweightDispatcher.processMouseEvent(Unknown Source) at java.awt.LightweightDispatcher.dispatchEvent(Unknown Source) at java.awt.Container.dispatchEventImpl(Unknown Source) at java.awt.Window.dispatchEventImpl(Unknown Source) at java.awt.Component.dispatchEvent(Unknown Source) at java.awt.EventQueue.dispatchEvent(Unknown Source) at java.awt.EventDispatchThread.pumpOneEventForFilters(Unknown Source) at java.awt.EventDispatchThread.pumpEventsForFilter(Unknown Source) at java.awt.EventDispatchThread.pumpEventsForHierarchy(Unknown Source) at java.awt.EventDispatchThread.pumpEvents(Unknown Source) at java.awt.EventDispatchThread.pumpEvents(Unknown Source) at java.awt.EventDispatchThread.run(Unknown Source) When I navigate to the folder directory and attempt to open "misc.html" with Notepad I receive Access is Denied. My code is fairly simple: File f = new File(page.sourceFileName); try { FileWriter out = new FileWriter(f); out.write(page.source); out.close(); } catch (IOException e) { e.printStackTrace(); } InputStream input = new FileInputStream(f); This is the vital excerpt from my program. I have copied this into a different test program and it works fine, I create a misc.html file and reopen it with both FileInputStream and manually. I would be worried about Administrator rights but the Test program works fine when I run it RIGHT after the problem program. I also have checked if the file exists and is a file with File methods and it is as well. Is this a result of me not closing a previous Input/Output properly? I've tried to check everything and I am fairly positive I close all streams as soon as they finish... Help! :)

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • PHP want to buy / find a eMall, Shopping Mall system with multiple vendor management backend

    - by Shiro
    Basically I am looking for a Shopping Mall system in PHP. User included Member / User Administrator Vendor Affiliate I find a lot ecommerce that support multiple shop, but each vendor don't have their own login and management. And in the front I would like to share the cart. and can buy from different shop. If multiple subdomain supported that would be more better. Web 2.0 design would be much more preferable. Any suggestion? I google some of it, hopefully can get more references. Buy / Open source also please advice. I don't think this kind of system got open source :p

    Read the article

  • How to set source path of image within html pages to show in webbrowser control

    - by Royson
    Hi in my application there is web browser control to show some static html pages. The pages are displayed properly. but images are not displayed.. I tried with changing src-path but no success. my htmlpages folder is located at bin folder. And i am assigning it as. FileStream source = new FileStream(@"..\HtmlPages\supportHtml.html", FileMode.Open, FileAccess.Read); if i open html files in browser, the images are displayed properly.. So, What is the correct path for images..?? If i set full path to src attribute of <img> tag..it works. but i think its not a proper way. :( EDIT: If i assign d:\myapp\bin\HtmlPages\support.gif then image is displayed. And if i assign "..\HtmlPages\support.gif" or "support.gif" image is not shown.

    Read the article

  • Jqm is not a function

    - by kris
    Hi all, I'm having some trouble with Jquery and JqModal, and I hope you are able to help, since I've been struggling for hours.. Having a single button element with an onclick action running my method "test" (shown below): $('#picture_form').jqm({ajax: '/test.php'}); $('#picture_form').jqmShow(); This will load the ajax content of test.php into my div element picture_form, shown using JqModal as its supposed to! Though when I close this window, and re-clicks the button I'm getting the error: $("#picture_form").jqm is not a function. As a solution I've tried to use the JqModal trigger function, and this leaves me able to open and close the JqModal windows as many times as I want to. Sadly I can only call the 'trigger' using test environment, in my production code I have to open the JqModal window using a function.. Does anyone have a clue why this 'bug' appears when calling the opening when using a function? Thanks in advance

    Read the article

  • IE 8 dialog windows not decompressing files

    - by Mike
    Hi, I've got a website where we have pre-compressed all of our HTML files. In general this works fine, but since IE 8 has come out some people are finding that they can not use some parts of the website. We've used the showModalDialog command to open a dialog window and pointing to one of our pre-compressed files but it displays it just show up as strange characters (ie not decompressed). Now it only happens in the dialog. I'm pretty sure our compression is all fine because the page they are viewing to open the dialog is also compressed. Has anyone else come across this or got any suggestions cuz i'm stumped??? Thanks, Mike

    Read the article

  • XSLT: How to escape square brackets in Urls

    - by ilariac
    I have a set of records from Solr where field[@name='url'] can have the following format: http://url/blabla/blabla.aspx?sv=[keyword%20keyword,%201] My understanding is that the square brackets denote an array syntax and I would like to use XSLT to remove the square brackets from all Urls. The reason for this is that I am using an Open URL resolver, which does not currently handle well those characters. The best option would be to strip the square brackets from all URLs before such resources are mediated by the Open URL resolver. There are cases where I have multiple occurrences of square brackets per Url. Can you please help me with this? Thanks for your help, I.

