Search Results

Search found 35200 results on 1408 pages for 'c string'.

Page 367/1408 | < Previous Page | 363 364 365 366 367 368 369 370 371 372 373 374  | Next Page >

  • Code Contracts with Interfaces: "Method Invocation skipped. Compiler will generate method invocation

    - by Jörg Battermann
    Good evening, I just started playing with Microsoft.Contracts (latest version) and plugging it on top of a sample interface and right now it looks like this: namespace iRMA2.Core.Interfaces { using System; using System.Collections.Generic; using System.ComponentModel.Composition; using System.Diagnostics.Contracts; /// <summary> /// Base Interface declarations for iRMA2 Extensions /// </summary> [InheritedExport] [ContractClass(typeof(IiRMA2ExtensionContract))] public interface IiRMA2Extension { /// <summary> /// Gets the name. /// </summary> /// <value>The name of the Extension.</value> string Name { get; } /// <summary> /// Gets the description. /// </summary> /// <value>The description.</value> string Description { get; } /// <summary> /// Gets the author of the extension. Please provide complete information to get in touch with author(s) and the corresponding department /// </summary> /// <value>The author of the extensions.</value> string Author { get; } /// <summary> /// Gets the major version. /// </summary> /// <value>The major version of the extension.</value> int MajorVersion { get; } /// <summary> /// Gets the minor version. /// </summary> /// <value>The minor version.</value> int MinorVersion { get; } /// <summary> /// Gets the build number. /// </summary> /// <value>The build number.</value> int BuildNumber { get; } /// <summary> /// Gets the revision. /// </summary> /// <value>The revision.</value> int Revision { get; } /// <summary> /// Gets the depends on. /// </summary> /// <value>The dependencies to other <c>IiRMA2Extension</c> this one has.</value> IList<IiRMA2Extension> DependsOn { get; } } /// <summary> /// Contract class for <c>IiRMA2Extension</c> /// </summary> [ContractClassFor(typeof(IiRMA2Extension))] internal sealed class IiRMA2ExtensionContract : IiRMA2Extension { #region Implementation of IiRMA2Extension /// <summary> /// Gets or sets the name. /// </summary> /// <value>The name of the Extension.</value> public string Name { get { Contract.Ensures(!String.IsNullOrEmpty(Contract.Result<string>())); return default(string); } set { Contract.Requires(value != null); } } /// <summary> /// Gets the description. /// </summary> /// <value>The description.</value> public string Description { get { throw new NotImplementedException(); } } /// <summary> /// Gets the author of the extension. Please provide complete information to get in touch with author(s) and the corresponding department /// </summary> /// <value>The author of the extensions.</value> public string Author { get { throw new NotImplementedException(); } } /// <summary> /// Gets the major version. /// </summary> /// <value>The major version of the extension.</value> public int MajorVersion { get { throw new NotImplementedException(); } } /// <summary> /// Gets the minor version. /// </summary> /// <value>The minor version.</value> public int MinorVersion { get { throw new NotImplementedException(); } } /// <summary> /// Gets the build number. /// </summary> /// <value>The build number.</value> public int BuildNumber { get { throw new NotImplementedException(); } } /// <summary> /// Gets the revision. /// </summary> /// <value>The revision.</value> public int Revision { get { throw new NotImplementedException(); } } /// <summary> /// Gets the Extensions this one depends on. /// </summary> /// <value>The dependencies to other <c>IiRMA2Extension</c> this one has.</value> public IList<IiRMA2Extension> DependsOn { get { Contract.Ensures(Contract.Result<IList<IiRMA2Extension>>() != null); return default(IList<IiRMA2Extension>); } } #endregion } } Now why are the two Contract.Ensures(...) 'blured' out visually with the tooltip saying "Method Invocation skipped. Compiler will generate method invocation because the method is conditional or it is partial method without implementation" and in fact the CodeContracts output does not count/show them... What am I missing & doing wrong here? -J

