Search Results

Search found 31994 results on 1280 pages for 'input output'.

Page 332/1280 | < Previous Page | 328 329 330 331 332 333 334 335 336 337 338 339  | Next Page >

  • Parent Objects

    - by Ali Bahrami
    Support for Parent Objects was added in Solaris 11 Update 1. The following material is adapted from the PSARC arc case, and the Solaris Linker and Libraries Manual. A "plugin" is a shared object, usually loaded via dlopen(), that is used by a program in order to allow the end user to add functionality to the program. Examples of plugins include those used by web browsers (flash, acrobat, etc), as well as mdb and elfedit modules. The object that loads the plugin at runtime is called the "parent object". Unlike most object dependencies, the parent is not identified by name, but by its status as the object doing the load. Historically, building a good plugin is has been more complicated than it should be: A parent and its plugin usually share a 2-way dependency: The plugin provides one or more routines for the parent to call, and the parent supplies support routines for use by the plugin for things like memory allocation and error reporting. It is a best practice to build all objects, including plugins, with the -z defs option, in order to ensure that the object specifies all of its dependencies, and is self contained. However: The parent is usually an executable, which cannot be linked to via the usual library mechanisms provided by the link editor. Even if the parent is a shared object, which could be a normal library dependency to the plugin, it may be desirable to build plugins that can be used by more than one parent, in which case embedding a dependency NEEDED entry for one of the parents is undesirable. The usual way to build a high quality plugin with -z defs uses a special mapfile provided by the parent. This mapfile defines the parent routines, specifying the PARENT attribute (see example below). This works, but is inconvenient, and error prone. The symbol table in the parent already describes what it makes available to plugins — ideally the plugin would obtain that information directly rather than from a separate mapfile. The new -z parent option to ld allows a plugin to link to the parent and access the parent symbol table. This differs from a typical dependency: No NEEDED record is created. The relationship is recorded as a logical connection to the parent, rather than as an explicit object name However, it operates in the same manner as any other dependency in terms of making symbols available to the plugin. When the -z parent option is used, the link-editor records the basename of the parent object in the dynamic section, using the new tag DT_SUNW_PARENT. This is an informational tag, which is not used by the runtime linker to locate the parent, but which is available for diagnostic purposes. The ld(1) manpage documentation for the -z parent option is: -z parent=object Specifies a "parent object", which can be an executable or shared object, against which to link the output object. This option is typically used when creating "plugin" shared objects intended to be loaded by an executable at runtime via the dlopen() function. The symbol table from the parent object is used to satisfy references from the plugin object. The use of the -z parent option makes symbols from the object calling dlopen() available to the plugin. Example For this example, we use a main program, and a plugin. The parent provides a function named parent_callback() for the plugin to call. The plugin provides a function named plugin_func() to the parent: % cat main.c #include <stdio.h> #include <dlfcn.h> #include <link.h> void parent_callback(void) { printf("plugin_func() has called parent_callback()\n"); } int main(int argc, char **argv) { typedef void plugin_func_t(void); void *hdl; plugin_func_t *plugin_func; if (argc != 2) { fprintf(stderr, "usage: main plugin\n"); return (1); } if ((hdl = dlopen(argv[1], RTLD_LAZY)) == NULL) { fprintf(stderr, "unable to load plugin: %s\n", dlerror()); return (1); } plugin_func = (plugin_func_t *) dlsym(hdl, "plugin_func"); if (plugin_func == NULL) { fprintf(stderr, "unable to find plugin_func: %s\n", dlerror()); return (1); } (*plugin_func)(); return (0); } % cat plugin.c #include <stdio.h> extern void parent_callback(void); void plugin_func(void) { printf("parent has called plugin_func() from plugin.so\n"); parent_callback(); } Building this in the traditional manner, without -zdefs: % cc -o main main.c % cc -G -o plugin.so plugin.c % ./main ./plugin.so parent has called plugin_func() from plugin.so plugin_func() has called parent_callback() As noted above, when building any shared object, the -z defs option is recommended, in order to ensure that the object is self contained and specifies all of its dependencies. However, the use of -z defs prevents the plugin object from linking due to the unsatisfied symbol from the parent object: % cc -zdefs -G -o plugin.so plugin.c Undefined first referenced symbol in file parent_callback plugin.o ld: fatal: symbol referencing errors. No output written to plugin.so A mapfile can be used to specify to ld that the parent_callback symbol is supplied by the parent object. % cat plugin.mapfile $mapfile_version 2 SYMBOL_SCOPE { global: parent_callback { FLAGS = PARENT }; }; % cc -zdefs -Mplugin.mapfile -G -o plugin.so plugin.c However, the -z parent option to ld is the most direct solution to this problem, allowing the plugin to actually link against the parent object, and obtain the available symbols from it. An added benefit of using -z parent instead of a mapfile, is that the name of the parent object is recorded in the dynamic section of the plugin, and can be displayed by the file utility: % cc -zdefs -zparent=main -G -o plugin.so plugin.c % elfdump -d plugin.so | grep PARENT [0] SUNW_PARENT 0xcc main % file plugin.so plugin.so: ELF 32-bit LSB dynamic lib 80386 Version 1, parent main, dynamically linked, not stripped % ./main ./plugin.so parent has called plugin_func() from plugin.so plugin_func() has called parent_callback() We can also observe this in elfedit plugins on Solaris systems running Solaris 11 Update 1 or newer: % file /usr/lib/elfedit/dyn.so /usr/lib/elfedit/dyn.so: ELF 32-bit LSB dynamic lib 80386 Version 1, parent elfedit, dynamically linked, not stripped, no debugging information available Related Other Work The GNU ld has an option named --just-symbols that can be used in a similar manner: --just-symbols=filename Read symbol names and their addresses from filename, but do not relocate it or include it in the output. This allows your output file to refer symbolically to absolute locations of memory defined in other programs. You may use this option more than once. -z parent is a higher level operation aimed specifically at simplifying the construction of high quality plugins. Although it employs the same operation, it differs from --just symbols in 2 significant ways: There can only be one parent. The parent is recorded in the created object, and can be displayed by 'file', or other similar tools.

    Read the article

  • Integration Patterns with Azure Service Bus Relay, Part 1: Exposing the on-premise service

    - by Elton Stoneman
    We're in the process of delivering an enabling project to expose on-premise WCF services securely to Internet consumers. The Azure Service Bus Relay is doing the clever stuff, we register our on-premise service with Azure, consumers call into our .servicebus.windows.net namespace, and their requests are relayed and serviced on-premise. In theory it's all wonderfully simple; by using the relay we get lots of protocol options, free HTTPS and load balancing, and by integrating to ACS we get plenty of security options. Part of our delivery is a suite of sample consumers for the service - .NET, jQuery, PHP - and this set of posts will cover setting up the service and the consumers. Part 1: Exposing the on-premise service In theory, this is ultra-straightforward. In practice, and on a dev laptop it is - but in a corporate network with firewalls and proxies, it isn't, so we'll walkthrough some of the pitfalls. Note that I'm using the "old" Azure portal which will soon be out of date, but the new shiny portal should have the same steps available and be easier to use. We start with a simple WCF service which takes a string as input, reverses the string and returns it. The Part 1 version of the code is on GitHub here: on GitHub here: IPASBR Part 1. Configuring Azure Service Bus Start by logging into the Azure portal and registering a Service Bus namespace which will be our endpoint in the cloud. Give it a globally unique name, set it up somewhere near you (if you’re in Europe, remember Europe (North) is Ireland, and Europe (West) is the Netherlands), and  enable ACS integration by ticking "Access Control" as a service: Authenticating and authorizing to ACS When we try to register our on-premise service as a listener for the Service Bus endpoint, we need to supply credentials, which means only trusted service providers can act as listeners. We can use the default "owner" credentials, but that has admin permissions so a dedicated service account is better (Neil Mackenzie has a good post On Not Using owner with the Azure AppFabric Service Bus with lots of permission details). Click on "Access Control Service" for the namespace, navigate to Service Identities and add a new one. Give the new account a sensible name and description: Let ACS generate a symmetric key for you (this will be the shared secret we use in the on-premise service to authenticate as a listener), but be sure to set the expiration date to something usable. The portal defaults to expiring new identities after 1 year - but when your year is up *your identity will expire without warning* and everything will stop working. In production, you'll need governance to manage identity expiration and a process to make sure you renew identities and roll new keys regularly. The new service identity needs to be authorized to listen on the service bus endpoint. This is done through claim mapping in ACS - we'll set up a rule that says if the nameidentifier in the input claims has the value serviceProvider, in the output we'll have an action claim with the value Listen. In the ACS portal you'll see that there is already a Relying Party Application set up for ServiceBus, which has a Default rule group. Edit the rule group and click Add to add this new rule: The values to use are: Issuer: Access Control Service Input claim type: http://schemas.xmlsoap.org/ws/2005/05/identity/claims/nameidentifier Input claim value: serviceProvider Output claim type: net.windows.servicebus.action Output claim value: Listen When your service namespace and identity are set up, open the Part 1 solution and put your own namespace, service identity name and secret key into the file AzureConnectionDetails.xml in Solution Items, e.g: <azure namespace="sixeyed-ipasbr">    <!-- ACS credentials for the listening service (Part1):-->   <service identityName="serviceProvider"            symmetricKey="nuR2tHhlrTCqf4YwjT2RA2BZ/+xa23euaRJNLh1a/V4="/>  </azure> Build the solution, and the T4 template will generate the Web.config for the service project with your Azure details in the transportClientEndpointBehavior:           <behavior name="SharedSecret">             <transportClientEndpointBehavior credentialType="SharedSecret">               <clientCredentials>                 <sharedSecret issuerName="serviceProvider"                               issuerSecret="nuR2tHhlrTCqf4YwjT2RA2BZ/+xa23euaRJNLh1a/V4="/>               </clientCredentials>             </transportClientEndpointBehavior>           </behavior> , and your service namespace in the Azure endpoint:         <!-- Azure Service Bus endpoints -->          <endpoint address="sb://sixeyed-ipasbr.servicebus.windows.net/net"                   binding="netTcpRelayBinding"                   contract="Sixeyed.Ipasbr.Services.IFormatService"                   behaviorConfiguration="SharedSecret">         </endpoint> The sample project is hosted in IIS, but it won't register with Azure until the service is activated. Typically you'd install AppFabric 1.1 for Widnows Server and set the service to auto-start in IIS, but for dev just navigate to the local REST URL, which will activate the service and register it with Azure. Testing the service locally As well as an Azure endpoint, the service has a WebHttpBinding for local REST access:         <!-- local REST endpoint for internal use -->         <endpoint address="rest"                   binding="webHttpBinding"                   behaviorConfiguration="RESTBehavior"                   contract="Sixeyed.Ipasbr.Services.IFormatService" /> Build the service, then navigate to: http://localhost/Sixeyed.Ipasbr.Services/FormatService.svc/rest/reverse?string=abc123 - and you should see the reversed string response: If your network allows it, you'll get the expected response as before, but in the background your service will also be listening in the cloud. Good stuff! Who needs network security? Onto the next post for consuming the service with the netTcpRelayBinding.  Setting up network access to Azure But, if you get an error, it's because your network is secured and it's doing something to stop the relay working. The Service Bus relay bindings try to use direct TCP connections to Azure, so if ports 9350-9354 are available *outbound*, then the relay will run through them. If not, the binding steps down to standard HTTP, and issues a CONNECT across port 443 or 80 to set up a tunnel for the relay. If your network security guys are doing their job, the first option will be blocked by the firewall, and the second option will be blocked by the proxy, so you'll get this error: System.ServiceModel.CommunicationException: Unable to reach sixeyed-ipasbr.servicebus.windows.net via TCP (9351, 9352) or HTTP (80, 443) - and that will probably be the start of lots of discussions. Network guys don't really like giving servers special permissions for the web proxy, and they really don't like opening ports, so they'll need to be convinced about this. The resolution in our case was to put up a dedicated box in a DMZ, tinker with the firewall and the proxy until we got a relay connection working, then run some traffic which the the network guys monitored to do a security assessment afterwards. Along the way we hit a few more issues, diagnosed mainly with Fiddler and Wireshark: System.Net.ProtocolViolationException: Chunked encoding upload is not supported on the HTTP/1.0 protocol - this means the TCP ports are not available, so Azure tries to relay messaging traffic across HTTP. The service can access the endpoint, but the proxy is downgrading traffic to HTTP 1.0, which does not support tunneling, so Azure can’t make its connection. We were using the Squid proxy, version 2.6. The Squid project is incrementally adding HTTP 1.1 support, but there's no definitive list of what's supported in what version (here are some hints). System.ServiceModel.Security.SecurityNegotiationException: The X.509 certificate CN=servicebus.windows.net chain building failed. The certificate that was used has a trust chain that cannot be verified. Replace the certificate or change the certificateValidationMode. The evocation function was unable to check revocation because the revocation server was offline. - by this point we'd given up on the HTTP proxy and opened the TCP ports. We got this error when the relay binding does it's authentication hop to ACS. The messaging traffic is TCP, but the control traffic still goes over HTTP, and as part of the ACS authentication the process checks with a revocation server to see if Microsoft’s ACS cert is still valid, so the proxy still needs some clearance. The service account (the IIS app pool identity) needs access to: www.public-trust.com mscrl.microsoft.com We still got this error periodically with different accounts running the app pool. We fixed that by ensuring the machine-wide proxy settings are set up, so every account uses the correct proxy: netsh winhttp set proxy proxy-server="http://proxy.x.y.z" - and you might need to run this to clear out your credential cache: certutil -urlcache * delete If your network guys end up grudgingly opening ports, they can restrict connections to the IP address range for your chosen Azure datacentre, which might make them happier - see Windows Azure Datacenter IP Ranges. After all that you've hopefully got an on-premise service listening in the cloud, which you can consume from pretty much any technology.

    Read the article

  • Memory Leaks - Objective-C

    - by reising1
    Can anyone help point out memory leaks? I'm getting a bunch within this method and I'm not sure exactly how to fix it. - (NSMutableArray *)getTop5AndOtherKeysAndValuesFromDictionary:(NSMutableDictionary *)dict { NSLog(@"get top 5"); int sumOfAllValues = 0; NSMutableArray *arr = [[[NSMutableArray alloc] init] retain]; for(NSString *key in dict){ NSString *value = [[dict objectForKey:key] retain]; [arr addObject:value]; sumOfAllValues += [value intValue]; } //sort values NSArray *sorted = [[arr sortedArrayUsingFunction:sort context:NULL] retain]; [arr release]; //top 5 values int sumOfTop5 = 0; NSMutableArray *top5 = [[[NSMutableArray alloc] init] retain]; for(int i = 0; i < 5; i++) { int proposedIndex = [sorted count] - 1 - i; if(proposedIndex >= 0) { [top5 addObject:[sorted objectAtIndex:([sorted count] - i - 1)]]; sumOfTop5 += [[sorted objectAtIndex:([sorted count] - i - 1)] intValue]; } } [sorted release]; //copy of all keys NSMutableArray *copyOfKeys = [[[NSMutableArray alloc] init] retain]; for(NSString *key in dict) { [copyOfKeys addObject:key]; } //copy of top 5 values NSMutableArray *copyOfTop5 = [[[NSMutableArray alloc] init] retain]; for(int i = 0; i < [top5 count]; i++) { [copyOfTop5 addObject:[top5 objectAtIndex:i]]; } //get keys with top 5 values NSMutableArray *outputKeys = [[[NSMutableArray alloc] init] retain]; for(int i = 0; i < [top5 count]; i++) { NSString *targetValue = [top5 objectAtIndex:i]; for(int j = 0; j < [copyOfKeys count]; j++) { NSString *key = [copyOfKeys objectAtIndex:j]; NSString *val = [dict objectForKey:key]; if([val isEqualToString:targetValue]) { [outputKeys addObject:key]; [copyOfKeys removeObjectAtIndex:j]; break; } } } [outputKeys addObject:@"Other"]; [top5 addObject:[[NSString stringWithFormat:@"%d",(sumOfAllValues - sumOfTop5)] retain]]; NSMutableArray *output = [[NSMutableArray alloc] init]; [output addObject:outputKeys]; [output addObject:top5]; NSMutableArray *percents = [[NSMutableArray alloc] init]; int sum = sumOfAllValues; float leftOverSum = sum * 1.0f; int count = [top5 count]; float val1, val2, val3, val4, val5; if(count >= 1) val1 = ([[top5 objectAtIndex:0] intValue] * 1.0f)/sum; else val1 = 0.0f; if(count >=2) val2 = ([[top5 objectAtIndex:1] intValue] * 1.0f)/sum; else val2 = 0.0f; if(count >= 3) val3 = ([[top5 objectAtIndex:2] intValue] * 1.0f)/sum; else val3 = 0.0f; if(count >= 4) val4 = ([[top5 objectAtIndex:3] intValue] * 1.0f)/sum; else val4 = 0.0f; if(count >=5) val5 = ([[top5 objectAtIndex:4] intValue] * 1.0f)/sum; else val5 = 0.0f; if(val1 >= .00001f) { NSMutableArray *a1 = [[NSMutableArray alloc] init]; [a1 addObject:[outputKeys objectAtIndex:0]]; [a1 addObject:[top5 objectAtIndex:0]]; [a1 addObject:[NSString stringWithFormat:@"%.01f",(val1*100)]]; [percents addObject:a1]; leftOverSum -= ([[top5 objectAtIndex:0] intValue] * 1.0f); } if(val2 >= .00001f) { NSMutableArray *a2 = [[NSMutableArray alloc] init]; [a2 addObject:[outputKeys objectAtIndex:1]]; [a2 addObject:[top5 objectAtIndex:1]]; [a2 addObject:[NSString stringWithFormat:@"%.01f",(val2*100)]]; [percents addObject:a2]; leftOverSum -= ([[top5 objectAtIndex:1] intValue] * 1.0f); } if(val3 >= .00001f) { NSMutableArray *a3 = [[NSMutableArray alloc] init]; [a3 addObject:[outputKeys objectAtIndex:2]]; [a3 addObject:[top5 objectAtIndex:2]]; [a3 addObject:[NSString stringWithFormat:@"%.01f",(val3*100)]]; [percents addObject:a3]; leftOverSum -= ([[top5 objectAtIndex:2] intValue] * 1.0f); } if(val4 >= .00001f) { NSMutableArray *a4 = [[NSMutableArray alloc] init]; [a4 addObject:[outputKeys objectAtIndex:3]]; [a4 addObject:[top5 objectAtIndex:3]]; [a4 addObject:[NSString stringWithFormat:@"%.01f",(val4*100)]]; [percents addObject:a4]; leftOverSum -= ([[top5 objectAtIndex:3] intValue] * 1.0f); } if(val5 >= .00001f) { NSMutableArray *a5 = [[NSMutableArray alloc] init]; [a5 addObject:[outputKeys objectAtIndex:4]]; [a5 addObject:[top5 objectAtIndex:4]]; [a5 addObject:[NSString stringWithFormat:@"%.01f",(val5*100)]]; [percents addObject:a5]; leftOverSum -= ([[top5 objectAtIndex:4] intValue] * 1.0f); } float valOther = (leftOverSum/sum); if(valOther >= .00001f) { NSMutableArray *a6 = [[NSMutableArray alloc] init]; [a6 addObject:[outputKeys objectAtIndex:5]]; [a6 addObject:[top5 objectAtIndex:5]]; [a6 addObject:[NSString stringWithFormat:@"%.01f",(valOther*100)]]; [percents addObject:a6]; } [output addObject:percents]; NSLog(@"mu - a"); //[arr release]; NSLog(@"mu - b"); //[copyOfKeys release]; NSLog(@"mu - c"); //[copyOfTop5 release]; NSLog(@"mu - c"); //[outputKeys release]; //[top5 release]; //[percents release]; return output; }