    Read the article

  • Upload and parse csv file with "universal newline" in python on Google App Engine

    - by greg
    Hi, I'm uploading a csv/tsv file from a form in GAE, and I try to parse the file with python csv module. Like describe here, uploaded files in GAE are strings. So I treat my uploaded string a file-like object : file = self.request.get('catalog') catalog = csv.reader(StringIO.StringIO(file),dialect=csv.excel_tab) But new lines in my files are not necessarily '\n' (thanks to excel..), and it generated an error : Error: new-line character seen in unquoted field - do you need to open the file in universal-newline mode? Does anyone know how to use StringIO.StringIO to treat strings like files open in universal-newline?

    Read the article

  • How do I determine which C/C++ compiler to use?

    - by Adam Siddhi
    Greetings, I am trying to figure out which C/C++ compiler to use. I found this list of C/C++ compilers at Wikipedia: http://en.wikipedia.org/wiki/List_of_compilers#C.2FC.2B.2B_compilers I am fairly certain that I want to go with an open source compiler. I feel that if it is open source then it will be a more complete compiler since many programmer perspectives are used to make it better. Please tell me if you disagree. I should mention that I plan on learning C/C++ mainly to program 2D/3D game applications that will be compatible with Windows, Linux, MAC and iPhone operating systems. I am currently using Windows Vista x64 OS. Thanks, Adam

    Read the article

  • Read entire file in Scala?

    - by Brendan OConnor
    What's a simple and canonical way to read an entire file into memory in Scala? (Ideally, with control over character encoding.) The best I can come up with is: scala.io.Source.fromPath("file.txt").getLines.reduceLeft(_+_) or am I supposed to use one of Java's god-awful idioms, the best of which (without using an external library) seems to be: import java.util.Scanner import java.io.File new Scanner(new File("file.txt")).useDelimiter("\\Z").next() From reading mailing list discussions, it's not clear to me that scala.io.Source is even supposed to be the canonical I/O library. I don't understand what its intended purpose is, exactly. ... I'd like something dead-simple and easy to remember. For example, in these languages it's very hard to forget the idiom ... Ruby open("file.txt").read Ruby File.read("file.txt") Python open("file.txt").read()

    Read the article

  • .Net Dynamically Load DLL

    - by hermiod
    I am trying to write some code that will allow me to dynamically load DLLs into my application, depending on an application setting. The idea is that the database to be accessed is set in the application settings and then this loads the appropriate DLL and assigns it to an instance of an interface for my application to access. This is my code at the moment: Dim SQLDataSource As ICRDataLayer Dim ass As Assembly = Assembly. _ LoadFrom("M:\MyProgs\WebService\DynamicAssemblyLoading\SQLServer\bin\Debug\SQLServer.dll") Dim obj As Object = ass.CreateInstance(GetType(ICRDataLayer).ToString, True) SQLDataSource = DirectCast(obj, ICRDataLayer) MsgBox(SQLDataSource.ModuleName & vbNewLine & SQLDataSource.ModuleDescription) I have my interface (ICRDataLayer) and the SQLServer.dll contains an implementation of this interface. I just want to load the assembly and assign it to the SQLDataSource object. The above code just doesn't work. There are no exceptions thrown, even the Msgbox doesn't appear. I would've expected at least the messagebox appearing with nothing in it, but even this doesn't happen! Is there a way to determine if the loaded assembly implements a specific interface. I tried the below but this also doesn't seem to do anything! For Each loadedType As Type In ass.GetTypes If GetType(ICRDataLayer).IsAssignableFrom(loadedType) Then Dim obj1 As Object = ass.CreateInstance(GetType(ICRDataLayer).ToString, True) SQLDataSource = DirectCast(obj1, ICRDataLayer) End If Next EDIT: New code from Vlad's examples: Module CRDataLayerFactory Sub New() End Sub ' class name is a contract, ' should be the same for all plugins Private Function Create() As ICRDataLayer Return New SQLServer() End Function End Module Above is Module in each DLL, converted from Vlad's C# example. Below is my code to bring in the DLL: Dim SQLDataSource As ICRDataLayer Dim ass As Assembly = Assembly. _ LoadFrom("M:\MyProgs\WebService\DynamicAssemblyLoading\SQLServer\bin\Debug\SQLServer.dll") Dim factory As Object = ass.CreateInstance("CRDataLayerFactory", True) Dim t As Type = factory.GetType Dim method As MethodInfo = t.GetMethod("Create") Dim obj As Object = method.Invoke(factory, Nothing) SQLDataSource = DirectCast(obj, ICRDataLayer) EDIT: Implementation based on Paul Kohler's code Dim file As String For Each file In Directory.GetFiles(baseDir, searchPattern, SearchOption.TopDirectoryOnly) Dim assemblyType As System.Type For Each assemblyType In Assembly.LoadFrom(file).GetTypes Dim s As System.Type() = assemblyType.GetInterfaces For Each ty As System.Type In s If ty.Name.Contains("ICRDataLayer") Then MsgBox(ty.Name) plugin = DirectCast(Activator.CreateInstance(assemblyType), ICRDataLayer) MessageBox.Show(plugin.ModuleName) End If Next I get the following error with this code: Unable to cast object of type 'SQLServer.CRDataSource.SQLServer' to type 'DynamicAssemblyLoading.ICRDataLayer'. The actual DLL is in a different project called SQLServer in the same solution as my implementation code. CRDataSource is a namespace and SQLServer is the actual class name of the DLL. The SQLServer class implements ICRDataLayer, so I don't understand why it wouldn't be able to cast it. Is the naming significant here, I wouldn't have thought it would be.

