Search Results

Search found 78757 results on 3151 pages for 'file save dialog'.

Page 35/3151 | < Previous Page | 31 32 33 34 35 36 37 38 39 40 41 42  | Next Page >

  • How to simulate inner join on very large files in java (without running out of memory)

    - by Constantin
    I am trying to simulate SQL joins using java and very large text files (INNER, RIGHT OUTER and LEFT OUTER). The files have already been sorted using an external sort routine. The issue I have is I am trying to find the most efficient way to deal with the INNER join part of the algorithm. Right now I am using two Lists to store the lines that have the same key and iterate through the set of lines in the right file once for every line in the left file (provided the keys still match). In other words, the join key is not unique in each file so would need to account for the Cartesian product situations ... left_01, 1 left_02, 1 right_01, 1 right_02, 1 right_03, 1 left_01 joins to right_01 using key 1 left_01 joins to right_02 using key 1 left_01 joins to right_03 using key 1 left_02 joins to right_01 using key 1 left_02 joins to right_02 using key 1 left_02 joins to right_03 using key 1 My concern is one of memory. I will run out of memory if i use the approach below but still want the inner join part to work fairly quickly. What is the best approach to deal with the INNER join part keeping in mind that these files may potentially be huge public class Joiner { private void join(BufferedReader left, BufferedReader right, BufferedWriter output) throws Throwable { BufferedReader _left = left; BufferedReader _right = right; BufferedWriter _output = output; Record _leftRecord; Record _rightRecord; _leftRecord = read(_left); _rightRecord = read(_right); while( _leftRecord != null && _rightRecord != null ) { if( _leftRecord.getKey() < _rightRecord.getKey() ) { write(_output, _leftRecord, null); _leftRecord = read(_left); } else if( _leftRecord.getKey() > _rightRecord.getKey() ) { write(_output, null, _rightRecord); _rightRecord = read(_right); } else { List<Record> leftList = new ArrayList<Record>(); List<Record> rightList = new ArrayList<Record>(); _leftRecord = readRecords(leftList, _leftRecord, _left); _rightRecord = readRecords(rightList, _rightRecord, _right); for( Record equalKeyLeftRecord : leftList ){ for( Record equalKeyRightRecord : rightList ){ write(_output, equalKeyLeftRecord, equalKeyRightRecord); } } } } if( _leftRecord != null ) { write(_output, _leftRecord, null); _leftRecord = read(_left); while(_leftRecord != null) { write(_output, _leftRecord, null); _leftRecord = read(_left); } } else { if( _rightRecord != null ) { write(_output, null, _rightRecord); _rightRecord = read(_right); while(_rightRecord != null) { write(_output, null, _rightRecord); _rightRecord = read(_right); } } } _left.close(); _right.close(); _output.flush(); _output.close(); } private Record read(BufferedReader reader) throws Throwable { Record record = null; String data = reader.readLine(); if( data != null ) { record = new Record(data.split("\t")); } return record; } private Record readRecords(List<Record> list, Record record, BufferedReader reader) throws Throwable { int key = record.getKey(); list.add(record); record = read(reader); while( record != null && record.getKey() == key) { list.add(record); record = read(reader); } return record; } private void write(BufferedWriter writer, Record left, Record right) throws Throwable { String leftKey = (left == null ? "null" : Integer.toString(left.getKey())); String leftData = (left == null ? "null" : left.getData()); String rightKey = (right == null ? "null" : Integer.toString(right.getKey())); String rightData = (right == null ? "null" : right.getData()); writer.write("[" + leftKey + "][" + leftData + "][" + rightKey + "][" + rightData + "]\n"); } public static void main(String[] args) { try { BufferedReader leftReader = new BufferedReader(new FileReader("LEFT.DAT")); BufferedReader rightReader = new BufferedReader(new FileReader("RIGHT.DAT")); BufferedWriter output = new BufferedWriter(new FileWriter("OUTPUT.DAT")); Joiner joiner = new Joiner(); joiner.join(leftReader, rightReader, output); } catch (Throwable e) { e.printStackTrace(); } } } After applying the ideas from the proposed answer, I changed the loop to this private void join(RandomAccessFile left, RandomAccessFile right, BufferedWriter output) throws Throwable { long _pointer = 0; RandomAccessFile _left = left; RandomAccessFile _right = right; BufferedWriter _output = output; Record _leftRecord; Record _rightRecord; _leftRecord = read(_left); _rightRecord = read(_right); while( _leftRecord != null && _rightRecord != null ) { if( _leftRecord.getKey() < _rightRecord.getKey() ) { write(_output, _leftRecord, null); _leftRecord = read(_left); } else if( _leftRecord.getKey() > _rightRecord.getKey() ) { write(_output, null, _rightRecord); _pointer = _right.getFilePointer(); _rightRecord = read(_right); } else { long _tempPointer = 0; int key = _leftRecord.getKey(); while( _leftRecord != null && _leftRecord.getKey() == key ) { _right.seek(_pointer); _rightRecord = read(_right); while( _rightRecord != null && _rightRecord.getKey() == key ) { write(_output, _leftRecord, _rightRecord ); _tempPointer = _right.getFilePointer(); _rightRecord = read(_right); } _leftRecord = read(_left); } _pointer = _tempPointer; } } if( _leftRecord != null ) { write(_output, _leftRecord, null); _leftRecord = read(_left); while(_leftRecord != null) { write(_output, _leftRecord, null); _leftRecord = read(_left); } } else { if( _rightRecord != null ) { write(_output, null, _rightRecord); _rightRecord = read(_right); while(_rightRecord != null) { write(_output, null, _rightRecord); _rightRecord = read(_right); } } } _left.close(); _right.close(); _output.flush(); _output.close(); } UPDATE While this approach worked, it was terribly slow and so I have modified this to create files as buffers and this works very well. Here is the update ... private long getMaxBufferedLines(File file) throws Throwable { long freeBytes = Runtime.getRuntime().freeMemory() / 