    Read the article

  • Having trouble binding a ksoap object to an ArrayList in Android

    - by Maskau
    I'm working on an app that calls a web service, then the webservice returns an array list. My problem is I am having trouble getting the data into the ArrayList and then displaying in a ListView. Any ideas what I am doing wrong? I know for a fact the web service returns an ArrayList. Everything seems to be working fine, just no data in the ListView or the ArrayList.....Thanks in advance! EDIT: So I added more code to the catch block of run() and now it's returning "org.ksoap2.serialization.SoapObject".....no more no less....and I am even more confused now... package com.maskau; import java.util.ArrayList; import org.ksoap2.SoapEnvelope; import org.ksoap2.serialization.PropertyInfo; import org.ksoap2.serialization.SoapObject; import org.ksoap2.serialization.SoapSerializationEnvelope; import org.ksoap2.transport.AndroidHttpTransport; import android.app.*; import android.os.*; import android.widget.ArrayAdapter; import android.widget.Button; import android.widget.EditText; import android.widget.ListView; import android.widget.TextView; import android.view.View; import android.view.View.OnClickListener; public class Home extends Activity implements Runnable{ /** Called when the activity is first created. */ public static final String SOAP_ACTION = "http://bb.mcrcog.com/GetArtist"; public static final String METHOD_NAME = "GetArtist"; public static final String NAMESPACE = "http://bb.mcrcog.com"; public static final String URL = "http://bb.mcrcog.com/karaoke/service.asmx"; String wt; public static ProgressDialog pd; TextView text1; ListView lv; static EditText myEditText; static Button but; private ArrayList<String> Artist_Result = new ArrayList<String>(); @Override public void onCreate(Bundle icicle) { super.onCreate(icicle); setContentView(R.layout.main); myEditText = (EditText)findViewById(R.id.myEditText); text1 = (TextView)findViewById(R.id.text1); lv = (ListView)findViewById(R.id.lv); but = (Button)findViewById(R.id.but); but.setOnClickListener(new OnClickListener() { @Override public void onClick(View v) { wt = ("Searching for " + myEditText.getText().toString()); text1.setText(""); pd = ProgressDialog.show(Home.this, "Working...", wt , true, false); Thread thread = new Thread(Home.this); thread.start(); } } ); } public void run() { try { SoapObject request = new SoapObject(NAMESPACE, METHOD_NAME); PropertyInfo pi = new PropertyInfo(); pi.setName("ArtistQuery"); pi.setValue(Home.myEditText.getText().toString()); request.addProperty(pi); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope(SoapEnvelope.VER11); envelope.dotNet = true; envelope.setOutputSoapObject(request); AndroidHttpTransport at = new AndroidHttpTransport(URL); at.call(SOAP_ACTION, envelope); java.util.Vector<Object> rs = (java.util.Vector<Object>)envelope.getResponse(); if (rs != null) { for (Object cs : rs) { Artist_Result.add(cs.toString()); } } } catch (Exception e) { // Added this line, throws "org.ksoap2.serialization.SoapObject" when run Artist_Result.add(e.getMessage()); } handler.sendEmptyMessage(0); } private Handler handler = new Handler() { @Override public void handleMessage(Message msg) { ArrayAdapter<String> aa; aa = new ArrayAdapter<String>(Home.this, android.R.layout.simple_list_item_1, Artist_Result); lv.setAdapter(aa); try { if (Artist_Result.isEmpty()) { text1.setText("No Results"); } else { text1.setText("Complete"); myEditText.setText("Search Artist"); } } catch(Exception e) { text1.setText(e.getMessage()); } aa.notifyDataSetChanged(); pd.dismiss(); } }; }

    Read the article

  • From AutoComplete textbox to database search and display?