    Read the article

  • jQuery Toggle with Cookie

    - by Cameron
    I have the following toggle system, but I want it to remember what was open/closed using the jQuery cookie plugin. So for example if I open a toggle and then navigate away from the page, when I come back it should be still open. This is code I have so far, but it's becoming rather confusing, some help would be much appreciated thanks. jQuery.cookie = function (name, value, options) { if (typeof value != 'undefined') { options = options || {}; if (value === null) { value = ''; options = $.extend({}, options); options.expires = -1; } var expires = ''; if (options.expires && (typeof options.expires == 'number' || options.expires.toUTCString)) { var date; if (typeof options.expires == 'number') { date = new Date(); date.setTime(date.getTime() + (options.expires * 24 * 60 * 60 * 1000)); } else { date = options.expires; } expires = '; expires=' + date.toUTCString(); } var path = options.path ? '; path=' + (options.path) : ''; var domain = options.domain ? '; domain=' + (options.domain) : ''; var secure = options.secure ? '; secure' : ''; document.cookie = [name, '=', encodeURIComponent(value), expires, path, domain, secure].join(''); } else { var cookieValue = null; if (document.cookie && document.cookie != '') { var cookies = document.cookie.split(';'); for (var i = 0; i < cookies.length; i++) { var cookie = jQuery.trim(cookies[i]); if (cookie.substring(0, name.length + 1) == (name + '=')) { cookieValue = decodeURIComponent(cookie.substring(name.length + 1)); break; } } } return cookieValue; } }; // var showTop = $.cookie('showTop'); if ($.cookie('showTop') == 'collapsed') { $(".toggle_container").hide(); $(".trigger").toggle(function () { $(this).addClass("active"); }, function () { $(this).removeClass("active"); }); $(".trigger").click(function () { $(this).next(".toggle_container").slideToggle("slow,"); }); } else { $(".toggle_container").show(); $(".trigger").toggle(function () { $(this).addClass("active"); }, function () { $(this).removeClass("active"); }); $(".trigger").click(function () { $(this).next(".toggle_container").slideToggle("slow,"); }); }; $(".trigger").click(function () { if ($(".toggle_container").is(":hidden")) { $(this).next(".toggle_container").slideToggle("slow,"); $.cookie('showTop', 'expanded'); } else { $(this).next(".toggle_container").slideToggle("slow,"); $.cookie('showTop', 'collapsed'); } return false; }); and this is a snippet of the HTML it works with: <li> <label for="small"><input type="checkbox" id="small" /> Small</label> <a class="trigger" href="#">Toggle</a> <div class="toggle_container"> <p class="funding"><strong>Funding</strong></p> <ul class="childs"> <li class="child"> <label for="fully-funded1"><input type="checkbox" id="fully-funded1" /> Fully Funded</label> <a class="trigger" href="#">Toggle</a> <div class="toggle_container"> <p class="days"><strong>Days</strong></p> <ul class="days clearfix"> <li><label for="1pre16">Pre 16</label> <input type="text" id="1pre16" /></li> <li><label for="2post16">Post 16</label> <input type="text" id="2post16" /></li> <li><label for="3teacher">Teacher</label> <input type="text" id="3teacher" /></li> </ul> </div> </li>

    Read the article

  • No GLX on Intel card with multiseat with additional nVidia card

    - by MeanEYE
    I have multiseat configured and my Xorg has 2 server layouts. One is for nVidia card and other is for Intel card. They both work, but display server assigned to Intel card doesn't have hardware acceleration since DRI and GLX module being used is from nVidia driver. So my question is, can I configure layouts somehow to use right DRI and GLX with each card? My Xorg.conf: Section "ServerLayout" Identifier "Default" Screen 0 "Screen0" 0 0 Option "Xinerama" "0" EndSection Section "ServerLayout" Identifier "TV" Screen 0 "Screen1" 0 0 Option "Xinerama" "0" EndSection Section "Monitor" # HorizSync source: edid, VertRefresh source: edid Identifier "Monitor0" VendorName "Unknown" ModelName "DELL E198WFP" HorizSync 30.0 - 83.0 VertRefresh 56.0 - 75.0 Option "DPMS" EndSection Section "Monitor" Identifier "Monitor1" VendorName "Unknown" Option "DPMS" EndSection Section "Device" Identifier "Device0" Driver "nvidia" VendorName "NVIDIA Corporation" BoardName "GeForce GT 610" EndSection Section "Device" Identifier "Device1" Driver "intel" BusID "PCI:0:2:0" Option "AccelMethod" "uxa" EndSection Section "Screen" Identifier "Screen0" Device "Device0" Monitor "Monitor0" DefaultDepth 24 Option "Stereo" "0" Option "nvidiaXineramaInfoOrder" "DFP-1" Option "metamodes" "DFP-0: nvidia-auto-select +1440+0, DFP-1: nvidia-auto-select +0+0" SubSection "Display" Depth 24 EndSubSection EndSection Section "Screen" Identifier "Screen1" Device "Device1" Monitor "Monitor1" DefaultDepth 24 SubSection "Display" Depth 24 EndSubSection EndSection Log file for Intel: [ 18.239] X.Org X Server 1.13.0 Release Date: 2012-09-05 [ 18.239] X Protocol Version 11, Revision 0 [ 18.239] Build Operating System: Linux 2.6.24-32-xen x86_64 Ubuntu [ 18.239] Current Operating System: Linux bytewiper 3.5.0-18-generic #29-Ubuntu SMP Fri Oct 19 10:26:51 UTC 2012 x86_64 [ 18.239] Kernel command line: BOOT_IMAGE=/boot/vmlinuz-3.5.0-18-generic root=UUID=fc0616fd-f212-4846-9241-ba4a492f0513 ro quiet splash [ 18.239] Build Date: 20 September 2012 11:55:20AM [ 18.239] xorg-server 2:1.13.0+git20120920.70e57668-0ubuntu0ricotz (For technical support please see http://www.ubuntu.com/support) [ 18.239] Current version of pixman: 0.26.0 [ 18.239] Before reporting problems, check http://wiki.x.org to make sure that you have the latest version. [ 18.239] Markers: (--) probed, (**) from config file, (==) default setting, (++) from command line, (!!) notice, (II) informational, (WW) warning, (EE) error, (NI) not implemented, (??) unknown. [ 18.239] (==) Log file: "/var/log/Xorg.1.log", Time: Wed Nov 21 18:32:14 2012 [ 18.239] (==) Using config file: "/etc/X11/xorg.conf" [ 18.239] (==) Using system config directory "/usr/share/X11/xorg.conf.d" [ 18.239] (++) ServerLayout "TV" [ 18.239] (**) |-->Screen "Screen1" (0) [ 18.239] (**) | |-->Monitor "Monitor1" [ 18.240] (**) | |-->Device "Device1" [ 18.240] (**) Option "Xinerama" "0" [ 18.240] (==) Automatically adding devices [ 18.240] (==) Automatically enabling devices [ 18.240] (==) Automatically adding GPU devices [ 18.240] (WW) The directory "/usr/share/fonts/X11/cyrillic" does not exist. [ 18.240] Entry deleted from font path. [ 18.240] (WW) The directory "/usr/share/fonts/X11/100dpi/" does not exist. [ 18.240] Entry deleted from font path. [ 18.240] (WW) The directory "/usr/share/fonts/X11/75dpi/" does not exist. [ 18.240] Entry deleted from font path. [ 18.240] (WW) The directory "/usr/share/fonts/X11/100dpi" does not exist. [ 18.240] Entry deleted from font path. [ 18.240] (WW) The directory "/usr/share/fonts/X11/75dpi" does not exist. [ 18.240] Entry deleted from font path. [ 18.240] (WW) The directory "/var/lib/defoma/x-ttcidfont-conf.d/dirs/TrueType" does not exist. [ 18.240] Entry deleted from font path. [ 18.240] (==) FontPath set to: /usr/share/fonts/X11/misc, /usr/share/fonts/X11/Type1, built-ins [ 18.240] (==) ModulePath set to "/usr/lib/x86_64-linux-gnu/xorg/extra-modules,/usr/lib/xorg/extra-modules,/usr/lib/xorg/modules" [ 18.240] (II) The server relies on udev to provide the list of input devices. If no devices become available, reconfigure udev or disable AutoAddDevices. [ 18.240] (II) Loader magic: 0x7f6917944c40 [ 18.240] (II) Module ABI versions: [ 18.240] X.Org ANSI C Emulation: 0.4 [ 18.240] X.Org Video Driver: 13.0 [ 18.240] X.Org XInput driver : 18.0 [ 18.240] X.Org Server Extension : 7.0 [ 18.240] (II) config/udev: Adding drm device (/dev/dri/card0) [ 18.241] (--) PCI: (0:0:2:0) 8086:0152:1043:84ca rev 9, Mem @ 0xf7400000/4194304, 0xd0000000/268435456, I/O @ 0x0000f000/64 [ 18.241] (--) PCI:*(0:1:0:0) 10de:104a:1458:3546 rev 161, Mem @ 0xf6000000/16777216, 0xe0000000/134217728, 0xe8000000/33554432, I/O @ 0x0000e000/128, BIOS @ 0x????????/524288 [ 18.241] (II) Open ACPI successful (/var/run/acpid.socket) [ 18.241] Initializing built-in extension Generic Event Extension [ 18.241] Initializing built-in extension SHAPE [ 18.241] Initializing built-in extension MIT-SHM [ 18.241] Initializing built-in extension XInputExtension [ 18.241] Initializing built-in extension XTEST [ 18.241] Initializing built-in extension BIG-REQUESTS [ 18.241] Initializing built-in extension SYNC [ 18.241] Initializing built-in extension XKEYBOARD [ 18.241] Initializing built-in extension XC-MISC [ 18.241] Initializing built-in extension SECURITY [ 18.241] Initializing built-in extension XINERAMA [ 18.241] Initializing built-in extension XFIXES [ 18.241] Initializing built-in extension RENDER [ 18.241] Initializing built-in extension RANDR [ 18.241] Initializing built-in extension COMPOSITE [ 18.241] Initializing built-in extension DAMAGE [ 18.241] Initializing built-in extension MIT-SCREEN-SAVER [ 18.241] Initializing built-in extension DOUBLE-BUFFER [ 18.241] Initializing built-in extension RECORD [ 18.241] Initializing built-in extension DPMS [ 18.241] Initializing built-in extension X-Resource [ 18.241] Initializing built-in extension XVideo [ 18.241] Initializing built-in extension XVideo-MotionCompensation [ 18.241] Initializing built-in extension XFree86-VidModeExtension [ 18.241] Initializing built-in extension XFree86-DGA [ 18.241] Initializing built-in extension XFree86-DRI [ 18.241] Initializing built-in extension DRI2 [ 18.241] (II) LoadModule: "glx" [ 18.241] (II) Loading /usr/lib/x86_64-linux-gnu/xorg/extra-modules/libglx.so [ 18.247] (II) Module glx: vendor="NVIDIA Corporation" [ 18.247] compiled for 4.0.2, module version = 1.0.0 [ 18.247] Module class: X.Org Server Extension [ 18.247] (II) NVIDIA GLX Module 310.19 Thu Nov 8 01:12:43 PST 2012 [ 18.247] Loading extension GLX [ 18.247] (II) LoadModule: "intel" [ 18.248] (II) Loading /usr/lib/xorg/modules/drivers/intel_drv.so [ 18.248] (II) Module intel: vendor="X.Org Foundation" [ 18.248] compiled for 1.13.0, module version = 2.20.13 [ 18.248] Module class: X.Org Video Driver [ 18.248] ABI class: X.Org Video Driver, version 13.0 [ 18.248] (II) intel: Driver for Intel Integrated Graphics Chipsets: i810, i810-dc100, i810e, i815, i830M, 845G, 854, 852GM/855GM, 865G, 915G, E7221 (i915), 915GM, 945G, 945GM, 945GME, Pineview GM, Pineview G, 965G, G35, 965Q, 946GZ, 965GM, 965GME/GLE, G33, Q35, Q33, GM45, 4 Series, G45/G43, Q45/Q43, G41, B43, B43, Clarkdale, Arrandale, Sandybridge Desktop (GT1), Sandybridge Desktop (GT2), Sandybridge Desktop (GT2+), Sandybridge Mobile (GT1), Sandybridge Mobile (GT2), Sandybridge Mobile (GT2+), Sandybridge Server, Ivybridge Mobile (GT1), Ivybridge Mobile (GT2), Ivybridge Desktop (GT1), Ivybridge Desktop (GT2), Ivybridge Server, Ivybridge Server (GT2), Haswell Desktop (GT1), Haswell Desktop (GT2), Haswell Desktop (GT2+), Haswell Mobile (GT1), Haswell Mobile (GT2), Haswell Mobile (GT2+), Haswell Server (GT1), Haswell Server (GT2), Haswell Server (GT2+), Haswell SDV Desktop (GT1), Haswell SDV Desktop (GT2), Haswell SDV Desktop (GT2+), Haswell SDV Mobile (GT1), Haswell SDV Mobile (GT2), Haswell SDV Mobile (GT2+), Haswell SDV Server (GT1), Haswell SDV Server (GT2), Haswell SDV Server (GT2+), Haswell ULT Desktop (GT1), Haswell ULT Desktop (GT2), Haswell ULT Desktop (GT2+), Haswell ULT Mobile (GT1), Haswell ULT Mobile (GT2), Haswell ULT Mobile (GT2+), Haswell ULT Server (GT1), Haswell ULT Server (GT2), Haswell ULT Server (GT2+), Haswell CRW Desktop (GT1), Haswell CRW Desktop (GT2), Haswell CRW Desktop (GT2+), Haswell CRW Mobile (GT1), Haswell CRW Mobile (GT2), Haswell CRW Mobile (GT2+), Haswell CRW Server (GT1), Haswell CRW Server (GT2), Haswell CRW Server (GT2+), ValleyView PO board [ 18.248] (++) using VT number 8 [ 18.593] (II) intel(0): using device path '/dev/dri/card0' [ 18.593] (**) intel(0): Depth 24, (--) framebuffer bpp 32 [ 18.593] (==) intel(0): RGB weight 888 [ 18.593] (==) intel(0): Default visual is TrueColor [ 18.593] (**) intel(0): Option "AccelMethod" "uxa" [ 18.593] (--) intel(0): Integrated Graphics Chipset: Intel(R) Ivybridge Desktop (GT1) [ 18.593] (**) intel(0): Relaxed fencing enabled [ 18.593] (**) intel(0): Wait on SwapBuffers? enabled [ 18.593] (**) intel(0): Triple buffering? enabled [ 18.593] (**) intel(0): Framebuffer tiled [ 18.593] (**) intel(0): Pixmaps tiled [ 18.593] (**) intel(0): 3D buffers tiled [ 18.593] (**) intel(0): SwapBuffers wait enabled ... [ 20.312] (II) Module fb: vendor="X.Org Foundation" [ 20.312] compiled for 1.13.0, module version = 1.0.0 [ 20.312] ABI class: X.Org ANSI C Emulation, version 0.4 [ 20.312] (II) Loading sub module "dri2" [ 20.312] (II) LoadModule: "dri2" [ 20.312] (II) Module "dri2" already built-in [ 20.312] (==) Depth 24 pixmap format is 32 bpp [ 20.312] (II) intel(0): [DRI2] Setup complete [ 20.312] (II) intel(0): [DRI2] DRI driver: i965 [ 20.312] (II) intel(0): Allocated new frame buffer 1920x1080 stride 7680, tiled [ 20.312] (II) UXA(0): Driver registered support for the following operations: [ 20.312] (II) solid [ 20.312] (II) copy [ 20.312] (II) composite (RENDER acceleration) [ 20.312] (II) put_image [ 20.312] (II) get_image [ 20.312] (==) intel(0): Backing store disabled [ 20.312] (==) intel(0): Silken mouse enabled [ 20.312] (II) intel(0): Initializing HW Cursor [ 20.312] (II) intel(0): RandR 1.2 enabled, ignore the following RandR disabled message. [ 20.313] (**) intel(0): DPMS enabled [ 20.313] (==) intel(0): Intel XvMC decoder enabled [ 20.313] (II) intel(0): Set up textured video [ 20.313] (II) intel(0): [XvMC] xvmc_vld driver initialized. [ 20.313] (II) intel(0): direct rendering: DRI2 Enabled [ 20.313] (==) intel(0): hotplug detection: "enabled" [ 20.332] (--) RandR disabled [ 20.335] (EE) Failed to initialize GLX extension (Compatible NVIDIA X driver not found) [ 20.335] (II) intel(0): Setting screen physical size to 508 x 285 [ 20.338] (II) XKB: reuse xkmfile /var/lib/xkb/server-B20D7FC79C7F597315E3E501AEF10E0D866E8E92.xkm [ 20.340] (II) config/udev: Adding input device Power Button (/dev/input/event1) [ 20.340] (**) Power Button: Applying InputClass "evdev keyboard catchall" [ 20.340] (II) LoadModule: "evdev" [ 20.340] (II) Loading /usr/lib/xorg/modules/input/evdev_drv.so