2; return (freeBytes / (file.length() / getLineCount(file))); } private void join(File left, File right, File output, JoinType joinType) throws Throwable { BufferedReader leftFile = new BufferedReader(new FileReader(left)); BufferedReader rightFile = new BufferedReader(new FileReader(right)); BufferedWriter outputFile = new BufferedWriter(new FileWriter(output)); long maxBufferedLines = getMaxBufferedLines(right); Record leftRecord; Record rightRecord; leftRecord = read(leftFile); rightRecord = read(rightFile); while( leftRecord != null && rightRecord != null ) { if( leftRecord.getKey().compareTo(rightRecord.getKey()) < 0) { if( joinType == JoinType.LeftOuterJoin || joinType == JoinType.LeftExclusiveJoin || joinType == JoinType.FullExclusiveJoin || joinType == JoinType.FullOuterJoin ) { write(outputFile, leftRecord, null); } leftRecord = read(leftFile); } else if( leftRecord.getKey().compareTo(rightRecord.getKey()) > 0 ) { if( joinType == JoinType.RightOuterJoin || joinType == JoinType.RightExclusiveJoin || joinType == JoinType.FullExclusiveJoin || joinType == JoinType.FullOuterJoin ) { write(outputFile, null, rightRecord); } rightRecord = read(rightFile); } else if( leftRecord.getKey().compareTo(rightRecord.getKey()) == 0 ) { String key = leftRecord.getKey(); List<File> rightRecordFileList = new ArrayList<File>(); List<Record> rightRecordList = new ArrayList<Record>(); rightRecordList.add(rightRecord); rightRecord = consume(key, rightFile, rightRecordList, rightRecordFileList, maxBufferedLines); while( leftRecord != null && leftRecord.getKey().compareTo(key) == 0 ) { processRightRecords(outputFile, leftRecord, rightRecordFileList, rightRecordList, joinType); leftRecord = read(leftFile); } // need a dispose for deleting files in list } else { throw new Exception("DATA IS NOT SORTED"); } } if( leftRecord != null ) { if( joinType == JoinType.LeftOuterJoin || joinType == JoinType.LeftExclusiveJoin || joinType == JoinType.FullExclusiveJoin || joinType == JoinType.FullOuterJoin ) { write(outputFile, leftRecord, null); } leftRecord = read(leftFile); while(leftRecord != null) { if( joinType == JoinType.LeftOuterJoin || joinType == JoinType.LeftExclusiveJoin || joinType == JoinType.FullExclusiveJoin || joinType == JoinType.FullOuterJoin ) { write(outputFile, leftRecord, null); } leftRecord = read(leftFile); } } else { if( rightRecord != null ) { if( joinType == JoinType.RightOuterJoin || joinType == JoinType.RightExclusiveJoin || joinType == JoinType.FullExclusiveJoin || joinType == JoinType.FullOuterJoin ) { write(outputFile, null, rightRecord); } rightRecord = read(rightFile); while(rightRecord != null) { if( joinType == JoinType.RightOuterJoin || joinType == JoinType.RightExclusiveJoin || joinType == JoinType.FullExclusiveJoin || joinType == JoinType.FullOuterJoin ) { write(outputFile, null, rightRecord); } rightRecord = read(rightFile); } } } leftFile.close(); rightFile.close(); outputFile.flush(); outputFile.close(); } public void processRightRecords(BufferedWriter outputFile, Record leftRecord, List<File> rightFiles, List<Record> rightRecords, JoinType joinType) throws Throwable { for(File rightFile : rightFiles) { BufferedReader rightReader = new BufferedReader(new FileReader(rightFile)); Record rightRecord = read(rightReader); while(rightRecord != null){ if( joinType == JoinType.LeftOuterJoin || joinType == JoinType.RightOuterJoin || joinType == JoinType.FullOuterJoin || joinType == JoinType.InnerJoin ) { write(outputFile, leftRecord, rightRecord); } rightRecord = read(rightReader); } rightReader.close(); } for(Record rightRecord : rightRecords) { if( joinType == JoinType.LeftOuterJoin || joinType == JoinType.RightOuterJoin || joinType == JoinType.FullOuterJoin || joinType == JoinType.InnerJoin ) { write(outputFile, leftRecord, rightRecord); } } } /** * consume all records having key (either to a single list or multiple files) each file will * store a buffer full of data. The right record returned represents the outside flow (key is * already positioned to next one or null) so we can't use this record in below while loop or * within this block in general when comparing current key. The trick is to keep consuming * from a List. When it becomes empty, re-fill it from the next file until all files have * been consumed (and the last node in the list is read). The next outside iteration will be * ready to be processed (either it will be null or it points to the next biggest key * @throws Throwable * */ private Record consume(String key, BufferedReader reader, List<Record> records, List<File> files, long bufferMaxRecordLines ) throws Throwable { boolean processComplete = false; Record record = records.get(records.size() - 1); while(!processComplete){ long recordCount = records.size(); if( record.getKey().compareTo(key) == 0 ){ record = read(reader); while( record != null && record.getKey().compareTo(key) == 0 && recordCount < bufferMaxRecordLines ) { records.add(record); recordCount++; record = read(reader); } } processComplete = true; // if record is null, we are done if( record != null ) { // if the key has changed, we are done if( record.getKey().compareTo(key) == 0 ) { // Same key means we have exhausted the buffer. // Dump entire buffer into a file. The list of file // pointers will keep track of the files ... processComplete = false; dumpBufferToFile(records, files); records.clear(); records.add(record); } } } return record; } /** * Dump all records in List of Record objects to a file. Then, add that * file to List of File objects * * NEED TO PLACE A LIMIT ON NUMBER OF FILE POINTERS (check size of file list) * * @param records * @param files * @throws Throwable */ private void dumpBufferToFile(List<Record> records, List<File> files) throws Throwable { String prefix = "joiner_" + files.size() + 1; String suffix = ".dat"; File file = File.createTempFile(prefix, suffix, new File("cache")); BufferedWriter writer = new BufferedWriter(new FileWriter(file)); for( Record record : records ) { writer.write( record.dump() ); } files.add(file); writer.flush(); writer.close(); }