    - by svebee
    Hello everyone, I have a small problem so I would be grateful if anyone could help me in any way. Thank you ;) I have this little "application", and I want when someone type in a AutoComplete textbox for example "New" it automatically displays "New York" as a option and that (AutoComplete function) works fine. But I want when user type in full location (or AutoComplete do it for him) - that text (location) input is forwarded to a database search which then searches through database and "collects" all rows with user-typed location. For example if user typed in "New York", database search would find all rows with "New York" in it. When it finds one/more row(s) it would display them below. In images... I have this when user is typing... http://www.imagesforme.com/show.php/1093305_SNAG0000.jpg I have this when user choose a AutoComplete location (h)ttp://www.imagesforme.com/show.php/1093306_SNAG0001.jpg (remove () on the beggining) But I wanna this when user choose a AutoComplete location (h)ttp://www.imagesforme.com/show.php/1093307_CopyofSNAG0001.jpg (remove () on the beggining) Complete Code package com.svebee.prijevoz; import android.app.Activity; import android.database.Cursor; import android.database.sqlite.SQLiteDatabase; import android.os.Bundle; import android.util.Log; import android.widget.ArrayAdapter; import android.widget.AutoCompleteTextView; import android.widget.TextView; public class ZelimDoci extends Activity { TextView lista; static final String[] STANICE = new String[] { "New York", "Chicago", "Dallas", "Los Angeles" }; /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.zelimdoci); AutoCompleteTextView textView = (AutoCompleteTextView) findViewById(R.id.autocomplete_country); ArrayAdapter<String> adapter = new ArrayAdapter<String>(this, R.layout.list_item, STANICE); textView.setAdapter(adapter); lista = (TextView)findViewById(R.id.lista); SQLiteDatabase myDB= null; String TableName = "Database"; String Data=""; /* Create a Database. */ try { myDB = this.openOrCreateDatabase("Database", MODE_PRIVATE, null); /* Create a Table in the Database. */ myDB.execSQL("CREATE TABLE IF NOT EXISTS " + TableName + " (Field1 INT(3) UNIQUE, Field2 INT(3) UNIQUE, Field3 VARCHAR UNIQUE, Field4 VARCHAR UNIQUE);"); Cursor a = myDB.rawQuery("SELECT * FROM Database where Field1 == 1", null); a.moveToFirst(); if (a == null) { /* Insert data to a Table*/ myDB.execSQL("INSERT INTO " + TableName + " (Field1, Field2, Field3, Field4)" + " VALUES (1, 119, 'New York', 'Dallas');"); myDB.execSQL("INSERT INTO " + TableName + " (Field1, Field2, Field3, Field4)" + " VALUES (9, 587, 'California', 'New York');"); } myDB.execSQL("INSERT INTO " + TableName + " (Field1, Field2, Field3, Field4)" + " VALUES (87, 57, 'Canada', 'London');"); } /*retrieve data from database */ Cursor c = myDB.rawQuery("SELECT * FROM " + TableName , null); int Column1 = c.getColumnIndex("Field1"); int Column2 = c.getColumnIndex("Field2"); int Column3 = c.getColumnIndex("Field3"); int Column4 = c.getColumnIndex("Field4"); // Check if our result was valid. c.moveToFirst(); if (c != null) { // Loop through all Results do { String LocationA = c.getString(Column3); String LocationB = c.getString(Column4); int Id = c.getInt(Column1); int Linija = c.getInt(Column2); Data =Data +Id+" | "+Linija+" | "+LocationA+"-"+LocationB+"\n"; }while(c.moveToNext()); } lista.setText(String.valueOf(Data)); } catch(Exception e) { Log.e("Error", "Error", e); } finally { if (myDB != null) myDB.close(); } } } .xml file <?xml version="1.0" encoding="utf-8"?> <LinearLayout xmlns:android="http://schemas.android.com/apk/res/android" android:orientation="vertical" android:layout_width="fill_parent" android:layout_height="fill_parent" > <TextView android:layout_width="fill_parent" android:layout_height="wrap_content" android:textSize="20sp" android:gravity="center_horizontal" android:padding="10sp" android:text="Test AutoComplete"/> <LinearLayout xmlns:android="http://schemas.android.com/apk/res/android" android:orientation="horizontal" android:layout_width="fill_parent" android:layout_height="wrap_content" android:padding="5dp"> <TextView android:layout_width="wrap_content" android:layout_height="wrap_content" android:text="AutoComplete" /> <AutoCompleteTextView android:id="@+id/autocomplete_country" android:layout_width="fill_parent" android:layout_height="wrap_content" android:layout_marginLeft="5dp"/> </LinearLayout> </LinearLayout>