    Read the article

  • Web service reference location?

    - by Damien Dennehy
    I have a Visual Studio 2008 solution that's currently consisting of three projects: A DataFactory project for Business Logic/Data Access. A Web project consisting of the actual user interface, pages, controls, etc. A Web.Core project consisting of utility classes, etc. The application requires consuming a web service. Normally I'd add the service reference to the Web project, but I'm not sure if this is best practice or not. The following options are open to me: Add the reference to the Web project. Add the reference to the Web.Core project, and create a wrapper method that Web will call to consume the web service. Add a new project called Web.Services, and copy step 2. This project is expected to increase in size so I'm open to any suggestions.

    Read the article

  • What's wrong with this SQL Server query ?

    - by ClixNCash
    What's wrong this T-SQL query : Protected Sub Button1_Click(ByVal sender As Object, ByVal e As System.EventArgs) Handles Button1.Click Dim SQLData As New System.Data.SqlClient.SqlConnection("Data Source=.\SQLEXPRESS;AttachDbFilename=|DataDirectory|\Database.mdf;Integrated Security=True;User Instance=True") Dim cmdSelect As New System.Data.SqlClient.SqlCommand("SELECT COUNT(*) FROM Table1 WHERE Name ='" + TextBox1.Text + "'", SQLData) SQLData.Open() If cmdSelect.ExecuteScalar > 0 Then Label1.Text = "You have already voted this service" Return End If Dim con As New SqlConnection Dim cmd As New SqlCommand con.Open() cmd.Connection = con cmd.CommandText = "INSERT INTO Tabel1 (Name) VALUES('" & Trim(Label1.Text) & "')" cmd.ExecuteNonQuery() Label1.Text = "Thank You !" SQLData.Close() End Sub

    Read the article

  • SharePoint 2010 is forcing me to safe PDF when opening from doc library

    - by Tobias Funke
    I have a document library with a PDF file. Whenever I click on the PDF file, I am prompted to save the file. I do not get the option of opening the file, I am forced to save it. What I want is for the PDF file to open, either in the browser or in a separate Adobe Reader window, depending on the Adobe Reader settings. I'm pretty sure SharePoint is responsible for this behavior, because if I put the PDF on my hard drive, then create a HTML file with a link to the file, it opens in the browser when I click on it. Please note: I looked at this question and did not help. I don't care if the PDF opens in the browser or in a separate Adobe Reader window, I just want it to open.

    Read the article

  • Extract a C/C++ header file from a C# class exposed to COM

    - by isorfir
    I'm not sure I've setup everything I've needed to in my C# class to properly, but it does work in COM. I've been looking for an example of a C# class that was successfully used in a C/C++ project, but haven't come across anything. I've tried using the OLE/COM Object View app to open the .tlb file and save as .h, but it gives some errors: MIDL1009: unknown argument ignored; MIDL1001: cannot open input file Studio "Studio" isn't the name of the file, it's Syslog, so that raises a red flag to me. Any ideas?

    Read the article

  • Algorithmic trading software safety guards

    - by Adal
    I'm working on an automatic trading system. What sorts of safe-guards should I have in place? The main idea I have is to have multiple pieces checking each other. I will have a second independent little process which will also connect to the same trading account and monitor simple things, like ensuring the total net position does not go over a certain limit, or that there are no more than N orders in 10 minutes for example, or more than M positions open simultaneously. You can also check that the actual open positions correspond to what the strategy process thinks it actually holds. As a bonus I could run this checker process on a different machine/network provider. Besides the checks in the main strategy, this will ensure that whatever weird bug occurs, nothing really bad can happen. Any other things I should monitor and be aware of?

    Read the article

  • Problem extracting text from RSS feeds

    - by Gautam
    Hi, I am new to the world of Ruby and Rails. I have seen rails cast 190 and I just started playing with it. I used selector gadget to find out the CSS and XPath I have the following code.. require 'rubygems' require 'nokogiri' require 'open-uri' url = "http://www.telegraph.co.uk/sport/football/rss" doc = Nokogiri::HTML(open(url)) doc.xpath('//a').each do |paragraph| puts paragraph.text end When I extracted text from a normal HTML page with css, I could get the extracted text on the console. But when I try to do the same either with CSS or XPath for the RSS Feed for the following URL mentioned in the code above, I dont get any output. How do you extract text from RSS feeds?? I also have another silly question. Is there a way to extract text from 2 different feeds and display it on the console something like url1 = "http://www.telegraph.co.uk/sport/football/rss" url2 = "http://www.telegraph.co.uk/sport/cricket/rss" Looking forward for your help and suggestions Thank You Gautam

    Read the article

< Previous Page | 321 322 323 324 325 326 327 328 329 330 331 332  | Next Page >