    Read the article

  • Flash AS3 load file xml

    - by Elias
    Hello, I'm just trying to load an xml file witch can be anywere in the hdd, this is what I have done to browse it, but later when I'm trying to load the file it would only look in the same path of the swf file here is the code package { import flash.display.Sprite; import flash.events.; import flash.net.; public class cargadorXML extends Sprite { public var cuadro:Sprite = new Sprite(); public var file:FileReference; public var req:URLRequest; public var xml:XML; public var xmlLoader:URLLoader = new URLLoader(); public function cargadorXML() { cuadro.graphics.beginFill(0xFF0000); cuadro.graphics.drawRoundRect(0,0,100,100,10); cuadro.graphics.endFill(); cuadro.addEventListener(MouseEvent.CLICK,browser); addChild(cuadro); } public function browser(e:Event) { file = new FileReference(); file.addEventListener(Event.SELECT,bien); file.browse(); } public function bien(e:Event) { xmlLoader.addEventListener(Event.COMPLETE, loadXML); req=new URLRequest(file.name); xmlLoader.load(req); } public function loadXML(e:Event) { xml=new XML(e.target.data); //xml.name=file.name; trace(xml); } } } when I open a xml file that isnt it the same directory as the swf, it gives me an unfound file error. is there anything I can do? cause for example for mp3 there is an especial class for loading the file, see http://www.flexiblefactory.co.uk/flexible/?p=46 thanks

    Read the article

  • How to submit the form using JQuery UI?