    Read the article

  • Loading FireMonkey style resourses with RTTI

    - by HeMet
    I am trying to write class that inherits from FMX TStyledControl. When style is updated it loads style resource objects to cache. I created project group for package with custom controls and test FMX HD project as it describes in Delphi help. After installing package and placing TsgSlideHost on the test form I run test app. It’s work well, but when I close it and try to rebuild package RAD Studio says “Error in rtl160.bpl” or “invalid pointer operation”. It seems what problem in LoadToCacheIfNeeded procedure from TsgStyledControl, but I’m not understand why. Is there any restriction on using RTTI with FMX styles or anything? TsgStyledControl sources: unit SlideGUI.TsgStyledControl; interface uses System.SysUtils, System.Classes, System.Types, FMX.Types, FMX.Layouts, FMX.Objects, FMX.Effects, System.UITypes, FMX.Ani, System.Rtti, System.TypInfo; type TCachedAttribute = class(TCustomAttribute) private fStyleName: string; public constructor Create(const aStyleName: string); property StyleName: string read fStyleName; end; TsgStyledControl = class(TStyledControl) private procedure CacheStyleObjects; procedure LoadToCacheIfNeeded(aField: TRttiField); protected function FindStyleResourceAs<T: class>(const AStyleLookup: string): T; function GetStyleName: string; virtual; abstract; function GetStyleObject: TControl; override; public procedure ApplyStyle; override; published { Published declarations } end; implementation { TsgStyledControl } procedure TsgStyledControl.ApplyStyle; begin inherited; CacheStyleObjects; end; procedure TsgStyledControl.CacheStyleObjects; var ctx: TRttiContext; typ: TRttiType; fld: TRttiField; begin ctx := TRttiContext.Create; try typ := ctx.GetType(Self.ClassType); for fld in typ.GetFields do LoadFromCacheIfNeeded(fld); finally ctx.Free end; end; function TsgStyledControl.FindStyleResourceAs<T>(const AStyleLookup: string): T; var fmxObj: TFmxObject; begin fmxObj := FindStyleResource(AStyleLookup); if Assigned(fmxObj) and (fmxObj is T) then Result := fmxObj as T else Result := nil; end; function TsgStyledControl.GetStyleObject: TControl; var S: TResourceStream; begin if (FStyleLookup = '') then begin if FindRCData(HInstance, GetStyleName) then begin S := TResourceStream.Create(HInstance, GetStyleName, RT_RCDATA); try Result := TControl(CreateObjectFromStream(nil, S)); Exit; finally S.Free; end; end; end; Result := inherited GetStyleObject; end; procedure TsgStyledControl.LoadToCacheIfNeeded(aField: TRttiField); var attr: TCustomAttribute; styleName: string; styleObj: TFmxObject; val: TValue; begin for attr in aField.GetAttributes do begin if attr is TCachedAttribute then begin styleName := TCachedAttribute(attr).StyleName; if styleName <> '' then begin styleObj := FindStyleResource(styleName); val := TValue.From<TFmxObject>(styleObj); aField.SetValue(Self, val); end; end; end; end; { TCachedAttribute } constructor TCachedAttribute.Create(const aStyleName: string); begin fStyleName := aStyleName; end; end. Using of TsgStyledControl: type TsgSlideHost = class(TsgStyledControl) private [TCached('SlideHost')] fSlideHost: TLayout; [TCached('SideMenu')] fSideMenuLyt: TLayout; [TCached('SlideContainer')] fSlideContainer: TLayout; fSideMenu: IsgSideMenu; procedure ReapplyProps; procedure SetSideMenu(const Value: IsgSideMenu); protected function GetStyleName: string; override; function GetStyleObject: TControl; override; procedure UpdateSideMenuLyt; public constructor Create(AOwner: TComponent); override; procedure ApplyStyle; override; published property SideMenu: IsgSideMenu read fSideMenu write SetSideMenu; end;