    Read the article

  • NSStream sockets missing data

    - by Chris T.
    I am trying to pull some sample data from FreeDB as a proof of concept, but I am having a tough time retrieving all of the data off the incoming stream (I am only getting the last bits for the final query listed here (if handshakeCode = 3) I think this may be something with the threading on the main runloop, but I am not sure. Odd thing is when the buffer size is larger than 1-2 bytes (which works as expected), I seem to be losing access to the data programmatically (the totalOutput variable on the first set of data is incomplete). I set up a packet capture, and it looks like those 1024 bytes are coming across the wire, but the app just isn't working with it. It looks like the next event is coming through and basically taking over. I tried using an NSLock to no avail as well. If I drop the buffer size down to 1 or 2, things seem to be reading just fine. This is probably obvious to someone who does this all the time, but this is my first foray into this with something I am familiar with, technology wise in other languages / platforms. The following code will show you what is happening. Run with the buffer set to 1024, and you will see a short final string, but once you set it to 1, you will see the amount of data I was expecting (I was even expecting it to be split, so that's not a big worry) #import <Foundation/Foundation.h> #import <Cocoa/Cocoa.h> //STACK OVERFLOW CODE: @interface stackoverflow : NSObject <NSStreamDelegate> { NSInputStream *iStream; NSOutputStream *oStream; int handshakeCode; NSString *selectedDiscId; NSString *selectedGenre; } -(void)getMatchesFromFreeDB; -(void)sendToOutputStream:(NSString*)command; @end @implementation stackoverflow -(void)getMatchesFromFreeDB { NSHost *host = [NSHost hostWithName:@"freedb.freedb.org"]; [NSStream getStreamsToHost:host port:8880 inputStream:&iStream outputStream:&oStream]; [iStream retain]; [oStream retain]; [iStream setDelegate:self]; [oStream setDelegate:self]; [iStream scheduleInRunLoop:[NSRunLoop currentRunLoop] forMode:NSDefaultRunLoopMode]; [oStream scheduleInRunLoop:[NSRunLoop currentRunLoop] forMode:NSDefaultRunLoopMode]; [iStream open]; [oStream open]; handshakeCode = 0; //not done any processing } -(void)stream:(NSStream *)aStream handleEvent:(NSStreamEvent)eventCode { switch(eventCode) { case NSStreamEventOpenCompleted: { NSLog(@"Stream open completed"); break; } case NSStreamEventHasBytesAvailable: { NSLog(@"Stream has bytes available"); if (aStream == iStream) { NSMutableString *totalOutput = [NSMutableString stringWithString:@""]; //read data uint8_t buffer[1024]; int len; while ([iStream hasBytesAvailable]) { len = [iStream read:buffer maxLength:sizeof(buffer)]; if (len 0) { NSString *output = [[NSString alloc] initWithBytes:buffer length:len encoding:NSUTF8StringEncoding]; //this could have also been put into an NSData object if (nil != output) { //append to the total output [totalOutput appendString:output]; } } } NSLog(@"OUTPUT , %i:\n\n%@", [totalOutput lengthOfBytesUsingEncoding:NSUTF8StringEncoding], totalOutput); NSArray *outputComponents = [totalOutput componentsSeparatedByString:@" "]; //Attempt to get handshake code, since we haven't done it yet: if (handshakeCode == 1) { //we are just getting the sign-on banner: //let's move on: handshakeCode = 2; } else if (handshakeCode == 2) { handshakeCode = [[outputComponents objectAtIndex:0] intValue]; if (handshakeCode == 200) { NSLog(@"---Handshake OK %i", handshakeCode); NSMutableString *query = [NSMutableString stringWithString:@"cddb query f3114b11 17 225 19915 36489 54850 69425 87025 103948 123242 136075 152817 178335 192850 211677 235104 262090 284882 308658 4430\n"]; handshakeCode = 3; [self sendToOutputStream:query]; } } else if (handshakeCode == 3) { //now, we are reading out the matches: if ([[outputComponents objectAtIndex:0] intValue] == 200) //found exact match: { NSLog(@"Found exact match"); selectedGenre = [outputComponents objectAtIndex:1] ; selectedDiscId = [outputComponents objectAtIndex:2]; if (selectedGenre && selectedDiscId) { //send off the request to get the entry: NSString *query = [NSString stringWithFormat:@"cddb read %@ %@\n", selectedGenre, selectedDiscId]; [self sendToOutputStream:query]; handshakeCode = 4; } } } } break; } case NSStreamEventEndEncountered: { NSLog(@"Stream event end encountered"); break; } case NSStreamEventErrorOccurred: { NSLog(@"Stream error occurred"); break; } case NSStreamEventHasSpaceAvailable: { NSLog(@"Stream has space available"); if (aStream == oStream) { if (handshakeCode == 0) { handshakeCode = 1; [self sendToOutputStream:@"cddb hello stackoverflow localhost.localdomain test .01BETA\n"]; } } break; } } } -(void)sendToOutputStream:(NSString*)command { const uint8_t *rawCommand = (const uint8_t *)[command UTF8String]; [oStream write:rawCommand maxLength:strlen(rawCommand)]; NSLog(@"Sent command: %@",command); } @end int main (int argc, const char * argv[]) { NSAutoreleasePool * pool = [[NSAutoreleasePool alloc] init]; stackoverflow *test = [[stackoverflow alloc] init]; [test getMatchesFromFreeDB]; NSRunLoop *runLoop = [NSRunLoop currentRunLoop]; [runLoop run]; [pool drain]; return 0; } Any help is much appreciated! Thanks

    Read the article

  • How to store generated eigen faces for future face recognition?

    - by user3237134
    My code works in the following manner: 1.First, it obtains several images from the training set 2.After loading these images, we find the normalized faces,mean face and perform several calculation. 3.Next, we ask for the name of an image we want to recognize 4.We then project the input image into the eigenspace, and based on the difference from the eigenfaces we make a decision. 5.Depending on eigen weight vector for each input image we make clusters using kmeans command. Source code i tried: clear all close all clc % number of images on your training set. M=1200; %Chosen std and mean. %It can be any number that it is close to the std and mean of most of the images. um=60; ustd=32; %read and show images(bmp); S=[]; %img matrix for i=1:M str=strcat(int2str(i),'.jpg'); %concatenates two strings that form the name of the image eval('img=imread(str);'); [irow icol d]=size(img); % get the number of rows (N1) and columns (N2) temp=reshape(permute(img,[2,1,3]),[irow*icol,d]); %creates a (N1*N2)x1 matrix S=[S temp]; %X is a N1*N2xM matrix after finishing the sequence %this is our S end %Here we change the mean and std of all images. We normalize all images. %This is done to reduce the error due to lighting conditions. for i=1:size(S,2) temp=double(S(:,i)); m=mean(temp); st=std(temp); S(:,i)=(temp-m)*ustd/st+um; end %show normalized images for i=1:M str=strcat(int2str(i),'.jpg'); img=reshape(S(:,i),icol,irow); img=img'; end %mean image; m=mean(S,2); %obtains the mean of each row instead of each column tmimg=uint8(m); %converts to unsigned 8-bit integer. Values range from 0 to 255 img=reshape(tmimg,icol,irow); %takes the N1*N2x1 vector and creates a N2xN1 matrix img=img'; %creates a N1xN2 matrix by transposing the image. % Change image for manipulation dbx=[]; % A matrix for i=1:M temp=double(S(:,i)); dbx=[dbx temp]; end %Covariance matrix C=A'A, L=AA' A=dbx'; L=A*A'; % vv are the eigenvector for L % dd are the eigenvalue for both L=dbx'*dbx and C=dbx*dbx'; [vv dd]=eig(L); % Sort and eliminate those whose eigenvalue is zero v=[]; d=[]; for i=1:size(vv,2) if(dd(i,i)>1e-4) v=[v vv(:,i)]; d=[d dd(i,i)]; end end %sort, will return an ascending sequence [B index]=sort(d); ind=zeros(size(index)); dtemp=zeros(size(index)); vtemp=zeros(size(v)); len=length(index); for i=1:len dtemp(i)=B(len+1-i); ind(i)=len+1-index(i); vtemp(:,ind(i))=v(:,i); end d=dtemp; v=vtemp; %Normalization of eigenvectors for i=1:size(v,2) %access each column kk=v(:,i); temp=sqrt(sum(kk.^2)); v(:,i)=v(:,i)./temp; end %Eigenvectors of C matrix u=[]; for i=1:size(v,2) temp=sqrt(d(i)); u=[u (dbx*v(:,i))./temp]; end %Normalization of eigenvectors for i=1:size(u,2) kk=u(:,i); temp=sqrt(sum(kk.^2)); u(:,i)=u(:,i)./temp; end % show eigenfaces; for i=1:size(u,2) img=reshape(u(:,i),icol,irow); img=img'; img=histeq(img,255); end % Find the weight of each face in the training set. omega = []; for h=1:size(dbx,2) WW=[]; for i=1:size(u,2) t = u(:,i)'; WeightOfImage = dot(t,dbx(:,h)'); WW = [WW; WeightOfImage]; end omega = [omega WW]; end % Acquire new image % Note: the input image must have a bmp or jpg extension. % It should have the same size as the ones in your training set. % It should be placed on your desktop ed_min=[]; srcFiles = dir('G:\newdatabase\*.jpg'); % the folder in which ur images exists for b = 1 : length(srcFiles) filename = strcat('G:\newdatabase\',srcFiles(b).name); Imgdata = imread(filename); InputImage=Imgdata; InImage=reshape(permute((double(InputImage)),[2,1,3]),[irow*icol,1]); temp=InImage; me=mean(temp); st=std(temp); temp=(temp-me)*ustd/st+um; NormImage = temp; Difference = temp-m; p = []; aa=size(u,2); for i = 1:aa pare = dot(NormImage,u(:,i)); p = [p; pare]; end InImWeight = []; for i=1:size(u,2) t = u(:,i)'; WeightOfInputImage = dot(t,Difference'); InImWeight = [InImWeight; WeightOfInputImage]; end noe=numel(InImWeight); % Find Euclidean distance e=[]; for i=1:size(omega,2) q = omega(:,i); DiffWeight = InImWeight-q; mag = norm(DiffWeight); e = [e mag]; end ed_min=[ed_min MinimumValue]; theta=6.0e+03; %disp(e) z(b,:)=InImWeight; end IDX = kmeans(z,5); clustercount=accumarray(IDX, ones(size(IDX))); disp(clustercount); QUESTIONS: 1.It is working fine for M=50(i.e Training set contains 50 images) but not for M=1200(i.e Training set contains 1200 images).It is not showing any error.There is no output.I waited for 10 min still there is no output. I think it is going infinite loop.What is the problem?Where i was wrong? 2.Instead of running the training set everytime how eigen faces generated are stored so that stored eigen faces are used for future face recoginition for a new input image.So it reduces wastage of time.

    Read the article

  • Waterfall Model (SDLC) vs. Prototyping Model

    The characters in the fable of the Tortoise and the Hare can easily be used to demonstrate the similarities and differences between the Waterfall and Prototyping software development models. This children fable is about a race between a consistently slow moving but steadfast turtle and an extremely fast but unreliable rabbit. After closely comparing each character’s attributes in correlation with both software development models, a trend seems to appear in that the Waterfall closely resembles the Tortoise in that Waterfall Model is typically a slow moving process that is broken up in to multiple sequential steps that must be executed in a standard linear pattern. The Tortoise can be quoted several times in the story saying “Slow and steady wins the race.” This is the perfect mantra for the Waterfall Model in that this model is seen as a cumbersome and slow moving. Waterfall Model Phases Requirement Analysis & Definition This phase focuses on defining requirements for a project that is to be developed and determining if the project is even feasible. Requirements are collected by analyzing existing systems and functionality in correlation with the needs of the business and the desires of the end users. The desired output for this phase is a list of specific requirements from the business that are to be designed and implemented in the subsequent steps. In addition this phase is used to determine if any value will be gained by completing the project. System Design This phase focuses primarily on the actual architectural design of a system, and how it will interact within itself and with other existing applications. Projects at this level should be viewed at a high level so that actual implementation details are decided in the implementation phase. However major environmental decision like hardware and platform decision are typically decided in this phase. Furthermore the basic goal of this phase is to design an application at the system level in those classes, interfaces, and interactions are defined. Additionally decisions about scalability, distribution and reliability should also be considered for all decisions. The desired output for this phase is a functional  design document that states all of the architectural decisions that have been made in regards to the project as well as a diagrams like a sequence and class diagrams. Software Design This phase focuses primarily on the refining of the decisions found in the functional design document. Classes and interfaces are further broken down in to logical modules based on the interfaces and interactions previously indicated. The output of this phase is a formal design document. Implementation / Coding This phase focuses primarily on implementing the previously defined modules in to units of code. These units are developed independently are intergraded as the system is put together as part of a whole system. Software Integration & Verification This phase primarily focuses on testing each of the units of code developed as well as testing the system as a whole. There are basic types of testing at this phase and they include: Unit Test and Integration Test. Unit Test are built to test the functionality of a code unit to ensure that it preforms its desired task. Integration testing test the system as a whole because it focuses on results of combining specific units of code and validating it against expected results. The output of this phase is a test plan that includes test with expected results and actual results. System Verification This phase primarily focuses on testing the system as a whole in regards to the list of project requirements and desired operating environment. Operation & Maintenance his phase primarily focuses on handing off the competed project over to the customer so that they can verify that all of their requirements have been met based on their original requirements. This phase will also validate the correctness of their requirements and if any changed need to be made. In addition, any problems not resolved in the previous phase will be handled in this section. The Waterfall Model’s linear and sequential methodology does offer a project certain advantages and disadvantages. Advantages of the Waterfall Model Simplistic to implement and execute for projects and/or company wide Limited demand on resources Large emphasis on documentation Disadvantages of the Waterfall Model Completed phases cannot be revisited regardless if issues arise within a project Accurate requirement are never gather prior to the completion of the requirement phase due to the lack of clarification in regards to client’s desires. Small changes or errors that arise in applications may cause additional problems The client cannot change any requirements once the requirements phase has been completed leaving them no options for changes as they see their requirements changes as the customers desires change. Excess documentation Phases are cumbersome and slow moving Learn more about the Major Process in the Sofware Development Life Cycle and Waterfall Model. Conversely, the Hare shares similar traits with the prototyping software development model in that ideas are rapidly converted to basic working examples and subsequent changes are made to quickly align the project with customers desires as they are formulated and as software strays from the customers vision. The basic concept of prototyping is to eliminate the use of well-defined project requirements. Projects are allowed to grow as the customer needs and request grow. Projects are initially designed according to basic requirements and are refined as requirement become more refined. This process allows customer to feel their way around the application to ensure that they are developing exactly what they want in the application This model also works well for determining the feasibility of certain approaches in regards to an application. Prototypes allow for quickly developing examples of implementing specific functionality based on certain techniques. Advantages of Prototyping Active participation from users and customers Allows customers to change their mind in specifying requirements Customers get a better understanding of the system as it is developed Earlier bug/error detection Promotes communication with customers Prototype could be used as final production Reduced time needed to develop applications compared to the Waterfall method Disadvantages of Prototyping Promotes constantly redefining project requirements that cause major system rewrites Potential for increased complexity of a system as scope of the system expands Customer could believe the prototype as the working version. Implementation compromises could increase the complexity when applying updates and or application fixes When companies trying to decide between the Waterfall model and Prototype model they need to evaluate the benefits and disadvantages for both models. Typically smaller companies or projects that have major time constraints typically head for more of a Prototype model approach because it can reduce the time needed to complete the project because there is more of a focus on building a project and less on defining requirements and scope prior to the start of a project. On the other hand, Companies with well-defined requirements and time allowed to generate proper documentation should steer towards more of a waterfall model because they are in a position to obtain clarified requirements and have to design and optimal solution prior to the start of coding on a project.