    - by Vafello
    I have a form in html with a default submit button. After the form is submitted, a php file is run (with action = homelocation). I decided to use JQuery UI dialog to display the form. I have 2 default buttons there - one to save and one to close the dialog. Can anyone tell me how to assign the form submit button action to the JQuery dialog button(i.e. replace the submit button from the form with the one in the dialog)? Here's my code: <div id="userdialog" title="Add"> <form id="add" action="engine.php" method="POST"> <input type="hidden" name="action" value="homelocation" id="action"> <button type="submit">Save this location</button> </form></div> Dialog: $('#userdialog').dialog({ width: 260, position: [250,100], buttons: { "Save": function() { HERE GOES THE REQUIRED FUNCTION $(this).dialog('close'); }, "Don't Save": function() { $(this).dialog("close"); } } });

    Read the article

  • alternative to JQuery form.submit() to do ajax post

    - by BluntTool
    Hello, I have a mvc2 application with a view like this <% using (Ajax.BeginForm("UserApprove", new { id = Model.id }, new AjaxOptions() { UpdateTargetId = "statusLights", OnSuccess = "HideButtons" }, new { id = "UserApprove" })) {%> <input type="button" value="Approve" onclick="$('#dialogApprove').dialog('open')" /> <div id="dialogApprove" title="Confirm"> <p> Are you sure you want to approve this request? </p> </div> <% } %> FYI, the controller returns a partial view back. I used to not have the jquery dialog and just simple a <input type="Submit" value="Approve" /> that used to work fine I added the jquery dialog and I have something like this to initialize the dialog. $("#dialogApprove").dialog({ autoOpen: false, draggable: true, resizable: false, buttons: { "Cancel": function() { $(this).dialog("close") }, "Approve": function() { $("#UserApprove").submit(); $(this).dialog("close"); } } }); The $("#UserApprove").submit(); does not seem to be doing an ajax post. It comes back with just the text from the partial view returned in a new page. I dont want to use the jquery form plugin which has .ajaxSubmit(). Is there any other way to force an ajax post from the jquery dialog "approve" button?

    Read the article

  • Unable to access Java-created file -- sometimes

    - by BlairHippo
    In Java, I'm working with code running under WinXP that creates a file like this: public synchronized void store(Properties props, byte[] data) { try { File file = filenameBasedOnProperties(props); if ( file.exists() ) { return; } File temp = File.createTempFile("tempfile", null); FileOutputStream out = new FileOutputStream(temp); out.write(data); out.flush(); out.close(); file.getParentFile().mkdirs(); temp.renameTo(file); } catch (IOException ex) { // Complain and whine and stuff } } Sometimes, when a file is created this way, it's just about totally inaccessible from outside the code (though the code responsible for opening and reading the file has no problem), even when the application isn't running. When accessed via Windows Explorer, I can't move, rename, delete, or even open the file. Under Cygwin, I get the following when I ls -l the directory: ls: cannot access [big-honkin-filename] total 0 ?????????? ? ? ? ? ? [big-honkin-filename] As implied, the filenames are big, but under the 260-character max for XP (though they are slightly over 200 characters). To further add to the sense the my computer just wants me to feel stupid, sometimes the files created by this code are perfectly normal. The only pattern I've spotted is that once one file in the directory "locks", the rest are screwed. Anybody ever run into something like this before, or have any insights into what's going on here?

    Read the article

  • MFC (C++) CDialog DoModal() not working as expected

    - by krebstar
    Hi, I have a plugin that is loaded by this application.. This plugin calls some dialog boxes with DoModal(). I'm expecting these dialog boxes to function like this: If I click on the application window behind the dialog box, the dialog box flashes and does not allow the application to be in focus. However, in one of the other dialog boxes, called with DoModal(), if I click on the application window, it doesn't do the flashing thing, and after a while the application's close/minimize buttons become active (well, just the color). They're not really active and the window turns somewhat white and the title bar says (Not Responding)... What could possibly be wrong and how do I fix it? I've tried setting the dialog box's properties to System Modal: True, and Set Foreground: True but it doesn't seem to work.. :( Thanks.. EDIT: I'd like to note that the in the Windows taskbar, there is only one entry for the application for the correct behavior, but when the dialog box with the incorrect behavior is launched, another "window" is launched.. So it looks like (Application)(Dialog box title).. The effect I'm trying to achieve is just (Application)..