    Read the article

  • EF Code First to SQL Azure

    - by Predrag Pejic
    I am using EF Code First to create a database on local .\SQLEXPRESS. Among others. I have these 2 classes: public class Shop { public int ShopID { get; set; } [Required(AllowEmptyStrings = false, ErrorMessage = "You must enter a name!")] [MaxLength(25, ErrorMessage = "Name must be 25 characters or less")] public string Name { get; set; } [Required(AllowEmptyStrings = false, ErrorMessage = "You must enter an address!")] [MaxLength(30, ErrorMessage = "Address must be 30 characters or less")] public string Address { get; set; } [Required(AllowEmptyStrings = false, ErrorMessage = "You must enter a valid city name!")] [MaxLength(30, ErrorMessage = "City name must be 30 characters or less")] public string City { get; set; } [Required(AllowEmptyStrings = false, ErrorMessage = "You must enter a phone number!")] [MaxLength(14, ErrorMessage = "Phone number must be 14 characters or less")] public string Phone { get; set; } [MaxLength(100, ErrorMessage = "Description must be 50 characters or less")] public string Description { get; set; } [Required(AllowEmptyStrings = false, ErrorMessage = "You must enter a WorkTime!")] public DateTime WorkTimeBegin { get; set; } [Required(AllowEmptyStrings = false, ErrorMessage = "You must enter a WorkTime!")] public DateTime WorkTimeEnd { get; set; } public DateTime? SaturdayWorkTimeBegin { get; set; } public DateTime? SaturdayWorkTimeEnd { get; set; } public DateTime? SundayWorkTimeBegin { get; set; } public DateTime? SundayWorkTimeEnd { get; set; } public int ShoppingPlaceID { get; set; } public virtual ShoppingPlace ShoppingPlace { get; set; } public virtual ICollection<Category> Categories { get; set; } } public class ShoppingPlace { [Key] public int ShopingplaceID { get; set; } [Required(AllowEmptyStrings = false, ErrorMessage = "You must enter a name!")] [MaxLength(25, ErrorMessage = "Name must be 25 characters or less")] public string Name { get; set; } [Required(AllowEmptyStrings = false, ErrorMessage = "You must enter an address!")] [MaxLength(50, ErrorMessage = "Address must be 50 characters or less")] public string Address { get; set; } [Required(AllowEmptyStrings = false, ErrorMessage = "You must enter a city name!")] [MaxLength(30, ErrorMessage = "City must be 30 characters or less")] public string City { get; set; } [Required(AllowEmptyStrings = false, ErrorMessage = "You must enter a valid phone number!")] [MaxLength(14, ErrorMessage = "Phone number must be 14 characters or less")] public string Phone { get; set; } public int ShoppingCenterID { get; set; } public virtual ShoppingCenter ShoppingCenter { get; set; } public virtual ICollection<Shop> Shops { get; set; } } and a method in DbContext: modelBuilder.Entity<Item>() .HasRequired(p => p.Category) .WithMany(a => a.Items) .HasForeignKey(a => a.CategoryID) .WillCascadeOnDelete(false); modelBuilder.Entity<Category>() .HasRequired(a => a.Shop) .WithMany(a => a.Categories) .HasForeignKey(a => a.ShopID) .WillCascadeOnDelete(false); modelBuilder.Entity<Shop>() .HasOptional(a => a.ShoppingPlace) .WithMany(a => a.Shops) .HasForeignKey(a => a.ShoppingPlaceID) .WillCascadeOnDelete(false); modelBuilder.Entity<ShoppingPlace>() .HasOptional(a => a.ShoppingCenter) .WithMany(a => a.ShoppingPlaces) .HasForeignKey(a => a.ShoppingCenterID) .WillCascadeOnDelete(false); Why I can't create Shop without creating and populating ShopingPlace. How to achieve that? EDIT: Tried with: modelBuilder.Entity<Shop>() .HasOptional(a => a.ShoppingPlace) .WithOptionalPrincipal(); modelBuilder.Entity<ShoppingPlace>() .HasOptional(a => a.ShoppingCenter) .WithOptionalPrincipal(); and it passed, but what is the difference? And why in SQL Server i am allowed to see ShoppingPlaceID and ShoppingPlace_ShopingPlaceID when in the case of Item and Category i see only one?