    Read the article

  • SQL University: What and why of database refactoring

    - by Mladen Prajdic
    This is a post for a great idea called SQL University started by Jorge Segarra also famously known as SqlChicken on Twitter. It’s a collection of blog posts on different database related topics contributed by several smart people all over the world. So this week is mine and we’ll be talking about database testing and refactoring. In 3 posts we’ll cover: SQLU part 1 - What and why of database testing SQLU part 2 - What and why of database refactoring SQLU part 3 - Tools of the trade This is a second part of the series and in it we’ll take a look at what database refactoring is and why do it. Why refactor a database To know why refactor we first have to know what refactoring actually is. Code refactoring is a process where we change module internals in a way that does not change that module’s input/output behavior. For successful refactoring there is one crucial thing we absolutely must have: Tests. Automated unit tests are the only guarantee we have that we haven’t broken the input/output behavior before refactoring. If you haven’t go back ad read my post on the matter. Then start writing them. Next thing you need is a code module. Those are views, UDFs and stored procedures. By having direct table access we can kiss fast and sweet refactoring good bye. One more point to have a database abstraction layer. And no, ORM’s don’t fall into that category. But also know that refactoring is NOT adding new functionality to your code. Many have fallen into this trap. Don’t be one of them and resist the lure of the dark side. And it’s a strong lure. We developers in general love to add new stuff to our code, but hate fixing our own mistakes or changing existing code for no apparent reason. To be a good refactorer one needs discipline and focus. Now we know that refactoring is all about changing inner workings of existing code. This can be due to performance optimizations, changing internal code workflows or some other reason. This is a typical black box scenario to the outside world. If we upgrade the car engine it still has to drive on the road (preferably faster) and not fly (no matter how cool that would be). Also be aware that white box tests will break when we refactor. What to refactor in a database Refactoring databases doesn’t happen that often but when it does it can include a lot of stuff. Let us look at a few common cases. Adding or removing database schema objects Adding, removing or changing table columns in any way, adding constraints, keys, etc… All of these can be counted as internal changes not visible to the data consumer. But each of these carries a potential input/output behavior change. Dropping a column can result in views not working anymore or stored procedure logic crashing. Adding a unique constraint shows duplicated data that shouldn’t exist. Foreign keys break a truncate table command executed from an application that runs once a month. All these scenarios are very real and can happen. With the proper database abstraction layer fully covered with black box tests we can make sure something like that does not happen (hopefully at all). Changing physical structures Physical structures include heaps, indexes and partitions. We can pretty much add or remove those without changing the data returned by the database. But the performance can be affected. So here we use our performance tests. We do have them, right? Just by adding a single index we can achieve orders of magnitude performance improvement. Won’t that make users happy? But what if that index causes our write operations to crawl to a stop. again we have to test this. There are a lot of things to think about and have tests for. Without tests we can’t do successful refactoring! Fixing bad code We all have some bad code in our systems. We usually refer to that code as code smell as they violate good coding practices. Examples of such code smells are SQL injection, use of SELECT *, scalar UDFs or cursors, etc… Each of those is huge code smell and can result in major code changes. Take SELECT * from example. If we remove a column from a table the client using that SELECT * statement won’t have a clue about that until it runs. Then it will gracefully crash and burn. Not to mention the widely unknown SELECT * view refresh problem that Tomas LaRock (@SQLRockstar on Twitter) and Colin Stasiuk (@BenchmarkIT on Twitter) talk about in detail. Go read about it, it’s informative. Refactoring this includes replacing the * with column names and most likely change to application using the database. Breaking apart huge stored procedures Have you ever seen seen a stored procedure that was 2000 lines long? I have. It’s not pretty. It hurts the eyes and sucks the will to live the next 10 minutes. They are a maintenance nightmare and turn into things no one dares to touch. I’m willing to bet that 100% of time they don’t have a single test on them. Large stored procedures (and functions) are a clear sign that they contain business logic. General opinion on good database coding practices says that business logic has no business in the database. That’s the applications part. Refactoring such behemoths requires writing lots of edge case tests for the stored procedure input/output behavior and then start to refactor it. First we split the logic inside into smaller parts like new stored procedures and UDFs. Those then get called from the master stored procedure. Once we’ve successfully modularized the database code it’s best to transfer that logic into the applications consuming it. This only leaves the stored procedure with common data manipulation logic. Of course this isn’t always possible so having a plethora of performance and behavior unit tests is absolutely necessary to confirm we’ve actually improved the codebase in some way.   Refactoring is not a popular chore amongst developers or managers. The former don’t like fixing old code, the latter can’t see the financial benefit. Remember how we talked about being lousy at estimating future costs in the previous post? But there comes a time when it must be done. Hopefully I’ve given you some ideas how to get started. In the last post of the series we’ll take a look at the tools to use and an example of testing and refactoring.

    Read the article

  • Oracle Enterprise Manager Ops Center : Using Operational Profiles to Install Packages and other Content

    - by LeonShaner
    Oracle Enterprise Manager Ops Center provides numerous ways to deploy content, such as through OS Update Profiles, or as part of an OS Provisioning plan or combinations of those and other "Install Software" capabilities of Deployment Plans.  This short "how-to" blog will highlight an alternative way to deploy content using Operational Profiles. Usually we think of Operational Profiles as a way to execute a simple "one-time" script to perform a basic system administration function, which can optionally be based on user input; however, Operational Profiles can be much more powerful than that.  There is often more to performing an action than merely running a script -- sometimes configuration files, packages, binaries, and other scripts, etc. are needed to perform the action, and sometimes the user would like to leave such content on the system for later use. For shell scripts and other content written to be generic enough to work on any flavor of UNIX, converting the same scripts and configuration files into Solaris 10 SVR4 package, Solaris 11 IPS package, and/or a Linux RPM's might be seen as three times the work, for little appreciable gain.   That is where using an Operational Profile to deploy simple scripts and other generic content can be very helpful.  The approach is so powerful, that pretty much any kind of content can be deployed using an Operational Profile, provided the files involved are not overly large, and it is not necessary to convert the content into UNIX variant-specific formats. The basic formula for deploying content with an Operational Profile is as follows: Begin with a traditional script header, which is a UNIX shell script that will be responsible for decoding and extracting content, copying files into the right places, and executing any other scripts and commands needed to install and configure that content. Include steps to make the script platform-aware, to do the right thing for a given UNIX variant, or a "sorry" message if the operator has somehow tried to run the Operational Profile on a system where the script is not designed to run.  Ops Center can constrain execution by target type, so such checks at this level are an added safeguard, but also useful with the generic target type of "Operating System" where the admin wants the script to "do the right thing," whatever the UNIX variant. Include helpful output to show script progress, and any other informational messages that can help the admin determine what has gone wrong in the case of a problem in script execution.  Such messages will be shown in the job execution log. Include necessary "clean up" steps for normal and error exit conditions Set non-zero exit codes when appropriate -- a non-zero exit code will cause an Operational Profile job to be marked failed, which is the admin's cue to look into the job details for diagnostic messages in the output from the script. That first bullet deserves some explanation.  If Operational Profiles are usually simple "one-time" scripts and binary content is not allowed, then how does the actual content, packages, binaries, and other scripts get delivered along with the script?  More specifically, how does one include such content without needing to first create some kind of traditional package?   All that is required is to simply encode the content and append it to the end of the Operational Profile.  The header portion of the Operational Profile will need to contain the commands to decode the embedded content that has been appended to the bottom of the script.  The header code can do whatever else is needed, and finally clean up any intermediate files that were created during the decoding and extraction of the content. One way to encode binary and other content for inclusion in a script is to use the "uuencode" utility to convert the content into simple base64 ASCII text -- a form that is suitable to be appended to an Operational Profile.   The behavior of the "uudecode" utility is such that it will skip over any parts of the input that do not fit the uuencoded "begin" and "end" clauses.  For that reason, your header script will be skipped over, and uudecode will find your embedded content, that you will uuencode and paste at the end of the Operational Profile.  You can have as many "begin" / "end" clauses as you need -- just separate each embedded file by an empty line between "begin" and "end" clauses. Example:  Install SUNWsneep and set the system serial number Script:  deploySUNWsneep.sh ( <- right-click / save to download) Highlights: #!/bin/sh # Required variables: OC_SERIAL="$OC_SERIAL" # The user-supplied serial number for the asset ... Above is a good practice, showing right up front what kind of input the Operational Profile will require.   The right-hand side where $OC_SERIAL appears in this example will be filled in by Ops Center based on the user input at deployment time. The script goes on to restrict the use of the program to the intended OS type (Solaris 10 or older, in this example, but other content might be suitable for Solaris 11, or Linux -- it depends on the content and the script that will handle it). A temporary working directory is created, and then we have the command that decodes the embedded content from "self" which in scripting terms is $0 (a variable that expands to the name of the currently executing script): # Pass myself through uudecode, which will extract content to the current dir uudecode $0 At that point, whatever content was appended in uuencoded form at the end of the script has been written out to the current directory.  In this example that yields a file, SUNWsneep.7.0.zip, which the rest of the script proceeds to unzip, and pkgadd, followed by running "/opt/SUNWsneep/bin/sneep -s $OC_SERIAL" which is the command that stores the system serial for future use by other programs such as Explorer.   Don't get hung up on the example having used a pkgadd command.  The content started as a zip file and it could have been a tar.gz, or any other file.  This approach simply decodes the file.  The header portion of the script has to make sense of the file and do the right thing (e.g. it's up to you). The script goes on to clean up after itself, whether or not the above was successful.  Errors are echo'd by the script and a non-zero exit code is set where appropriate. Second to last, we have: # just in case, exit explicitly, so that uuencoded content will not cause error OPCleanUP exit # The rest of the script is ignored, except by uudecode # # UUencoded content follows # # e.g. for each file needed, #  $ uuencode -m {source} {source} > {target}.uu5 # then paste the {target}.uu5 files below # they will be extracted into the workding dir at $TDIR # The commentary above also describes how to encode the content. Finally we have the uuencoded content: begin-base64 444 SUNWsneep.7.0.zip UEsDBBQAAAAIAPsRy0Di3vnukAAAAMcAAAAKABUAcmVhZG1lLnR4dFVUCQADOqnVT7up ... VXgAAFBLBQYAAAAAAgACAJEAAADTNwEAAAA= ==== That last line of "====" is the base64 uuencode equivalent of a blank line, followed by "end" and as mentioned you can have as many begin/end clauses as you need.  Just separate each embedded file by a blank line after each ==== and before each begin-base64. Deploying the example Operational Profile looks like this (where I have pasted the system serial number into the required field): The job succeeded, but here is an example of the kind of diagnostic messages that the example script produces, and how Ops Center displays them in the job details: This same general approach could be used to deploy Explorer, and other useful utilities and scripts. Please let us know what you think?  Until next time...\Leon-- Leon Shaner | Senior IT/Product ArchitectSystems Management | Ops Center Engineering @ Oracle The views expressed on this [blog; Web site] are my own and do not necessarily reflect the views of Oracle. For more information, please go to Oracle Enterprise Manager  web page or  follow us at :  Twitter | Facebook | YouTube | Linkedin | Newsletter

    Read the article

  • ApiChange Is Released!

    - by Alois Kraus
    I have been working on little tool to simplify my life and perhaps yours as developer as well. It is basically a command line tool that allows you to execute queries on your compiled .NET code base. The main purpose is to find out how big the impact of an api change would be if you changed this or that.  Now you can do high level operations like Diff public types for breaking changes. Who uses a method? Who uses a type? Who uses implements an interface? Who references me? What format has the binary  (32/64, Managed C++, Pure IL, Unmanaged)? Search for all event subscribers and unsubscribers. A unique feature is to check for event subscription imbalances. Forgotten event subscriptions are the 90% cause of managed memory leaks. It is done at a per class level. If one class does subscribe to one event more often than it does unsubscribe it is treated as possible event subscription imbalance. Another unique ability is to search for users of string literals which allows you to track users of a string constant which is not possible otherwise. For incremental builds the ShowRebuildTargets command can be used to identify the dependant targets that need a rebuild after you did compile one assembly. It has some heuristics in place to determine the impact of breaking changes and finds out which targets need to be recompiled as well. It has a ton of other features and a an API to access these things programmatically so you can build upon these simple queries create even better tools. Perhaps we get a Visual Studio plug in? You can download it from CodePlex here. It works via XCopy deployment. Simply let it run and check the command line help out. The best feature in my opinion is that the output of nearly all commands can be piped to Excel for further analysis. Since it does read also the pdbs it can show you the source file name and line number as well for all matches. The following picture shows the output of a –WhousesType query. The following command checks where type from BaseLibraryV1.dll are used inside DependantLibV1.dll. All matches are printed out with the reason and matching item along with file and line number. There is even a hyper link to the match which will open Visual Studio. ApiChange -whousestype "*" BaseLibraryV1.dll -in DependantLibV1.dll –excel The "*” is the actual query which means all types. The syntax is the same like in C# just that placeholders are allowed ;-). More info's can be found at the Codeplex Documentation.     The tool was developed in a TDD style manner which means that it is heavily tested and already used by a quite large user base inside the company I do work for. Luckily for you I got the permission to make it public so you take advantage of it. It is fully instrumented with tracing. If you find bugs simply add the –trace command line switch to find out what is failing and send me the output. How is it done? Your first guess might be that it uses reflection. Wrong. It is based on Mono Cecil a free IL parser with a fantastic API to access all internals of a managed assembly. The speed is awesome and to make it even faster I did make the tool heavily multi threaded. The query above did execute in 1.8s with the Excel output. On a rather slow machine I can analyze over 1500 assemblies in less than 40s with a very low memory consumption. The true power of Mono Cecil is that I can load an assembly like any other data file. I have no problems unloading a file but if I would have used reflection I would need to unload a whole AppDomain just to get rid of one assembly in my memory. Just to give you a glimpse how ApiChange.Api.dll can be used I show you one of the unit tests:           public void Can_Find_GenericMethodInvocations_With_Type_Parameters()         { // 1. Create an aggregator to collect our matches             UsageQueryAggregator agg = new UsageQueryAggregator();   // 2. This is the type we want to search for. Load it via the type query             var decimalType = TypeQuery.GetTypeByName(TestConstants.MscorlibAssembly, "System.Decimal");   // 3. register the type query which searches for uses of the Decimal type             new WhoUsesType(agg, decimalType);   // 4. Search for all users of the Decimal type in the DependandLibV1Assembly             agg.Analyze(TestConstants.DependandLibV1Assembly);   // Extract matches and assert             Assert.AreEqual(2, agg.MethodMatches.Count, "Method match count");             Assert.AreEqual("UseGenericMethod", agg.MethodMatches[0].Match.Name);             Assert.AreEqual("UseGenericMethod", agg.MethodMatches[1].Match.Name);         } Many thanks go from here to Jb Evian for the creation of Mono.Cecil. Without this fantastic piece of code it would have been much much harder. There are other options around like the Common Compiler Infrastructure  Metadata Api which should do the same thing but it was not a real option since the Microsoft reader did fail on even simple assemblies (at least in September 2009 this was the case). Besides this I found the CCI Apis much harder to use. The only real competitor was Reflector which does support many things but does not let me access his cool high level analyze commands. So I decided to dig into the IL specs and as a result you can query your compiled binaries from the command line or programmatically. The best thing is you try it out for yourself and give me some feedback what you miss. If you want to contribute or have a cool idea what should be added drop me a mail at A Kraus1@___No [email protected]. There is much more inside the tool I did not talk about it (yet).