    Read the article

  • Modifying File while in use using Java

    - by Marquinio
    Hi all, I have this recurrent Java JAR program tasks that tries to modify a file every 60seconds. Problem is that if user is viewing the file than Java program will not be able to modify the file. I get the typical IOException. Anyone knows if there is a way in Java to modify a file currently in use? Or anyone knows what would be the best way to solve this problem? I was thinking of using the File canRead(), canWrite() methods to check if file is in use. If file is in use then I'm thinking of making a backup copy of data that could not be written. Then after 60 seconds add some logic to check if backup file is empty or not. If backup file is not empty then add its contents to main file. If empty then just add new data to main file. Of course, the first thing I will always do is check if file is in use. Thanks for all your ideas.

    Read the article

  • How to compare two file structures in PHP?

    - by OM The Eternity
    I have a function which gives me the complete file structure upto n-level, function getDirectory($path = '.', $ignore = '') { $dirTree = array (); $dirTreeTemp = array (); $ignore[] = '.'; $ignore[] = '..'; $dh = @opendir($path); while (false !== ($file = readdir($dh))) { if (!in_array($file, $ignore)) { if (!is_dir("$path/$file")) { //display of file and directory name with their modification time $stat = stat("$path/$file"); $statdir = stat("$path"); $dirTree["$path"][] = $file. " === ". date('Y-m-d H:i:s', $stat['mtime']) . " Directory == ".$path."===". date('Y-m-d H:i:s', $statdir['mtime']) ; } else { $dirTreeTemp = getDirectory("$path/$file", $ignore); if (is_array($dirTreeTemp))$dirTree = array_merge($dirTree, $dirTreeTemp); } } } closedir($dh); return $dirTree; } $ignore = array('.htaccess', 'error_log', 'cgi-bin', 'php.ini', '.ftpquota'); //function call $dirTree = getDirectory('.', $ignore); //file structure array print print_r($dirTree); Now here my requirement is , I have two sites The Development/Test Site- where i do testing of all the changes The Production Site- where I finally post all the changes as per test in development site Now, for example, I have tested an image upload in the Development/test site, and i found it appropriate to publish on Production site then i will completely transfer the Development/Test DB detail to Production DB, but now I want to compare the files structure as well to transfer the corresponding image file to Production folder. There could be the situation when I update the image by editing the image and upload it with same name, now in this case the image file would be already present there, which will restrict the use of "file_exist" logic, so for these type of situations....HOW CAN I COMPARE THE TWO FILE STRUCTURE TO GET THE SYNCHRONIZATION DONE AS PER REQUIREMENT??

    Read the article

  • Jquery hide is not working in my Dialog box close span

    - by kumar
    $('.ui-dialog-titlebar-close ui-corner-all').hide(); this is the hide for my Jquery dialog close 'X' span.. this is not working in my case. I am trying to hide that Close becuase its not showing me in my dialog when I resize my dialog then its showing me.. some reason my CSS not showing me that Close button correctly on my POPUP. Can any body help me out. here is my code and CSS. $("#window").dialog({ resizable: true, height: 180, title: titles, width: 500, modal: true, open: function () { $('.ui-widget-overlay').show(); $('.ui-dialog-titlebar-close ui-corner-all').hide(); }, buttons: { "OK": function () { $(this).dialog("close"); if (redirectURL) { window.location = redirectURL; } } } }); here is my CSS. <style> .ui-widget-overlay { background: black; opacity: 0.5; filter: alpha(opacity = 50); position: absolute; top: 0; left: 10; } </style> Can any body tell me how to show My Close 'X' correctly on my dialog or I need to hide that Close 'X' thanks