    Read the article

  • running multi threads in Java

    - by owca
    My task is to simulate activity of couple of persons. Each of them has few activities to perform in some random time: fast (0-5s), medium(5-10s), slow(10-20s) and very slow(20-30s). Each person performs its task independently in the same time. At the beginning of new task I should print it's random time, start the task and then after time passes show next task's time and start it. I've written run() function that counts time, but now it looks like threads are done one after another and not in the same time or maybe they're just printed in this way. public class People{ public static void main(String[] args){ Task tasksA[]={new Task("washing","fast"), new Task("reading","slow"), new Task("shopping","medium")}; Task tasksM[]={new Task("sleeping zzzzzzzzzz","very slow"), new Task("learning","slow"), new Task(" :** ","slow"), new Task("passing an exam","slow") }; Task tasksJ[]={new Task("listening music","medium"), new Task("doing nothing","slow"), new Task("walking","medium") }; BusyPerson friends[]={ new BusyPerson("Alice",tasksA), new BusyPerson("Mark",tasksM), new BusyPerson("John",tasksJ)}; System.out.println("STARTING....................."); for(BusyPerson f: friends) (new Thread(f)).start(); System.out.println("DONE........................."); } } class Task { private String task; private int time; private Task[]tasks; public Task(String t, String s){ task = t; Speed speed = new Speed(); time = speed.getSpeed(s); } public Task(Task[]tab){ Task[]table=new Task[tab.length]; for(int i=0; i < tab.length; i++){ table[i] = tab[i]; } this.tasks = table; } } class Speed { private static String[]hows = {"fast","medium","slow","very slow"}; private static int[]maxs = {5000, 10000, 20000, 30000}; public Speed(){ } public static int getSpeed( String speedString){ String s = speedString; int up_limit=0; int down_limit=0; int time=0; //get limits of time for(int i=0; i<hows.length; i++){ if(s.equals(hows[i])){ up_limit = maxs[i]; if(i>0){ down_limit = maxs[i-1]; } else{ down_limit = 0; } } } //get random time within the limits Random rand = new Random(); time = rand.nextInt(up_limit) + down_limit; return time; } } class BusyPerson implements Runnable { private String name; private Task[] person_tasks; private BusyPerson[]persons; public BusyPerson(String s, Task[]t){ name = s; person_tasks = t; } public BusyPerson(BusyPerson[]tab){ BusyPerson[]table=new BusyPerson[tab.length]; for(int i=0; i < tab.length; i++){ table[i] = tab[i]; } this.persons = table; } public void run() { int time = 0; double t1=0; for(Task t: person_tasks){ t1 = (double)t.time/1000; System.out.println(name+" is... "+t.task+" "+t.speed+ " ("+t1+" sec)"); while (time == t.time) { try { Thread.sleep(10); } catch(InterruptedException exc) { System.out.println("End of thread."); return; } time = time + 100; } } } } And my output : STARTING..................... DONE......................... Mark is... sleeping zzzzzzzzzz very slow (36.715 sec) Mark is... learning slow (10.117 sec) Mark is... :** slow (29.543 sec) Mark is... passing an exam slow (23.429 sec) Alice is... washing fast (1.209 sec) Alice is... reading slow (23.21 sec) Alice is... shopping medium (11.237 sec) John is... listening music medium (8.263 sec) John is... doing nothing slow (13.576 sec) John is... walking medium (11.322 sec) Whilst it should be like this : STARTING..................... DONE......................... John is... listening music medium (7.05 sec) Alice is... washing fast (3.268 sec) Mark is... sleeping zzzzzzzzzz very slow (23.71 sec) Alice is... reading slow (15.516 sec) John is... doing nothing slow (13.692 sec) Alice is... shopping medium (8.371 sec) Mark is... learning slow (13.904 sec) John is... walking medium (5.172 sec) Mark is... :** slow (12.322 sec) Mark is... passing an exam very slow (27.1 sec)

    Read the article

  • How to include multiple XML files in a single XML file for deserialization by XmlSerializer in .NET