    Read the article

  • MapRedux - PowerShell and Big Data

    - by Dittenhafer Solutions
    MapRedux – #PowerShell and #Big Data Have you been hearing about “big data”, “map reduce” and other large scale computing terms over the past couple of years and been curious to dig into more detail? Have you read some of the Apache Hadoop online documentation and unfortunately concluded that it wasn't feasible to setup a “test” hadoop environment on your machine? More recently, I have read about some of Microsoft’s work to enable Hadoop on the Azure cloud. Being a "Microsoft"-leaning technologist, I am more inclinded to be successful with experimentation when on the Windows platform. Of course, it is not that I am "religious" about one set of technologies other another, but rather more experienced. Anyway, within the past couple of weeks I have been thinking about PowerShell a bit more as the 2012 PowerShell Scripting Games approach and it occured to me that PowerShell's support for Windows Remote Management (WinRM), and some other inherent features of PowerShell might lend themselves particularly well to a simple implementation of the MapReduce framework. I fired up my PowerShell ISE and started writing just to see where it would take me. Quite simply, the ScriptBlock feature combined with the ability of Invoke-Command to create remote jobs on networked servers provides much of the plumbing of a distributed computing environment. There are some limiting factors of course. Microsoft provided some default settings which prevent PowerShell from taking over a network without administrative approval first. But even with just one adjustment, a given Windows-based machine can become a node in a MapReduce-style distributed computing environment. Ok, so enough introduction. Let's talk about the code. First, any machine that will participate as a remote "node" will need WinRM enabled for remote access, as shown below. This is not exactly practical for hundreds of intended nodes, but for one (or five) machines in a test environment it does just fine. C:> winrm quickconfig WinRM is not set up to receive requests on this machine. The following changes must be made: Set the WinRM service type to auto start. Start the WinRM service. Make these changes [y/n]? y Alternatively, you could take the approach described in the Remotely enable PSRemoting post from the TechNet forum and use PowerShell to create remote scheduled tasks that will call Enable-PSRemoting on each intended node. Invoke-MapRedux Moving on, now that you have one or more remote "nodes" enabled, you can consider the actual Map and Reduce algorithms. Consider the following snippet: $MyMrResults = Invoke-MapRedux -MapReduceItem $Mr -ComputerName $MyNodes -DataSet $dataset -Verbose Invoke-MapRedux takes an instance of a MapReduceItem which references the Map and Reduce scriptblocks, an array of computer names which are the remote nodes, and the initial data set to be processed. As simple as that, you can start working with concepts of big data and the MapReduce paradigm. Now, how did we get there? I have published the initial version of my PsMapRedux PowerShell Module on GitHub. The PsMapRedux module provides the Invoke-MapRedux function described above. Feel free to browse the underlying code and even contribute to the project! In a later post, I plan to show some of the inner workings of the module, but for now let's move on to how the Map and Reduce functions are defined. Map Both the Map and Reduce functions need to follow a prescribed prototype. The prototype for a Map function in the MapRedux module is as follows. A simple scriptblock that takes one PsObject parameter and returns a hashtable. It is important to note that the PsObject $dataset parameter is a MapRedux custom object that has a "Data" property which offers an array of data to be processed by the Map function. $aMap = { Param ( [PsObject] $dataset ) # Indicate the job is running on the remote node. Write-Host ($env:computername + "::Map"); # The hashtable to return $list = @{}; # ... Perform the mapping work and prepare the $list hashtable result with your custom PSObject... # ... The $dataset has a single 'Data' property which contains an array of data rows # which is a subset of the originally submitted data set. # Return the hashtable (Key, PSObject) Write-Output $list; } Reduce Likewise, with the Reduce function a simple prototype must be followed which takes a $key and a result $dataset from the MapRedux's partitioning function (which joins the Map results by key). Again, the $dataset is a MapRedux custom object that has a "Data" property as described in the Map section. $aReduce = { Param ( [object] $key, [PSObject] $dataset ) Write-Host ($env:computername + "::Reduce - Count: " + $dataset.Data.Count) # The hashtable to return $redux = @{}; # Return Write-Output $redux; } All Together Now When everything is put together in a short example script, you implement your Map and Reduce functions, query for some starting data, build the MapReduxItem via New-MapReduxItem and call Invoke-MapRedux to get the process started: # Import the MapRedux and SQL Server providers Import-Module "MapRedux" Import-Module “sqlps” -DisableNameChecking # Query the database for a dataset Set-Location SQLSERVER:\sql\dbserver1\default\databases\myDb $query = "SELECT MyKey, Date, Value1 FROM BigData ORDER BY MyKey"; Write-Host "Query: $query" $dataset = Invoke-SqlCmd -query $query # Build the Map function $MyMap = { Param ( [PsObject] $dataset ) Write-Host ($env:computername + "::Map"); $list = @{}; foreach($row in $dataset.Data) { # Write-Host ("Key: " + $row.MyKey.ToString()); if($list.ContainsKey($row.MyKey) -eq $true) { $s = $list.Item($row.MyKey); $s.Sum += $row.Value1; $s.Count++; } else { $s = New-Object PSObject; $s | Add-Member -Type NoteProperty -Name MyKey -Value $row.MyKey; $s | Add-Member -type NoteProperty -Name Sum -Value $row.Value1; $list.Add($row.MyKey, $s); } } Write-Output $list; } $MyReduce = { Param ( [object] $key, [PSObject] $dataset ) Write-Host ($env:computername + "::Reduce - Count: " + $dataset.Data.Count) $redux = @{}; $count = 0; foreach($s in $dataset.Data) { $sum += $s.Sum; $count += 1; } # Reduce $redux.Add($s.MyKey, $sum / $count); # Return Write-Output $redux; } # Create the item data $Mr = New-MapReduxItem "My Test MapReduce Job" $MyMap $MyReduce # Array of processing nodes... $MyNodes = ("node1", "node2", "node3", "node4", "localhost") # Run the Map Reduce routine... $MyMrResults = Invoke-MapRedux -MapReduceItem $Mr -ComputerName $MyNodes -DataSet $dataset -Verbose # Show the results Set-Location C:\ $MyMrResults | Out-GridView Conclusion I hope you have seen through this article that PowerShell has a significant infrastructure available for distributed computing. While it does take some code to expose a MapReduce-style framework, much of the work is already done and PowerShell could prove to be the the easiest platform to develop and run big data jobs in your corporate data center, potentially in the Azure cloud, or certainly as an academic excerise at home or school. Follow me on Twitter to stay up to date on the continuing progress of my Powershell MapRedux module, and thanks for reading! Daniel

    Read the article

  • When building a web Application project, TFS 2008 Builds two spearate projects in the _PublishedFold

    - by Steve Johnson
    Hi all, I am trying to a perform build automation on one of web application projects built using VS 2008. The _PublishedWebSites contains two folders: Web and Deploy. I just want the TFS 2008 to generate only the Deploy Folder and Not the Web Folder. Here is my TFSBuild.proj File <Project ToolsVersion="3.5" DefaultTargets="Compile" xmlns="http://schemas.microsoft.com/developer/msbuild/2003"> <Import Project="$(MSBuildExtensionsPath)\Microsoft\VisualStudio\TeamBuild\Microsoft.TeamFoundation.Build.targets" /> <Import Project="$(MSBuildExtensionsPath)\Microsoft\WebDeployment\v9.0\Microsoft.WebDeployment.targets" /> <ItemGroup> <SolutionToBuild Include="$(BuildProjectFolderPath)/../../Development/Main/MySoftware.sln"> <Targets></Targets> <Properties></Properties> </SolutionToBuild> </ItemGroup> <ItemGroup> <ConfigurationToBuild Include="Release|AnyCPU"> <FlavorToBuild>Release</FlavorToBuild> <PlatformToBuild>Any CPU</PlatformToBuild> </ConfigurationToBuild> </ItemGroup> <!--<ItemGroup> <SolutionToBuild Include="$(BuildProjectFolderPath)/../../Development/Main/MySoftware.sln"> <Targets></Targets> <Properties></Properties> </SolutionToBuild> </ItemGroup> <ItemGroup> <ConfigurationToBuild Include="Release|x64"> <FlavorToBuild>Release</FlavorToBuild> <PlatformToBuild>x64</PlatformToBuild> </ConfigurationToBuild> </ItemGroup>--> <ItemGroup> <AdditionalReferencePath Include="C:\3PR" /> </ItemGroup> <Target Name="GetCopyToOutputDirectoryItems" Outputs="@(AllItemsFullPathWithTargetPath)" DependsOnTargets="AssignTargetPaths;_SplitProjectReferencesByFileExistence"> <!-- Get items from child projects first. --> <MSBuild Projects="@(_MSBuildProjectReferenceExistent)" Targets="GetCopyToOutputDirectoryItems" Properties="%(_MSBuildProjectReferenceExistent.SetConfiguration); %(_MSBuildProjectReferenceExistent.SetPlatform)" Condition="'@(_MSBuildProjectReferenceExistent)'!=''"> <Output TaskParameter="TargetOutputs" ItemName="_AllChildProjectItemsWithTargetPathNotFiltered"/> </MSBuild> <!-- Remove duplicates. --> <RemoveDuplicates Inputs="@(_AllChildProjectItemsWithTargetPathNotFiltered)"> <Output TaskParameter="Filtered" ItemName="_AllChildProjectItemsWithTargetPath"/> </RemoveDuplicates> <!-- Target outputs must be full paths because they will be consumed by a different project. --> <CreateItem Include="@(_AllChildProjectItemsWithTargetPath->'%(FullPath)')" Exclude= "$(BuildProjectFolderPath)/../../Development/Main/Web/Bin*.pdb; *.refresh; *.vshost.exe; *.manifest; *.compiled; $(BuildProjectFolderPath)/../../Development/Main/Web/Auth/MySoftware.dll; $(BuildProjectFolderPath)/../../Development/Main/Web/BinApp_Web_*.dll;" Condition="'%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='Always' or '%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='PreserveNewest'" > <Output TaskParameter="Include" ItemName="AllItemsFullPathWithTargetPath"/> <Output TaskParameter="Include" ItemName="_SourceItemsToCopyToOutputDirectoryAlways" Condition="'%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='Always'"/> <Output TaskParameter="Include" ItemName="_SourceItemsToCopyToOutputDirectory" Condition="'%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='PreserveNewest'"/> </CreateItem> </Target> <!-- To modify your build process, add your task inside one of the targets below and uncomment it. Other similar extension points exist, see Microsoft.WebDeployment.targets. <Target Name="BeforeBuild"> </Target> <Target Name="BeforeMerge"> </Target> <Target Name="AfterMerge"> </Target> <Target Name="AfterBuild"> </Target> --> </Project> I want to build everything that the builtin Deploy project is doing for me. But i dont want the generated Web Project as it conatains App_Web_xxxx.dll assemblies instead of a single compiled assembly. Please help. Thanks

    Read the article

  • plupload variable upload path?

    - by SoulieBaby
    Hi all, I'm using plupload to upload files to my server (http://www.plupload.com/index.php), however I wanted to know if there was any way of making the upload path variable. Basically I need to select the upload path folder first, then choose the files using plupload and then upload to the initially selected folder. I've tried a few different ways but I can't seem to pass along the variable folder path to the upload.php file. I'm using the flash version of plupload. If someone could help me out, that would be fantastic!! :) Here's my plupload jquery: jQuery.noConflict(); jQuery(document).ready(function() { jQuery("#flash_uploader").pluploadQueue({ // General settings runtimes: 'flash', url: '/assets/upload/upload.php', max_file_size: '10mb', chunk_size: '1mb', unique_names: false, // Resize images on clientside if we can resize: {width: 500, height: 350, quality: 100}, // Flash settings flash_swf_url: '/assets/upload/flash/plupload.flash.swf' }); }); And here's the upload.php file: <?php /** * upload.php * * Copyright 2009, Moxiecode Systems AB * Released under GPL License. * * License: http://www.plupload.com/license * Contributing: http://www.plupload.com/contributing */ // HTTP headers for no cache etc header('Content-type: text/plain; charset=UTF-8'); header("Expires: Mon, 26 Jul 1997 05:00:00 GMT"); header("Last-Modified: ".gmdate("D, d M Y H:i:s")." GMT"); header("Cache-Control: no-store, no-cache, must-revalidate"); header("Cache-Control: post-check=0, pre-check=0", false); header("Pragma: no-cache"); // Settings $targetDir = $_SERVER['DOCUMENT_ROOT']."/tmp/uploads"; //temp directory <- need these to be variable $finalDir = $_SERVER['DOCUMENT_ROOT']."/tmp/uploads2"; //final directory <- need these to be variable $cleanupTargetDir = true; // Remove old files $maxFileAge = 60 * 60; // Temp file age in seconds // 5 minutes execution time @set_time_limit(5 * 60); // usleep(5000); // Get parameters $chunk = isset($_REQUEST["chunk"]) ? $_REQUEST["chunk"] : 0; $chunks = isset($_REQUEST["chunks"]) ? $_REQUEST["chunks"] : 0; $fileName = isset($_REQUEST["name"]) ? $_REQUEST["name"] : ''; // Clean the fileName for security reasons $fileName = preg_replace('/[^\w\._]+/', '', $fileName); // Create target dir if (!file_exists($targetDir)) @mkdir($targetDir); // Remove old temp files if (is_dir($targetDir) && ($dir = opendir($targetDir))) { while (($file = readdir($dir)) !== false) { $filePath = $targetDir . DIRECTORY_SEPARATOR . $file; // Remove temp files if they are older than the max age if (preg_match('/\\.tmp$/', $file) && (filemtime($filePath) < time() - $maxFileAge)) @unlink($filePath); } closedir($dir); } else die('{"jsonrpc" : "2.0", "error" : {"code": 100, "message": "Failed to open temp directory."}, "id" : "id"}'); // Look for the content type header if (isset($_SERVER["HTTP_CONTENT_TYPE"])) $contentType = $_SERVER["HTTP_CONTENT_TYPE"]; if (isset($_SERVER["CONTENT_TYPE"])) $contentType = $_SERVER["CONTENT_TYPE"]; if (strpos($contentType, "multipart") !== false) { if (isset($_FILES['file']['tmp_name']) && is_uploaded_file($_FILES['file']['tmp_name'])) { // Open temp file $out = fopen($targetDir . DIRECTORY_SEPARATOR . $fileName, $chunk == 0 ? "wb" : "ab"); if ($out) { // Read binary input stream and append it to temp file $in = fopen($_FILES['file']['tmp_name'], "rb"); if ($in) { while ($buff = fread($in, 4096)) fwrite($out, $buff); } else die('{"jsonrpc" : "2.0", "error" : {"code": 101, "message": "Failed to open input stream."}, "id" : "id"}'); fclose($out); unlink($_FILES['file']['tmp_name']); } else die('{"jsonrpc" : "2.0", "error" : {"code": 102, "message": "Failed to open output stream."}, "id" : "id"}'); } else die('{"jsonrpc" : "2.0", "error" : {"code": 103, "message": "Failed to move uploaded file."}, "id" : "id"}'); } else { // Open temp file $out = fopen($targetDir . DIRECTORY_SEPARATOR . $fileName, $chunk == 0 ? "wb" : "ab"); if ($out) { // Read binary input stream and append it to temp file $in = fopen("php://input", "rb"); if ($in) { while ($buff = fread($in, 4096)){ fwrite($out, $buff); } } else die('{"jsonrpc" : "2.0", "error" : {"code": 101, "message": "Failed to open input stream."}, "id" : "id"}'); fclose($out); } else die('{"jsonrpc" : "2.0", "error" : {"code": 102, "message": "Failed to open output stream."}, "id" : "id"}'); } //Moves the file from $targetDir to $finalDir after receiving the final chunk if($chunk == ($chunks-1)){ rename($targetDir . DIRECTORY_SEPARATOR . $fileName, $finalDir . DIRECTORY_SEPARATOR . $fileName); } // Return JSON-RPC response die('{"jsonrpc" : "2.0", "result" : null, "id" : "id"}'); ?>

    Read the article

  • Recursion in the form of a Recursive Func&lt;T, T&gt;