    Read the article

  • File mkdirs() method not working in android/java

    - by Leif Andersen
    I've been pulling out my hair on this for a while now. The following method is supposed to download a file, and save it to the location specified on the hard drive. private static void saveImage(Context context, boolean backgroundUpdate, URL url, File file) { if (!Tools.checkNetworkState(context, backgroundUpdate)) return; // Get the image try { // Make the file file.getParentFile().mkdirs(); // Set up the connection URLConnection uCon = url.openConnection(); InputStream is = uCon.getInputStream(); BufferedInputStream bis = new BufferedInputStream(is); // Download the data ByteArrayBuffer baf = new ByteArrayBuffer(50); int current = 0; while ((current = bis.read()) != -1) { baf.append((byte) current); } // Write the bits to the file OutputStream os = new FileOutputStream(file); os.write(baf.toByteArray()); os.close(); } catch (Exception e) { // Any exception is probably a newtork faiilure, bail return; } } Also, if the file doesn't exist, it is supposed to make the directory for the file. (And if there is another file already in that spot, it should just not do anything). However, for some reason, the mkdirs() method never makes the directory. I've tried everything from explicit parentheses, to explicitly making the parent file class, and nothing seems to work. I'm fairly certain that the drive is writable, as it's only called after that has already been determined, also that is true after running through it while debugging. So the method fails because the parent directories aren't made. Can anyone tell me if there is anything wrong with the way I'm calling it? Also, if it helps, here is the source for the file I'm calling it in: https://github.com/LeifAndersen/NetCatch/blob/master/src/net/leifandersen/mobile/android/netcatch/services/RSSService.java Thank you

    Read the article

  • jQueryUI dialog width

    - by user35295
    Fiddle Full Screen Example I use jQuery dialog to open tables. Some of them have a large amount of text and they tend to be too long and go way off the screen. How can I make the dialog wider if the table is too long like the first one in the fiddle? I've tried width:'auto' but it seems to just occupy the entire screen. HTML: <button class='label'>Click</button><div class='dialog'><p><table>.....</table></div> <button class='label'>Click</button><div class='dialog'><p><table>.....</table></div> Javascript: $(document).ready(function(){ $('.label').each(function() { var dialogopen = $(this).next(".dialog"); dialogopen.dialog({width:'auto',autoOpen: false,modal: true, open: function(){ jQuery('.ui-widget-overlay').bind('click',function(){ dialogopen.dialog('close'); }) } }); $(this).click(function(){ dialogopen.dialog('open'); return false; } ); }); });

    Read the article

  • displaying a dialog using an activity?

    - by ricardo123
    what am i doing wrong here or what do i need to add? package dialog.com; import android.app.Activity; import android.app.AlertDialog; import android.content.DialogInterface; import android.app.Dialog; import android.os.Bundle; import android.view.View; import android.widget.Button; import android.widget.Toast; public class Dialog extends Activity { CharSequence [] items = { "google", "apple", "microsoft" }; boolean [] itemschecked = new boolean [items.length]; /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); Button btn = (Button) findViewById(R.id.btn_dialog); btn.setOnClickListener(new View.OnClickListener() { public void onClick(View v) { showDialog(0); } }); } @Override protected Dialog onCreateDialog(int id) { switch(id) { case 0: return new AlertDialog.Builder(this) .setIcon(R.drawable.icon) .setTitle("This is a Dialog with some simple text...") .setPositiveButton("ok", new DialogInterface.OnClickListener() { public void onClick(DialogInterface dialog, int whichbutton) { Toast.makeText(getBaseContext(), "OK Clicked!", Toast.LENGTH_SHORT).show(); } }); .setNegativeButton("cancel",new DialogInterface.OnclickListener() { public void onClick(DialogInterface dialog, int whichButton) {Toast.makeText(getBaseContext(), "cancel clicked!", Toast.LENGTH_SHORT).show(); } }); .setMultiChoiceItems(itemschecked, new DialogInterface.OnMultiChoiceClickListener() { @Override public void onClick(dialoginterface dialog, int which, boolean isChecked) { Toast.makeText(getBaseContext(), items[which] + (isChecked ? " checked!": "unchecked!"), Toast.LENGTH_SHORT).show(); } } ) .create(); } return null: }}}

    Read the article

  • Macro To Choose "Don't Save" on pop-up window (Mac OS X)

    - by MxmastaMills
    I was wondering if there is a keyboard shortcut to choose "Don't Save" when an alert comes up. I'm talking specifically about Photoshop but the same action happens in many applications. It's the standard pop up that shows when you are canceling out of a window and haven't saved the document or project. To be clear it says "Don't Save", "Cancel" and "Save". Save is generally the default but I was just curious if there's a way to choose "Don't Save" without clicking. I know this may be a pretty simple question but I was curious about it and it's surprisingly hard to Google... Thanks!