    - by harrydev
    Hi, is it possible to use the XmlSerializer in .NET to load an XML file which includes other XML files? And how? This, in order to share XML state easily in two "parent" XML files, e.g. AB and BC in below. Example: using System; using System.IO; using System.Xml.Serialization; namespace XmlSerializerMultipleFilesTest { [Serializable] public class A { public int Value { get; set; } } [Serializable] public class B { public double Value { get; set; } } [Serializable] public class C { public string Value { get; set; } } [Serializable] public class AB { public A A { get; set; } public B B { get; set; } } [Serializable] public class BC { public B B { get; set; } public C C { get; set; } } class Program { public static void Serialize<T>(T data, string filePath) { using (var writer = new StreamWriter(filePath)) { var xmlSerializer = new XmlSerializer(typeof(T)); xmlSerializer.Serialize(writer, data); } } public static T Deserialize<T>(string filePath) { using (var reader = new StreamReader(filePath)) { var xmlSerializer = new XmlSerializer(typeof(T)); return (T)xmlSerializer.Deserialize(reader); } } static void Main(string[] args) { const string fileNameA = @"A.xml"; const string fileNameB = @"B.xml"; const string fileNameC = @"C.xml"; const string fileNameAB = @"AB.xml"; const string fileNameBC = @"BC.xml"; var a = new A(){ Value = 42 }; var b = new B(){ Value = Math.PI }; var c = new C(){ Value = "Something rotten" }; Serialize(a, fileNameA); Serialize(b, fileNameB); Serialize(c, fileNameC); // How can AB and BC be deserialized from single // files which include two of the A, B or C files. // Using ideally something like: var ab = Deserialize<AB>(fileNameAB); var bc = Deserialize<BC>(fileNameBC); // That is, so that A, B, C xml file // contents are shared across these two } } } Thus, the A, B, C files contain the following: A.xml: <?xml version="1.0" encoding="utf-8"?> <A xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <Value>42</Value> </A> B.xml: <?xml version="1.0" encoding="utf-8"?> <B xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <Value>3.1415926535897931</Value> </B> C.xml: <?xml version="1.0" encoding="utf-8"?> <C xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <Value>Something rotten</Value> </C> And then the "parent" XML files would contain a XML include file of some sort (I have not been able to find anything like this), such as: AB.xml: <?xml version="1.0" encoding="utf-8"?> <AB xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <A include="A.xml"/> <B include="B.xml"/> </AB> BC.xml: <?xml version="1.0" encoding="utf-8"?> <BC xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <B include="B.xml"/> <C include="C.xml"/> </BC> Of course, I guess this can be solved by implementing IXmlSerializer for AB and BC, but I was hoping there was an easier solution or a generic solution with which classes themselves only need the [Serializable] attribute and nothing else. That is, the split into multiple files is XML only and handled by XmlSerializer itself or a custom generic serializer on top of this. I know this should be somewhat possible with app.config (as in http://stackoverflow.com/questions/480538/use-xml-includes-or-config-references-in-app-config-to-include-other-config-files), but I would prefer a solution based on XmlSerializer. Thanks.