    - by ToStringTheory
    I gotta admit, I am kind of surprised that I didn’t realize I could do this sooner.  I recently had a problem which required a recursive function call to come up with the answer.  After some time messing around with a recursive method, and creating an API that I was not happy with, I was able to create an API that I enjoy, and seems intuitive. Introduction To bring it to a simple example, consider the summation to n: A mathematically identical formula is: In a .NET function, this can be represented by a function: Func<int, int> summation = x => x*(x+1)/2 Calling summation with an input integer will yield the summation to that number: var sum10 = summation(4); //sum10 would be equal to 10 But what if I wanted to get a second level summation…  First some to n, and then use that argument as the input to the same function, to find the second level summation: So as an easy example, calculate the summation to 3, which yields 6.  Then calculate the summation to 6 which yields 21. Represented as a mathematical formula - So what if I wanted to represent this as .NET functions.  I can always do: //using the summation formula from above var sum3 = summation(3); //sets sum3 to 6 var sum3_2 = summation(sum3); //sets sum3 to 21 I could always create a while loop to perform the calculations too: Func<int, int> summation = x => x*(x+1)/2; //for the interests of a smaller example, using shorthand int sumResultTo = 3; int level = 2; while(level-- > 0) { sumResultTo = summation(sumResultTo); } //sumResultTo is equal to 21 now. Or express it as a for-loop, method calls, etc…  I really didn’t like any of the options that I tried.  Then it dawned on me – since I was using a Func<T, T> anyways, why not use the Func’s output from one call as the input as another directly. Some Code So, I decided that I wanted a recursion class.  Something that I would be generic and reusable in case I ever wanted to do something like this again. It is limited to only the Func<T1, T2> level of Func, and T1 must be the same as T2. The first thing in this class is a private field for the function: private readonly Func<T, T> _functionToRecurse; So, I since I want the function to be unchangeable, I have defined it as readonly.  Therefore my constructor looks like: public Recursion(Func<T, T> functionToRecurse) { if (functionToRecurse == null) { throw new ArgumentNullException("functionToRecurse", "The function to recurse can not be null"); } _functionToRecurse = functionToRecurse; } Simple enough.  If you have any questions, feel free to post them in the comments, and I will be sure to answer them. Next, I want enough. If be able to get the result of a function dependent on how many levels of recursion: private Func<T, T> GetXLevel(int level) { if (level < 1) { throw new ArgumentOutOfRangeException("level", level, "The level of recursion must be greater than 0"); } if (level == 1) return _functionToRecurse; return _GetXLevel(level - 1, _functionToRecurse); } So, if you pass in 1 for the level, you get just the Func<T,T> back.  If you say that you want to go deeper down the rabbit hole, it calls a method which accepts the level it is at, and the function which it needs to use to recurse further: private Func<T, T> _GetXLevel(int level, Func<T, T> prevFunc) { if (level == 1) return y => prevFunc(_functionToRecurse(y)); return _GetXLevel(level - 1, y => prevFunc(_functionToRecurse(y))); } That is really all that is needed for this class. If I exposed the GetXLevel function publicly, I could use that to get the function for a level, and pass in the argument..  But I wanted something better.  So, I used the ‘this’ array operator for the class: public Func<T,T> this[int level] { get { if (level < 1) { throw new ArgumentOutOfRangeException("level", level, "The level of recursion must be greater than 0"); } return this.GetXLevel(level); } } So, using the same example above of finding the second recursion of the summation of 3: var summator = new Recursion<int>(x => (x * (x + 1)) / 2); var sum_3_level2 = summator[2](3); //yields 21 You can even find just store the delegate to the second level summation, and use it multiple times: var summator = new Recursion<int>(x => (x * (x + 1)) / 2); var sum_level2 = summator[2]; var sum_3_level2 = sum_level2(3); //yields 21 var sum_4_level2 = sum_level2(4); //yields 55 var sum_5_level2 = sum_level2(5); //yields 120 Full Code Don’t think I was just going to hold off on the full file together and make you do the hard work…  Copy this into a new class file: public class Recursion<T> { private readonly Func<T, T> _functionToRecurse; public Recursion(Func<T, T> functionToRecurse) { if (functionToRecurse == null) { throw new ArgumentNullException("functionToRecurse", "The function to recurse can not be null"); } _functionToRecurse = functionToRecurse; } public Func<T,T> this[int level] { get { if (level < 1) { throw new ArgumentOutOfRangeException("level", level, "The level of recursion must be greater than 0"); } return this.GetXLevel(level); } } private Func<T, T> GetXLevel(int level) { if (level < 1) { throw new ArgumentOutOfRangeException("level", level, "The level of recursion must be greater than 0"); } if (level == 1) return _functionToRecurse; return _GetXLevel(level - 1, _functionToRecurse); } private Func<T, T> _GetXLevel(int level, Func<T, T> prevFunc) { if (level == 1) return y => prevFunc(_functionToRecurse(y)); return _GetXLevel(level - 1, y => prevFunc(_functionToRecurse(y))); } } Conclusion The great thing about this class, is that it can be used with any function with same input/output parameters.  I strived to find an implementation that I found clean and useful, and I finally settled on this.  If you have feedback – good or bad, I would love to hear it!

    Read the article

  • Is there any better way for creating a dynamic HTML table without using any javascript library like

    - by piemesons
    Dont worry we dont need to find out any bug in this code.. Its working perfectly.:-P My boss came to me and said "Hey just tell me whats the best of way of writing code for a dynamic HTML table (add row, delete row, update row).No need to add any CSS. Just javascript. No Jquery library etc. I was confused that in the middle of the project why he asking for some stupid exercise like this. What ever i wrote the following code and mailed him and after 15 mins i got a mail from him. " I was expecting much better code from a guy like you. Anyways good job monkey.(And with a picture of monkey as attachment.) thats was the mail. Line by line. I want to reply him but before that i want to know about the quality of my code. Is this really shitty...!!! Or he was just making fun of mine. I dont think that code is really shitty. Still correct me if you can.Code is working perfectly fine. Just copy paste it in a HTML file. <html> <head> <title> Exercise CSS </title> <script type="text/javascript"> function add_row() { var table = document.getElementById('table'); var rowCount = table.rows.length; var row = table.insertRow(rowCount); var cell1 = row.insertCell(0); var element1 = document.createElement("input"); element1.type = "text"; cell1.appendChild(element1); var cell2 = row.insertCell(1); var element2 = document.createElement("input"); element2.type = "text"; cell2.appendChild(element2); var cell3 = row.insertCell(2); cell3.innerHTML = ' <span onClick="edit(this)">Edit</span>/<span onClick="delete_row(this)">Delete</span>'; cell3.setAttribute("style", "display:none;"); var cell4 = row.insertCell(3); cell4.innerHTML = '<span onClick="save(this)">Save</span>'; } function save(e) { var elTableCells = e.parentNode.parentNode.getElementsByTagName("td"); elTableCells[0].innerHTML=elTableCells[0].firstChild.value; elTableCells[1].innerHTML=elTableCells[1].firstChild.value; elTableCells[2].setAttribute("style", "display:block;"); elTableCells[3].setAttribute("style", "display:none;"); } function edit(e) { var elTableCells = e.parentNode.parentNode.getElementsByTagName("td"); elTableCells[0].innerHTML='<input type="text" value="'+elTableCells[0].innerHTML+'">'; elTableCells[1].innerHTML='<input type="text" value="'+elTableCells[1].innerHTML+'">'; elTableCells[2].setAttribute("style", "display:none;"); elTableCells[3].setAttribute("style", "display:block;"); } function delete_row(e) { e.parentNode.parentNode.parentNode.removeChild(e.parentNode.parentNode); } </script> </head> <body > <div id="display"> <table id='table'> <tr id='id'> <td> Piemesons </td> <td> 23 </td> <td > <span onClick="edit(this)">Edit</span>/<span onClick="delete_row(this)">Delete</span> </td> <td style="display:none;"> <span onClick="save(this)">Save</span> </td> </tr> </table> <input type="button" value="Add new row" onClick="add_row();" /> </div> </body>

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • how to generate tinymce to ajax generated textarea

    - by Jai_pans
    Hi, i have a image multi-uloader script which also each item uploaded was preview 1st b4 it submitted and each images has its following textarea which are also generated by javascript and my problem is i want to use the tinymce editor to each textarea generated by the ajax. Any help will be appreciated.. here is my script function fileQueueError(file, errorCode, message) { try { var imageName = "error.gif"; var errorName = ""; if (errorCode === SWFUpload.errorCode_QUEUE_LIMIT_EXCEEDED) { errorName = "You have attempted to queue too many files."; } if (errorName !== "") { alert(errorName); return; } switch (errorCode) { case SWFUpload.QUEUE_ERROR.ZERO_BYTE_FILE: imageName = "zerobyte.gif"; break; case SWFUpload.QUEUE_ERROR.FILE_EXCEEDS_SIZE_LIMIT: imageName = "toobig.gif"; break; case SWFUpload.QUEUE_ERROR.ZERO_BYTE_FILE: case SWFUpload.QUEUE_ERROR.INVALID_FILETYPE: default: alert(message); break; } addImage("images/" + imageName); } catch (ex) { this.debug(ex); } } function fileDialogComplete(numFilesSelected, numFilesQueued) { try { if (numFilesQueued 0) { this.startUpload(); } } catch (ex) { this.debug(ex); } } function uploadProgress(file, bytesLoaded) { try { var percent = Math.ceil((bytesLoaded / file.size) * 100); var progress = new FileProgress(file, this.customSettings.upload_target); progress.setProgress(percent); if (percent === 100) { progress.setStatus("Creating thumbnail..."); progress.toggleCancel(false, this); } else { progress.setStatus("Uploading..."); progress.toggleCancel(true, this); } } catch (ex) { this.debug(ex); } } function uploadSuccess(file, serverData) { try { var progress = new FileProgress(file, this.customSettings.upload_target); if (serverData.substring(0, 7) === "FILEID:") { addRow("tableID","thumbnail.php?id=" + serverData.substring(7),file.name); //setup(); //generateTinyMCE('itemdescription[]'); progress.setStatus("Thumbnail Created."); progress.toggleCancel(false); } else { addImage("images/error.gif"); progress.setStatus("Error."); progress.toggleCancel(false); alert(serverData); } } catch (ex) { this.debug(ex); } } function uploadComplete(file) { try { /* I want the next upload to continue automatically so I'll call startUpload here */ if (this.getStats().files_queued 0) { this.startUpload(); } else { var progress = new FileProgress(file, this.customSettings.upload_target); progress.setComplete(); progress.setStatus("All images received."); progress.toggleCancel(false); } } catch (ex) { this.debug(ex); } } function uploadError(file, errorCode, message) { var imageName = "error.gif"; var progress; try { switch (errorCode) { case SWFUpload.UPLOAD_ERROR.FILE_CANCELLED: try { progress = new FileProgress(file, this.customSettings.upload_target); progress.setCancelled(); progress.setStatus("Cancelled"); progress.toggleCancel(false); } catch (ex1) { this.debug(ex1); } break; case SWFUpload.UPLOAD_ERROR.UPLOAD_STOPPED: try { progress = new FileProgress(file, this.customSettings.upload_target); progress.setCancelled(); progress.setStatus("Stopped"); progress.toggleCancel(true); } catch (ex2) { this.debug(ex2); } case SWFUpload.UPLOAD_ERROR.UPLOAD_LIMIT_EXCEEDED: imageName = "uploadlimit.gif"; break; default: alert(message); break; } addImage("images/" + imageName); } catch (ex3) { this.debug(ex3); } } function addRow(tableID,src,filename) { var table = document.getElementById(tableID); var rowCount = table.rows.length; var row = table.insertRow(rowCount); rowCount + 1; row.id = "row"+rowCount; var cell0 = row.insertCell(0); cell0.innerHTML = rowCount; cell0.style.background = "#FFFFFF"; var cell1 = row.insertCell(1); cell1.align = "center"; cell1.style.background = "#FFFFFF"; var imahe = document.createElement("img"); imahe.setAttribute("src",src); var hidden = document.createElement("input"); hidden.setAttribute("type","hidden"); hidden.setAttribute("name","filename[]"); hidden.setAttribute("value",filename); /*var hidden2 = document.createElement("input"); hidden2.setAttribute("type","hidden"); hidden2.setAttribute("name","filename[]"); hidden2.setAttribute("value",filename); cell1.appendChild(hidden2);*/ cell1.appendChild(hidden); cell1.appendChild(imahe); var cell2 = row.insertCell(2); cell2.align = "left"; cell2.valign = "top"; cell2.style.background = "#FFFFFF"; //tr1.appendChild(td1); var div2 = document.createElement("div"); div2.style.padding ="0 0 0 10px"; div2.style.width = "400px"; var alink = document.createElement("a"); //alink.style.margin="40px 0 0 0"; alink.href ="#"; alink.innerHTML ="Cancel"; alink.onclick= function () { document.getElementById(row.id).style.display='none'; document.getElementById(textfield.id).disabled='disabled'; }; var div = document.createElement("div"); div.style.margin="10px 0"; div.appendChild(alink); var textfield = document.createElement("input"); textfield.id = "file"+rowCount; textfield.type = "text"; textfield.name = "itemname[]"; textfield.style.margin = "10px 0"; textfield.style.width = "400px"; textfield.value = "Item Name"; textfield.onclick= function(){ //textfield.value=""; if(textfield.value=="Item Name") textfield.value=""; if(desc.innerHTML=="") desc.innerHTML ="Item Description"; if(price.value=="") price.value="Item Price"; } var desc = document.createElement("textarea"); desc.name = "itemdescription[]"; desc.cols = "80"; desc.rows = "4"; desc.innerHTML = "Item Description"; desc.onclick = function(){ if(desc.innerHTML== "Item Description") desc.innerHTML = ""; if(textfield.value=="Item name" || textfield.value=="") textfield.value="Item Name"; if(price.value=="") price.value="Item Price"; } var price = document.createElement("input"); price.id = "file"+rowCount; price.type = "text"; price.name = "itemprice[]"; price.style.margin = "10px 0"; price.style.width = "400px"; price.value = "Item Price"; price.onclick= function(){ if(price.value=="Item Price") price.value=""; if(desc.innerHTML=="") desc.innerHTML ="Item Description"; if(textfield.value=="") textfield.value="Item Name"; } var span = document.createElement("span"); span.innerHTML = "View"; span.style.width = "auto"; span.style.padding = "10px 0"; var view = document.createElement("input"); view.id = "file"+rowCount; view.type = "checkbox"; view.name = "publicview[]"; view.value = "y"; view.checked = "checked"; var div3 = document.createElement("div"); div3.appendChild(span); div3.appendChild(view); var div4 = document.createElement("div"); div4.style.padding = "10px 0"; var span2 = document.createElement("span"); span2.innerHTML = "Default Display"; span2.style.width = "auto"; span2.style.padding = "10px 0"; var radio = document.createElement("input"); radio.type = "radio"; radio.name = "setdefault"; radio.value = "y"; div4.appendChild(span2); div4.appendChild(radio); div2.appendChild(div); //div2.appendChild(label); //div2.appendChild(table); div2.appendChild(textfield); div2.appendChild(desc); div2.appendChild(price); div2.appendChild(div3); div2.appendChild(div4); cell2.appendChild(div2); } function addImage(src,val_id) { var newImg = document.createElement("img"); newImg.style.margin = "5px 50px 5px 5px"; newImg.style.display= "inline"; newImg.id=val_id; document.getElementById("thumbnails").appendChild(newImg); if (newImg.filters) { try { newImg.filters.item("DXImageTransform.Microsoft.Alpha").opacity = 0; } catch (e) { // If it is not set initially, the browser will throw an error. This will set it if it is not set yet. newImg.style.filter = 'progid:DXImageTransform.Microsoft.Alpha(opacity=' + 0 + ')'; } } else { newImg.style.opacity = 0; } newImg.onload = function () { fadeIn(newImg, 0); }; newImg.src = src; } function fadeIn(element, opacity) { var reduceOpacityBy = 5; var rate = 30; // 15 fps if (opacity < 100) { opacity += reduceOpacityBy; if (opacity > 100) { opacity = 100; } if (element.filters) { try { element.filters.item("DXImageTransform.Microsoft.Alpha").opacity = opacity; } catch (e) { // If it is not set initially, the browser will throw an error. This will set it if it is not set yet. element.style.filter = 'progid:DXImageTransform.Microsoft.Alpha(opacity=' + opacity + ')'; } } else { element.style.opacity = opacity / 100; } } if (opacity < 100) { setTimeout(function () { fadeIn(element, opacity); }, rate); } } /* ************************************** * FileProgress Object * Control object for displaying file info * ************************************** */ function FileProgress(file, targetID) { this.fileProgressID = "divFileProgress"; this.fileProgressWrapper = document.getElementById(this.fileProgressID); if (!this.fileProgressWrapper) { this.fileProgressWrapper = document.createElement("div"); this.fileProgressWrapper.className = "progressWrapper"; this.fileProgressWrapper.id = this.fileProgressID; this.fileProgressElement = document.createElement("div"); this.fileProgressElement.className = "progressContainer"; var progressCancel = document.createElement("a"); progressCancel.className = "progressCancel"; progressCancel.href = "#"; progressCancel.style.visibility = "hidden"; progressCancel.appendChild(document.createTextNode(" ")); var progressText = document.createElement("div"); progressText.className = "progressName"; progressText.appendChild(document.createTextNode(file.name)); var progressBar = document.createElement("div"); progressBar.className = "progressBarInProgress"; var progressStatus = document.createElement("div"); progressStatus.className = "progressBarStatus"; progressStatus.innerHTML = "&nbsp;"; this.fileProgressElement.appendChild(progressCancel); this.fileProgressElement.appendChild(progressText); this.fileProgressElement.appendChild(progressStatus); this.fileProgressElement.appendChild(progressBar); this.fileProgressWrapper.appendChild(this.fileProgressElement); document.getElementById(targetID).appendChild(this.fileProgressWrapper); fadeIn(this.fileProgressWrapper, 0); } else { this.fileProgressElement = this.fileProgressWrapper.firstChild; this.fileProgressElement.childNodes[1].firstChild.nodeValue = file.name; } this.height = this.fileProgressWrapper.offsetHeight; } FileProgress.prototype.setProgress = function (percentage) { this.fileProgressElement.className = "progressContainer green"; this.fileProgressElement.childNodes[3].className = "progressBarInProgress"; this.fileProgressElement.childNodes[3].style.width = percentage + "%"; }; FileProgress.prototype.setComplete = function () { this.fileProgressElement.className = "progressContainer blue"; this.fileProgressElement.childNodes[3].className = "progressBarComplete"; this.fileProgressElement.childNodes[3].style.width = ""; }; FileProgress.prototype.setError = function () { this.fileProgressElement.className = "progressContainer red"; this.fileProgressElement.childNodes[3].className = "progressBarError"; this.fileProgressElement.childNodes[3].style.width = ""; }; FileProgress.prototype.setCancelled = function () { this.fileProgressElement.className = "progressContainer"; this.fileProgressElement.childNodes[3].className = "progressBarError"; this.fileProgressElement.childNodes[3].style.width = ""; }; FileProgress.prototype.setStatus = function (status) { this.fileProgressElement.childNodes[2].innerHTML = status; }; FileProgress.prototype.toggleCancel = function (show, swfuploadInstance) { this.fileProgressElement.childNodes[0].style.visibility = show ? "visible" : "hidden"; if (swfuploadInstance) { var fileID = this.fileProgressID; this.fileProgressElement.childNodes[0].onclick = function () { swfuploadInstance.cancelUpload(fileID); return false; }; } }; i am using a swfuploader an i jst added a input fields and a textarea when it preview the images which ready to be uploaded and from my html i have this script var swfu; window.onload = function () { swfu = new SWFUpload({ // Backend Settings upload_url: "../we_modules/upload.php", // Relative to the SWF file or absolute post_params: {"PHPSESSID": ""}, // File Upload Settings file_size_limit : "20 MB", // 2MB file_types : "*.*", //file_types : "", file_types_description : "jpg", file_upload_limit : "0", file_queue_limit : "0", // Event Handler Settings - these functions as defined in Handlers.js // The handlers are not part of SWFUpload but are part of my website and control how // my website reacts to the SWFUpload events. //file_queued_handler : fileQueued, file_queue_error_handler : fileQueueError, file_dialog_complete_handler : fileDialogComplete, upload_progress_handler : uploadProgress, upload_error_handler : uploadError, upload_success_handler : uploadSuccess, upload_complete_handler : uploadComplete, // Button Settings button_image_url : "../we_modules/images/SmallSpyGlassWithTransperancy_17x18.png", // Relative to the SWF file button_placeholder_id : "spanButtonPlaceholder", button_width: 180, button_height: 18, button_text : 'Select Files(2 MB Max)', button_text_style : '.button { font-family: Helvetica, Arial, sans-serif; font-size: 12pt;cursor:pointer } .buttonSmall { font-size: 10pt; }', button_text_top_padding: 0, button_text_left_padding: 18, button_window_mode: SWFUpload.WINDOW_MODE.TRANSPARENT, button_cursor: SWFUpload.CURSOR.HAND, // Flash Settings flash_url : "../swfupload/swfupload.swf", custom_settings : { upload_target : "divFileProgressContainer" }, // Debug Settings debug: false }); }; where should i put on the tinymce function as you mention below?