    Read the article

  • Office 2011 Mac - Unable to save Word files, plus normal.dot alert errors

    - by Jeff D
    There are actually 3 errors here. When I open Word, I get: Word cannot open the existing global template. () If I create a file, type a character and try to save to the desktop (that I have no problems writing to otherwise), I get: Word cannot save or create this file. The disk may be full or write-protected. Try one or more of the following: * Free more memory * Make sure that the disk you want to save the file on is not full, write-protected, or damaged. () I am just saving to the desktop, and I can save excel files (or anything else) there. After the failure, if I save again, the default file name becomes: .doc...doc Weird. Finally, when I close word completely, I get: Do you want to replace the existing Normal.dotm.

    Read the article

  • Unset the system immutable bit in Mac OS X

    - by skylarking
    In theory I believe you can unlock and remove the system immutable bit with: chflags noschg /Path/To/File But how can you do this when you've set the bit as root? I have a file that is locked, and even running this command as root will not work as the operation is not permitted. I tried logging in as Single-User mode to no avail. I seem to remember that even though you are in as root you are in at level '1'. And to be able to remove the system-immutable flag you need to be logged in at level '0'. Does this have something to do with this issue?

    Read the article

  • Reliable file copy (move) process - mostly Unix/Linux

    - by mfinni
    Short story : We have a need for a rock-solid reliable file mover process. We have source directories that are often being written to that we need to move files from. The files come in pairs - a big binary, and a small XML index. We get a CTL file that defines these file bundles. There is a process that operates on the files once they are in the destination directory; that gets rid of them when it's done. Would rsync do the best job, or do we need to get more complex? Long story as follows : We have multiple sources to pull from : one set of directories are on a Windows machine (that does have Cygwin and an SSH daemon), and a whole pile of directories are on a set of SFTP servers (Most of these are also Windows.) Our destinations are a list of directories on AIX servers. We used to use a very reliable Perl script on the Windows/Cygwin machine when it was our only source. However, we're working on getting rid of that machine, and there are other sources now, the SFTP servers, that we cannot presently run our own scripts on. For security reasons, we can't run the copy jobs on our AIX servers - they have no access to the source servers. We currently have a homegrown Java program on a Linux machine that uses SFTP to pull from the various new SFTP source directories, copies to a local tmp directory, verifies that everything is present, then copies that to the AIX machines, and then deletes the files from the source. However, we're finding any number of bugs or poorly-handled error checking. None of us are Java experts, so fixing/improving this may be difficult. Concerns for us are: With a remote source (SFTP), will rsync leave alone any file still being written? Some of these files are large. From reading the docs, it seems like rysnc will be very good about not removing the source until the destination is reliably written. Does anyone have experience confirming or disproving this? Additional info We will be concerned about the ingestion process that operates on the files once they are in the destination directory. We don't want it operating on files while we are in the process of copying them; it waits until the small XML index file is present. Our current copy job are supposed to copy the XML file last. Sometimes the network has problems, sometimes the SFTP source servers crap out on us. Sometimes we typo the config files and a destination directory doesn't exist. We never want to lose a file due to this sort of error. We need good logs If you were presented with this, would you just script up some rsync? Or would you build or buy a tool, and if so, what would it be (or what technologies would it use?) I (and others on my team) are decent with Perl.

    Read the article

  • Testing for Auto Save and Load Game

    - by David Dimalanta
    I'm trying to make a simple app that will test the save and load state. Is it a good idea to make an app that has an auto save and load game every time the newbies open the first app then continues it on the other day? I'm trying to make a simple app with a simple moving block sprite, starting at the center coordinate. Once I moved the sprite to the top by touch n' drag, I touch the back key to close the app. I expected that once I re-open the app and the block sprite is still at the top. But instead, it goes back to the center instead. Where can I find more ways to use the preferences or manipulating by telling the dispose method to dispose only specific wastes but not the important records (fastest time, last time where the sprite is located via coordinates, etc.). Is there really an easy way or it has no shortcuts but most effective way? I need help to expand more ideas. Thank you. Here are the following links that I'm trying to figure it out how to use them: http://www.youtube.com/watch?v=gER5GGQYzGc http://www.badlogicgames.com/wordpress/?p=1585 http://www.youtube.com/watch?v=t0PtLexfBCA&feature=relmfu Take note that these links above are codes. But I'm not looking answers for code but to look how to start or figure it out how to use them. Tell me if I'm wrong.