    Read the article

  • When building a web application project, TFS 2008 builds two separate projects in _PublishedFolder.

    - by Steve Johnson
    I am trying to perform build automation on one of my web application projects built using VS 2008. The _PublishedWebSites contains two folders: Web and Deploy. I want TFS 2008 to generate only the deploy folder and not the web folder. Here is my TFSBuild.proj file: <Project ToolsVersion="3.5" DefaultTargets="Compile" xmlns="http://schemas.microsoft.com/developer/msbuild/2003"> <Import Project="$(MSBuildExtensionsPath)\Microsoft\VisualStudio\TeamBuild\Microsoft.TeamFoundation.Build.targets" /> <Import Project="$(MSBuildExtensionsPath)\Microsoft\WebDeployment\v9.0\Microsoft.WebDeployment.targets" /> <ItemGroup> <SolutionToBuild Include="$(BuildProjectFolderPath)/../../Development/Main/MySoftware.sln"> <Targets></Targets> <Properties></Properties> </SolutionToBuild> </ItemGroup> <ItemGroup> <ConfigurationToBuild Include="Release|AnyCPU"> <FlavorToBuild>Release</FlavorToBuild> <PlatformToBuild>Any CPU</PlatformToBuild> </ConfigurationToBuild> </ItemGroup> <!--<ItemGroup> <SolutionToBuild Include="$(BuildProjectFolderPath)/../../Development/Main/MySoftware.sln"> <Targets></Targets> <Properties></Properties> </SolutionToBuild> </ItemGroup> <ItemGroup> <ConfigurationToBuild Include="Release|x64"> <FlavorToBuild>Release</FlavorToBuild> <PlatformToBuild>x64</PlatformToBuild> </ConfigurationToBuild> </ItemGroup>--> <ItemGroup> <AdditionalReferencePath Include="C:\3PR" /> </ItemGroup> <Target Name="GetCopyToOutputDirectoryItems" Outputs="@(AllItemsFullPathWithTargetPath)" DependsOnTargets="AssignTargetPaths;_SplitProjectReferencesByFileExistence"> <!-- Get items from child projects first. --> <MSBuild Projects="@(_MSBuildProjectReferenceExistent)" Targets="GetCopyToOutputDirectoryItems" Properties="%(_MSBuildProjectReferenceExistent.SetConfiguration); %(_MSBuildProjectReferenceExistent.SetPlatform)" Condition="'@(_MSBuildProjectReferenceExistent)'!=''"> <Output TaskParameter="TargetOutputs" ItemName="_AllChildProjectItemsWithTargetPathNotFiltered"/> </MSBuild> <!-- Remove duplicates. --> <RemoveDuplicates Inputs="@(_AllChildProjectItemsWithTargetPathNotFiltered)"> <Output TaskParameter="Filtered" ItemName="_AllChildProjectItemsWithTargetPath"/> </RemoveDuplicates> <!-- Target outputs must be full paths because they will be consumed by a different project. --> <CreateItem Include="@(_AllChildProjectItemsWithTargetPath->'%(FullPath)')" Exclude= "$(BuildProjectFolderPath)/../../Development/Main/Web/Bin*.pdb; *.refresh; *.vshost.exe; *.manifest; *.compiled; $(BuildProjectFolderPath)/../../Development/Main/Web/Auth/MySoftware.dll; $(BuildProjectFolderPath)/../../Development/Main/Web/BinApp_Web_*.dll;" Condition="'%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='Always' or '%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='PreserveNewest'" > <Output TaskParameter="Include" ItemName="AllItemsFullPathWithTargetPath"/> <Output TaskParameter="Include" ItemName="_SourceItemsToCopyToOutputDirectoryAlways" Condition="'%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='Always'"/> <Output TaskParameter="Include" ItemName="_SourceItemsToCopyToOutputDirectory" Condition="'%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='PreserveNewest'"/> </CreateItem> </Target> <!-- To modify your build process, add your task inside one of the targets below and uncomment it. Other similar extension points exist, see Microsoft.WebDeployment.targets. <Target Name="BeforeBuild"> </Target> <Target Name="BeforeMerge"> </Target> <Target Name="AfterMerge"> </Target> <Target Name="AfterBuild"> </Target> --> </Project> I want to build everything that the builtin Deploy project is doing for me. But I don't want the generated web project as it contains App_Web_xxxx.dll assemblies instead of a single compiled assembly. How can I do this?

    Read the article

  • What's the best/most efficent way to create a semi-intelligent AI for a tic tac toe game?

    - by Link
    basically I am attempting to make a a efficient/smallish C game of Tic-Tac-Toe. I have implemented everything other then the AI for the computer so far. my squares are basically structs in an array with an assigned value based on the square. For example s[1].value = 1; therefore it's a x, and then a value of 3 would be a o. My question is whats the best way to create a semi-decent game playing AI for my tic-tac-toe game? I don't really want to use minimax, since It's not what I need. So how do I avoid a a lot of if statments and make it more efficient. Here is the rest of my code: #include <stdio.h> #include <stdlib.h> #include <string.h> #include <time.h> struct state{ // defined int state; // 0 is tie, 1 is user loss, 2 is user win, 3 is ongoing game int moves; }; struct square{ // one square of the board int value; // 1 is x, 3 is o char sign; // no space used }; struct square s[9]; //set up the struct struct state gamestate = {0,0}; //nothing void setUpGame(){ // setup the game int i = 0; for(i = 0; i < 9; i++){ s[i].value = 0; s[i].sign = ' '; } gamestate.moves=0; printf("\nHi user! You're \"x\"! I'm \"o\"! Good Luck :)\n"); } void displayBoard(){// displays the game board printf("\n %c | %c | %c\n", s[6].sign, s[7].sign, s[8].sign); printf("-----------\n"); printf(" %c | %c | %c\n", s[3].sign, s[4].sign, s[5].sign); printf("-----------\n"); printf(" %c | %c | %c\n\n", s[0].sign, s[1].sign, s[2].sign); } void getHumanMove(){ // get move from human int i; while(1){ printf(">>:"); char line[255]; // input the move to play fgets(line, sizeof(line), stdin); while(sscanf(line, "%d", &i) != 1) { //1 match of defined specifier on input line printf("Sorry, that's not a valid move!\n"); fgets(line, sizeof(line), stdin); } if(s[i-1].value != 0){printf("Sorry, That moves already been taken!\n\n");continue;} break; } s[i-1].value = 1; s[i-1].sign = 'x'; gamestate.moves++; } int sum(int x, int y, int z){return(x*y*z);} void getCompMove(){ // get the move from the computer } void checkWinner(){ // check the winner int i; for(i = 6; i < 9; i++){ // check cols if((sum(s[i].value,s[i-3].value,s[i-6].value)) == 8){printf("The Winner is o!\n");gamestate.state=1;} if((sum(s[i].value,s[i-3].value,s[i-6].value)) == 1){printf("The Winner is x!\n");gamestate.state=2;} } for(i = 0; i < 7; i+=3){ // check rows if((sum(s[i].value,s[i+1].value,s[i+2].value)) == 8){printf("The Winner is o!\n");gamestate.state=1;} if((sum(s[i].value,s[i+1].value,s[i+2].value)) == 1){printf("The Winner is x!\n");gamestate.state=2;} } if((sum(s[0].value,s[4].value,s[8].value)) == 8){printf("The Winner is o!\n");gamestate.state=1;} if((sum(s[0].value,s[4].value,s[8].value)) == 1){printf("The Winner is x!\n");gamestate.state=2;} if((sum(s[2].value,s[4].value,s[6].value)) == 8){printf("The Winner is o!\n");gamestate.state=1;} if((sum(s[2].value,s[4].value,s[6].value)) == 1){printf("The Winner is x!\n");gamestate.state=2;} } void playGame(){ // start playing the game gamestate.state = 3; //set-up the gamestate srand(time(NULL)); int temp = (rand()%2) + 1; if(temp == 2){ // if two comp goes first temp = (rand()%2) + 1; if(temp == 2){ s[4].value = 2; s[4].sign = 'o'; gamestate.moves++; }else{ s[2].value = 2; s[2].sign = 'o'; gamestate.moves++; } } displayBoard(); while(gamestate.state == 3){ if(gamestate.moves<10); getHumanMove(); if(gamestate.moves<10); getCompMove(); checkWinner(); if(gamestate.state == 3 && gamestate.moves==9){ printf("The game is a tie :p\n"); break; } displayBoard(); } } int main(int argc, const char *argv[]){ printf("Welcome to Tic Tac Toe\nby The Elite Noob\nEnter 1-9 To play a move, standard numpad\n1 is bottom-left, 9 is top-right\n"); while(1){ // while game is being played printf("\nPress 1 to play a new game, or any other number to exit;\n>>:"); char line[255]; // input whether or not to play the game fgets(line, sizeof(line), stdin); int choice; // user's choice about playing or not while(sscanf(line, "%d", &choice) != 1) { //1 match of defined specifier on input line printf("Sorry, that's not a valid option!\n"); fgets(line, sizeof(line), stdin); } if(choice == 1){ setUpGame(); // set's up the game playGame(); // Play a Game }else {break;} // exit the application } printf("\nThank's For playing!\nHave a good Day!\n"); return 0; }

    Read the article

  • Panel is not displaying in JFrame

    - by mallikarjun
    I created a chat panel and added to Jframe but the panel is not displaying. But my sop in the chat panel are displaying in the console. Any one please let me know what could be the problem My Frame public class MyFrame extends JFrame { MyPanel chatClient; String input; public MyFrame() { input = (String)JOptionPane.showInputDialog(null, "Name:", "Connect to chat server", JOptionPane.QUESTION_MESSAGE, null,null, "Test"); input=input.trim(); chatClient = new MyPanel("localhost",input); setVisible(true); setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); add(chatClient); } public static void main(String...args){ new MyFrame(); } } MyPanel: public class MyPanel extends JPanel{ ChatClient chatClient; public MyPanel(String host, String uid) { chatClient= new ChatClient(host,uid); add(chatClient.getChatPanel()); this.setVisible(true); } } chat panel: public class ChatClient { Client client; String name; ChatPanel chatPanel; String hostid; public ChatClient(String host,String uid){ client = new Client(); client.start(); System.out.println("in constructor"); Network.register(client); client.addListener(new Listener(){ public void connected(Connection connection){ System.out.println("in client connected method"); Network.RegisterName registerName = new Network.RegisterName(); registerName.name=name; client.sendTCP(registerName); } public void received(Connection connection,Object object){ System.out.println("in client received method"); if (object instanceof Network.UpdateNames) { Network.UpdateNames updateNames = (Network.UpdateNames)object; //chatFrame.setNames(updateNames.names); System.out.println("got it message"); return; } if (object instanceof Network.ChatMessage) { Network.ChatMessage chatMessage = (Network.ChatMessage)object; //chatFrame.addMessage(chatMessage.text); System.out.println("send it message"); return; } } }); // end of listner name=uid.trim(); hostid=host.trim(); chatPanel = new ChatPanel(hostid,name); chatPanel.setSendListener(new Runnable(){ public void run(){ Network.ChatMessage chatMessage = new Network.ChatMessage(); chatMessage.chatMessage=chatPanel.getSendText(); client.sendTCP(chatMessage); } }); new Thread("connect"){ public void run(){ try{ client.connect(5000, hostid,Network.port); }catch(IOException e){ e.printStackTrace(); } } }.start(); }//end of constructor static public class ChatPanel extends JPanel{ CardLayout cardLayout; JList messageList,nameList; JTextField sendText; JButton sendButton; JPanel topPanel,bottomPanel,panel; public ChatPanel(String host,String user){ setSize(600, 200); this.setVisible(true); System.out.println("Chat panel "+host+"user: "+user); { panel = new JPanel(new BorderLayout()); { topPanel = new JPanel(new GridLayout(1,2)); panel.add(topPanel); { topPanel.add(new JScrollPane(messageList=new JList())); messageList.setModel(new DefaultListModel()); } { topPanel.add(new JScrollPane(nameList=new JList())); nameList.setModel(new DefaultListModel()); } DefaultListSelectionModel disableSelections = new DefaultListSelectionModel() { public void setSelectionInterval (int index0, int index1) { } }; messageList.setSelectionModel(disableSelections); nameList.setSelectionMode(ListSelectionModel.SINGLE_SELECTION); } { bottomPanel = new JPanel(new GridBagLayout()); panel.add(bottomPanel,BorderLayout.SOUTH); bottomPanel.add(sendText=new JTextField(),new GridBagConstraints(0,0,1,1,1,0,GridBagConstraints.CENTER,GridBagConstraints.BOTH,new Insets(0,0,0,0),0,0)); bottomPanel.add(sendButton=new JButton(),new GridBagConstraints(1,0,1,1,0,0,GridBagConstraints.CENTER,0,new Insets(0,0,0,0),0,0)); } } sendText.addActionListener(new ActionListener(){ public void actionPerformed(ActionEvent e){ sendButton.doClick(); } }); } public void setSendListener (final Runnable listener) { sendButton.addActionListener(new ActionListener() { public void actionPerformed (ActionEvent evt) { if (getSendText().length() == 0) return; listener.run(); sendText.setText(""); sendText.requestFocus(); } }); } public String getSendText () { return sendText.getText().trim(); } public void setNames (final String[] names) { EventQueue.invokeLater(new Runnable(){ public void run(){ DefaultListModel model = (DefaultListModel)nameList.getModel(); model.removeAllElements(); for(String name:names) model.addElement(name); } }); } public void addMessage (final String message) { EventQueue.invokeLater(new Runnable() { public void run () { DefaultListModel model = (DefaultListModel)messageList.getModel(); model.addElement(message); messageList.ensureIndexIsVisible(model.size() - 1); } }); } } public JPanel getChatPanel(){ return chatPanel; } }

    Read the article

  • PROBLEM: PHP strip_tags & multi-dimensional array form parameter

    - by Tunji Gbadamosi
    I'm having problems stripping the tags from the textual inputs retrieved from my form so as to do something with them in checkout.php. The input is stored in a multi-dimensional array. Here's my form: echo '<form name="choose" action="checkout.php" method="post" onsubmit="return validate_second_form(this);">'; echo '<input type="hidden" name="hidden_value" value="'.$no_guests.'" />'; if($no_guests >= 1){ echo '<div class="volunteer">'; echo '<fieldset>'; echo '<legend>Volunteer:</legend>'; echo '<label>Table:</label>'; echo '<select name="volunteer_table">'; foreach($tables as $t){ echo '<option>'.$t.'</option>'; } echo '</select><br><br>'; echo '<label>Seat number:</label>'; echo '<select name="volunteer_seat">'; foreach($seats as $seat){ echo '<option>'.$seat.'</option>'; } echo '</select><br><br>'; //echo '<br>'; echo '</fieldset>'; echo '</div>'; for($i=0;$i<$no_guests;$i++){ $guest = "guest_".$i; echo '<div class="'.$guest.'">'; echo '<fieldset>'; echo '<legend>Guest '.$i.':</legend>'; echo '<label>First Name:</label>'; echo '<input type="text" name="guest['.$i.']['.$first_name.']" id="fn'.$i.'">'; echo '<label>Surname:</label>'; echo '<input type="text" name="guest['.$i.']['.$surname.']" id="surname'.$i.'"><br><br>'; echo '<label>Date of Birth:</label> <br>'; echo '<label>Day:</label>'; echo '<select name="guest['.$i.'][dob_day]">'; for($j=1;$j<32;$j++){ echo"<option value='$j'>$j</option>"; } echo '</select>'; echo '<label>Month:</label>'; echo '<select name="guest['.$i.'][dob_month]">'; for($j=0;$j<sizeof($month);$j++){ $value = ($j + 1); echo"<option value='$value'>$month[$j]</option>"; } echo '</select>'; echo '<label>Year:</label>'; echo '<select name="guest['.$i.'][dob_year]">'; for($j=1900;$j<$year_limit;$j++){ echo"<option value='$j'>$j</option>"; } echo '</select> <br><br>'; echo '<label>Sex:</label>'; echo '<select name="guest['.$i.']['.$sex.']">'; echo '<option>Female</option>'; echo '<option>Male</option>'; echo '</select><br><br>'; echo '<label>Table:</label>'; echo '<select name="guest['.$i.']['.$table.']">'; foreach($tables as $t){ echo '<option>'.$t.'</option>'; } echo '</select><br><br>'; echo '<label>Seat number:</label>'; echo '<select name="guest['.$i.']['.$seat_no.']">'; foreach($seats as $seat){ echo '<option>'.$seat.'</option>'; } echo '</select><br><br>'; //echo '<br>'; echo '</fieldset>'; echo '</div>'; } } else{ echo '<div id="volunteer">'; echo '<fieldset>'; echo '<legend>Volunteer:</legend>'; echo '<label>Table:</label>'; echo '<select name="volunteer['.$table.']">'; foreach($tables as $t){ echo '<option>'.$t.'</option>'; } echo '</select><br><br>'; echo '<label>Seat number:</label>'; echo '<select name="volunteer['.$seat_no.']">'; foreach($seats as $seat){ echo '<option>'.$seat.'</option>'; } echo '</select><br><br>'; //echo '<br>'; echo '</fieldset>'; echo '</div>'; } echo '<input type="submit" value="Submit form">'; echo '</form>'; here's checkout.php: if(isset($_POST['guest'])){ foreach($_POST['guest'] as $guest){ $guest['first_name'] = strip_tags($guest['first_name']); $guest['surname'] = strip_tags($guest['surname']); } //$_SESSION['guest'] = $guests; }

    Read the article

  • Saving a Join Model

    - by Thorpe Obazee
    I've been reading the cookbook for a while now and still don't get how I'm supposed to do this: My original problem was this: A related Model isn't being validated From RabidFire's commment: If you want to count the number of Category models that a new Post is associated with (on save), then you need to do this in the beforeSave function as I've mentioned. As you've currently set up your models, you don't need to use the multiple rule anywhere. If you really, really want to validate against a list of Category IDs for some reason, then create a join model, and validate category_id with the multiple rule there. Now, I have these models and are now validating. The problem now is that data isn't being saved in the Join Table: class Post extends AppModel { var $name = 'Post'; var $hasMany = array( 'CategoryPost' => array( 'className' => 'CategoryPost' ) ); var $belongsTo = array( 'Page' => array( 'className' => 'Page' ) ); class Category extends AppModel { var $name = 'Category'; var $hasMany = array( 'CategoryPost' => array( 'className' => 'CategoryPost' ) ); class CategoryPost extends AppModel { var $name = 'CategoryPost'; var $validate = array( 'category_id' => array( 'rule' => array('multiple', array('in' => array(1, 2, 3, 4))), 'required' => FALSE, 'message' => 'Please select one, two or three options' ) ); var $belongsTo = array( 'Post' => array( 'className' => 'Post' ), 'Category' => array( 'className' => 'Category' ) ); This is the new Form: <div id="content-wrap"> <div id="main"> <h2>Add Post</h2> <?php echo $this->Session->flash();?> <div> <?php echo $this->Form->create('Post'); echo $this->Form->input('Post.title'); echo $this->Form->input('CategoryPost.category_id', array('multiple' => 'checkbox')); echo $this->Form->input('Post.body', array('rows' => '3')); echo $this->Form->input('Page.meta_keywords'); echo $this->Form->input('Page.meta_description'); echo $this->Form->end('Save Post'); ?> </div> <!-- main ends --> </div> The data I am producing from the form is as follows: Array ( [Post] => Array ( [title] => 1234 [body] => 1234 ) [CategoryPost] => Array ( [category_id] => Array ( [0] => 1 [1] => 2 ) ) [Page] => Array ( [meta_keywords] => 1234 [meta_description] => 1234 [title] => 1234 [layout] => index ) ) UPDATE: controller action //Controller action function admin_add() { // pr(Debugger::trace()); $this->set('categories', $this->Post->CategoryPost->Category->find('list')); if ( ! empty($this->data)) { $this->data['Page']['title'] = $this->data['Post']['title']; $this->data['Page']['layout'] = 'index'; debug($this->data); if ($this->Post->saveAll($this->data)) { $this->Session->setFlash('Your post has been saved', 'flash_good'); $this->redirect($this->here); } } } UPDATE #2: Should I just do this manually? The problem is that the join tables doesn't have things saved in it. Is there something I'm missing? UPDATE #3 RabidFire gave me a solution. I already did this before and am quite surprised as so why it didn't work. Thus, me asking here. The reason I think there is something wrong. I don't know where: Post beforeSave: function beforeSave() { if (empty($this->id)) { $this->data[$this->name]['uri'] = $this->getUniqueUrl($this->data[$this->name]['title']); } if (isset($this->data['CategoryPost']['category_id']) && is_array($this->data['CategoryPost']['category_id'])) { echo 'test'; $categoryPosts = array(); foreach ($this->data['CategoryPost']['category_id'] as $categoryId) { $categoryPost = array( 'category_id' => $categoryId ); array_push($categoryPosts, $categoryPost); } $this->data['CategoryPost'] = $categoryPosts; } debug($this->data); // Gives RabidFire's correct array for saving. return true; } My Post action: function admin_add() { // pr(Debugger::trace()); $this->set('categories', $this->Post->CategoryPost->Category->find('list')); if ( ! empty($this->data)) { $this->data['Page']['title'] = $this->data['Post']['title']; $this->data['Page']['layout'] = 'index'; debug($this->data); // First debug is giving the correct array as above. if ($this->Post->saveAll($this->data)) { debug($this->data); // STILL gives the above array. which shouldn't be because of the beforeSave in the Post Model // $this->Session->setFlash('Your post has been saved', 'flash_good'); // $this->redirect($this->here); } } }

    Read the article

  • jQuery getting these functions to work together

    - by brett
    I'm new to jQuery and have tried looking around for an answer on how to do this. I have 2 functions and I would like both to work together. The one function is submitHandler and its used to hide a form and at the same time add a class to a hidden element to unhide it - ie a thank you for submitting h1. The other function is to grab the input data and display it onsubmit in the form. So the problem is that I can get that one to work but then the other doesnt. Ie on form submit I can see the data input but not the h1 Thank you message. Here are the functions: SubmitHandler: submitHandler: function() { $("#content").empty(); $("#content").append( "<p>If you want to be kept in the loop...</p>" + "<p>Or you can contact...</p>" ); $('h1.success_').removeClass('success_').addClass('success_form'); $('#contactform').hide(); }, onsubmit="return inputdata()" function inputdata(){ var usr = document.getElementById('contactname').value; var eml = document.getElementById('email').value; var msg = document.getElementById('message').value; document.getElementById('out').innerHTML = usr + " " + eml + msg; document.getElementById('out').style.display = "block"; return true; }, The form uses PHP and jQuery - I dont know about AJAX but after some reading even less sure. Please help me out I dont know what I'm doing and at the moment I am learning but its a long road for me still. Thank you The form: <form method="post" action="<?php echo $_SERVER['PHP_SELF']; ?>" id="contactform" onsubmit="return inputdata()"> <div class="_required"><p class="label_left">Name*</p><input type="text" size="50" name="contactname" id="contactname" value="" class="required" /></div><br/><br/> <div class="_required"><p class="label_left">E-mail address*</p><input type="text" size="50" name="email" id="email" value="" class="required email" /></div><br/><br/> <p class="label_left">Message</p><textarea rows="5" cols="50" name="message" id="message" class="required"></textarea><br/> <input type="submit" value="submit" name="submit" id="submit" /> </form> The PHP bit: <?php $subject = "Website Contact Form Enquiry"; //If the form is submitted if(isset($_POST['submit'])) { //Check to make sure that the name field is not empty if(trim($_POST['contactname']) == '') { $hasError = true; } else { $name = trim($_POST['contactname']); } //Check to make sure sure that a valid email address is submitted if(trim($_POST['email']) == '') { $hasError = true; } else if (!eregi("^[A-Z0-9._%-]+@[A-Z0-9._%-]+\.[A-Z]{2,4}$", trim($_POST['email']))) { $hasError = true; } else { $email = trim($_POST['email']); } //Check to make sure comments were entered if(trim($_POST['message']) == '') { $hasError = true; } else { if(function_exists('stripslashes')) { $comments = stripslashes(trim($_POST['message'])); } else { $comments = trim($_POST['message']); } } //If there is no error, send the email if(!isset($hasError)) { $emailTo = '[email protected]'; //Put your own email address here $body = "Name: $name \n\nEmail: $email \n\nComments:\n $comments"; $headers = 'From: My Site <'.$emailTo.'>' . "\r\n" . 'Reply-To: ' . $email; mail($emailTo, $subject, $body, $headers); $emailSent = true; } } ? The Jquery Validate bit: $(document).ready(function(){ $('#contactform').validate({ showErrors: function(errorMap, errorList) { //restore the normal look $('#contactform div.xrequired').removeClass('xrequired').addClass('_required'); //stop if everything is ok if (errorList.length == 0) return; //Iterate over the errors for(var i = 0;i < errorList.length; i++) $(errorList[i].element).parent().removeClass('_required').addClass('xrequired'); }, Here is the full jQuery bit: $(document).ready(function(){ $('#contactform').validate({ showErrors: function(errorMap, errorList) { //restore the normal look $('#contactform div.xrequired').removeClass('xrequired').addClass('_required'); //stop if everything is ok if (errorList.length == 0) return; //Iterate over the errors for(var i = 0;i < errorList.length; i++) $(errorList[i].element).parent().removeClass('_required').addClass('xrequired'); }, submitHandler: function() { $('h1.success_').removeClass('success_').addClass('success_form'); $("#content").empty(); $("#content").append('#sadhu'); $('#contactform').hide(); }, }); }); Latest edit - Looks like this: $(document).ready(function(){ $('#contactform').validate({ showErrors: function(errorMap, errorList) { //restore the normal look $('#contactform div.xrequired').removeClass('xrequired').addClass('_required'); //stop if everything is ok if (errorList.length == 0) return; //Iterate over the errors for(var i = 0;i < errorList.length; i++) $(errorList[i].element).parent().removeClass('_required').addClass('xrequired'); }, function submitHandler() { $('h1.success_').removeClass('success_').addClass('success_form'); $("#content").empty(); $("#content").append('#sadhu'); $('#contactform').hide(); }, function inputdata() { var usr = document.getElementById('contactname').value; var eml = document.getElementById('email').value; var msg = document.getElementById('message').value; document.getElementById('out').innerHTML = usr + " " + eml + msg; document.getElementById('out').style.display = "block"; }, $(document).ready(function(){ $('#contactForm').submit(function() { inputdata(); submitHandler(); }); }); });

    Read the article

  • Json / Jsonp not connecting to php (Phonegap + jquerymobile)

    - by Madhulika Mukherjee
    I am trying to make - an android WEB application with phonegap layout with JqueryMobile What Im doing - An html form that takes ID, name, and address as input 'Serialize's this data using ajax makes a json object out of it Should send it to a file called 'connection.php' Where, this data is put into a database (MySql) Other details - My server is localhost, Im using xampp I have already created a database and table using phpmyadmin The problem - My html file, where my json object is created, does not connect to the php file which is hosted by my localhost Here is my COMPLETE html file: <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01//EN" "http://www.w3.org/TR/html4/strict.dtd"> <html> <head> <!-- Change this if you want to allow scaling --> <meta name="viewport" content="width=default-width; user-scalable=no" /> <meta http-equiv="Content-type" content="text/html;charset=utf-8"> <title>Trial app</title> <link rel="stylesheet" href="thestylesheet.css" type="text/css"> <script type="text/javascript" charset="utf-8" src="javascript1.js"></script> <script type="text/javascript" charset="utf-8" src="javascript2.js"></script> <script type="text/javascript" charset="utf-8" src="cordova-1.8.0.js"></script> <script> $(document).ready(function () { $("#btn").click( function() { alert('hello hello'); $.ajax({ url: "connection.php", type: "POST", data: { id: $('#id').val(), name: $('#name').val(), Address: $('#Address').val() }, datatype: "json", success: function (status) { if (status.success == false) { alert("Failure!"); } else { alert("Success!"); } } }); }); }); </script> </head> <body> <div data-role="header"> <h1>Heading of the app</h1> </div><!-- /header --> <div data-role="content"> <form id="target" method="post"> <label for="id"> <input type="text" id="id" placeholder="ID"> </label> <label for="name"> <input type="text" id="name" placeholder="Name"> </label> <label for="Address"> <input type="text" id="Address" placeholder="Address"> </label> <div id="btn" data-role="button" data-icon="star" data-theme="e">Add record</div> <!--<input type="submit" value="Add record" data-icon="star" data-theme="e"> --> </form> </div> </body> </html> And here is my 'connection.php' hosted by my localhost <?php header('Content-type: application/json'); $server = "localhost"; $username = "root"; $password = ""; $database = "jqueryex"; $con = mysql_connect($server, $username, $password); if($con) { echo "Connected to database!"; } else { echo "Could not connect!"; } //or die ("Could not connect: " . mysql_error()); mysql_select_db($database, $con); /* CREATE TABLE `sample` ( `id` int(11) unsigned NOT NULL AUTO_INCREMENT, `name` varchar(45) DEFAULT NULL, `Address` varchar(45) DEFAULT NULL, PRIMARY KEY (`id`) ) */ $id= json_decode($_POST['id']); $name = json_decode($_POST['name']); $Address = json_decode($_POST['Address']); $sql = "INSERT INTO sample (id, name, Address) "; $sql .= "VALUES ($id, '$name', '$Address')"; if (!mysql_query($sql, $con)) { die('Error: ' . mysql_error()); } else { echo "Comment added"; } mysql_close($con); ?> My doubts: No entry is made in my table 'sample' when i view it in phpmyadmin So obviously, i see no success messages either I dont get any errors, not from ajax and neither from the php file. Stuff Im suspecting: Should i be using jsonp instead of json? Im new to this. Is there a problem with my php file? Perhaps I need to include some more javascript files in my html file? I assume this is a very simple problem so please help me out! I think there is just some conceptual error, as i have only just started with jquery, ajax, and json. Thank you.

    Read the article

< Previous Page | 328 329 330 331 332 333 334 335 336 337 338 339  | Next Page >