    Read the article

  • Database Developers Can Now Save 20%

    - by stephen.garth
    Database developers can now increase productivity and save money at the same time. For a limited time, Oracle Store is offering a 20% discount on Oracle SQL Developer Data Modeler. Just enter the code SQLDDM at checkout to get the discount. Oracle SQL Developer Data Modeler is an independent, standalone product with a full spectrum of data and database modeling tools and utilities, including modeling for Entity Relationship Diagrams (ERD), Relational (database design), Data Type and Multi-dimensional modeling, full forward and reverse engineering and DDL code generation. SQL Developer Data Modeler can connect to any supported Oracle Database and is platform independent. Save 20% on Oracle SQL Developer Data Modeler at Oracle Store - Discount Code SQLDDM Find out more about Oracle SQL Developer and Oracle SQL Developer Data Modeler var gaJsHost = (("https:" == document.location.protocol) ? "https://ssl." : "http://www."); document.write(unescape("%3Cscript src='" + gaJsHost + "google-analytics.com/ga.js' type='text/javascript'%3E%3C/script%3E")); try { var pageTracker = _gat._getTracker("UA-13185312-1"); pageTracker._trackPageview(); } catch(err) {}

    Read the article

  • What methods should save/load a game state

    - by vedi
    There are a lot of articles about how to save a state of a game and they are pretty good. But I have one conceptual misunderstanding where should I save the state? My game has number of screens and pair of them are MainMenuScreen and MainSceneScreen these are inherited from Screen class. MainMenuScreen is shown at start of the game the MainSceneScreen little later. What is the problem? I navigated to MainSceneScreen, forced Android to stop the application (I change a language settings on the device to achieve it, please let me know if I'm wrong). After that I select the application again and I can see MainMenuScreen is shown. But I want MainSceneScreen to be shown. I suppose I should override resume method. But what class I should override? I have class PsGame that extends Game class of libgdx. I put breakpoints to its resume method and it turned out that method was not called. I investigated the problem and I've found little strange code in onResume method of AndroidApplication class of libgdx: if (!firstResume) graphics.resume(); else firstResume = false; My debugger said firstResume was true and didn't go to *graphics.resume()*line. Sorry for a lot of words but could you answer following question: What did I do wrong? What methods should I override? Thank you in advance.

    Read the article

  • help download and install and save and use my wireless stick modem and software

    - by ADAM
    i installed Linux Ubuntu after my win os went totally dead by fatal blue screen. cannot reboot or install form CD ROM or get safe mode i installed Linux Ubuntu i still unable to install my wireless stick usb modem to connect and surf the Internet wireless form my provider. i use wireless network from neighborhood And i find it difficult to download and install and save porg and application from the INTERNET like skype and real player and others. it is different form windows and not that easy to use. i click to download for example and find real player but when click on it it opens as text file only and i cannot use it as it should be used for video and download and record from you tube. how to do it. and is there with Linux Ubuntu similar prog to download and record and save from you tube as in windows? Is there any trick to restart or reboot windows OS from the dead. can i use linux to reboot windows or to import my files from the blue screen stopped windows7? Any help is highly appreciated. thanks please email me to : [email protected]

    Read the article

  • Ubuntu 12.04 Network Manager: unable to save manual setting to set up a static ip

    - by Andy
    I am fairly familiar with setting up servers, and ubuntu is generally my flavor of choice, but I just installed 12.04 desktop and I am seeing some behavior in network manager that is really puzzling. The network connection works fine if I leave it set on dhcp, but I would like a static IP address for my new web server. When I go into network manager and edit the connection for the one and only NIC I can select MANUAL from the dropdown menu but as soon as I do the Save button becomes greyed out. Even after filling out all fields for the connection it is still grey and I am unable to save the static IP connection information. Any thoughts would be greatly appreciated. I'm hoping there is just some new setting that I am unaware of.... On another note, if I stop the network manager and go edit the interfaces file (and the appropriate hosts/routes/dns files), I do get a static ip address assigned and I can contact my server from the outside, however, the server cannot find the internet. Can't ping even its own ip... I can ping the loopback interface though. I'm really confused on this one. Hoping someone can offer some help.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

< Previous Page | 31 32 33 34 35 36 37 38 39 40 41 42  | Next Page >