    Read the article

  • How to add Category in DotClear blog with HttpWebRequest or MetaWeblog API

    - by Pitming
    I'm trying to create/modify dotclear blogs. For most of the options, i use XmlRpc API (DotClear.MetaWeblog). But didn't find any way to handle categories. So I start to look at the Http packet and try to do "the same as the browser". Here si the method I use to "Http POST" protected HttpStatusCode HttpPost(Uri url_, string data_, bool allowAutoRedirect_) { HttpWebRequest Request; HttpWebResponse Response = null; Stream ResponseStream = null; Request = (System.Net.HttpWebRequest)HttpWebRequest.Create(url_); Request.UserAgent = "Mozilla/5.0 (Windows; U; Windows NT 5.1; fr; rv:1.9.1.5) Gecko/20091102 Firefox/3.5.5 (.NET CLR 3.5.30729)"; Request.Accept = "text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8"; Request.AllowAutoRedirect = allowAutoRedirect_; // Add the network credentials to the request. Request.Credentials = new NetworkCredential(Username, Password); string authInfo = Username + ":" + Password; authInfo = Convert.ToBase64String(Encoding.Default.GetBytes(authInfo)); Request.Headers["Authorization"] = "Basic " + authInfo; Request.Method = "POST"; Request.CookieContainer = Cookies; if(ConnectionCookie!=null) Request.CookieContainer.Add(url_, ConnectionCookie); if (dcAdminCookie != null) Request.CookieContainer.Add(url_, dcAdminCookie); Request.PreAuthenticate = true; ASCIIEncoding encoding = new ASCIIEncoding(); string postData = data_; byte[] data = encoding.GetBytes(postData); //Encoding.UTF8.GetBytes(data_); //encoding.GetBytes(postData); Request.ContentLength = data.Length; Request.ContentType = "application/x-www-form-urlencoded"; Stream newStream = Request.GetRequestStream(); // Send the data. newStream.Write(data, 0, data.Length); newStream.Close(); try { // get the response from the server. Response = (HttpWebResponse)Request.GetResponse(); if (!allowAutoRedirect_) { foreach (Cookie c in Response.Cookies) { if (c.Name == "dcxd") ConnectionCookie = c; if (c.Name == "dc_admin") dcAdminCookie = c; } Cookies.Add(Response.Cookies); } // Get the response stream. ResponseStream = Response.GetResponseStream(); // Pipes the stream to a higher level stream reader with the required encoding format. StreamReader readStream = new StreamReader(ResponseStream, Encoding.UTF8); string result = readStream.ReadToEnd(); if (Request.RequestUri == Response.ResponseUri) { _log.InfoFormat("{0} ==&gt; {1}({2})", Request.RequestUri, Response.StatusCode, Response.StatusDescription); } else { _log.WarnFormat("RequestUri:{0}\r\nResponseUri:{1}\r\nstatus code:{2} Status descr:{3}", Request.RequestUri, Response.ResponseUri, Response.StatusCode, Response.StatusDescription); } } catch (WebException wex) { Response = wex.Response as HttpWebResponse; if (Response != null) { _log.ErrorFormat("{0} ==&gt; {1}({2})", Request.RequestUri, Response.StatusCode, Response.StatusDescription); } Request.Abort(); } finally { if (Response != null) { // Releases the resources of the response. Response.Close(); } } if(Response !=null) return Response.StatusCode; return HttpStatusCode.Ambiguous; } So the first thing to do is to Authenticate as admin. Here is the code: protected bool HttpAuthenticate() { Uri u = new Uri(this.Url); Uri url = new Uri(string.Format("{0}/admin/auth.php", u.GetLeftPart(UriPartial.Authority))); string data = string.Format("user_id={0}&user_pwd={1}&user_remember=1", Username, Password); var ret = HttpPost(url,data,false); return (ret == HttpStatusCode.OK || ret==HttpStatusCode.Found); } 3.Now that I'm authenticate, i need to get a xd_chek info (that i can find on the page so basically it's a GET on /admin/category.php + Regex("dotclear[.]nonce = '(.*)'")) 4.so I'm authenticate and have the xd_check info. The last thing to do seems to post the next category. But of course it does not work at all... here is the code: string postData = string.Format("cat_title={0}&new_cat_parent={1}&xd_check={2}", category_, 0, xdCheck); HttpPost(url, postData, true); If anyone can help me and explain were is it wrong ? thanks in advance.

    Read the article

  • Convert PDF to Image Batch

    - by tro
    I am working on a solution where I can convert pdf files to images. I am using the following example from codeproject: http://www.codeproject.com/Articles/317700/Convert-a-PDF-into-a-series-of-images-using-Csharp?msg=4134859#xx4134859xx now I tried with the following code to generate from more then 1000 pdf files new images: using Cyotek.GhostScript; using Cyotek.GhostScript.PdfConversion; using System; using System.Collections.Generic; using System.Drawing; using System.IO; using System.Linq; using System.Text; using System.Threading.Tasks; namespace RefClass_PDF2Image { class Program { static void Main(string[] args) { string outputPath = Properties.Settings.Default.outputPath; string pdfPath = Properties.Settings.Default.pdfPath; if (!Directory.Exists(outputPath)) { Console.WriteLine("Der angegebene Pfad " + outputPath + " für den Export wurde nicht gefunden. Bitte ändern Sie den Pfad (outputPath) in der App.Config Datei."); return; } else { Console.WriteLine("Output Pfad: " + outputPath + " gefunden."); } if (!Directory.Exists(pdfPath)) { Console.WriteLine("Der angegebene Pfad " + pdfPath + " zu den PDF Zeichnungen wurde nicht gefunden. Bitte ändern Sie den Pfad (pdfPath) in der App.Config Datei."); return; } else { Console.WriteLine("PDF Pfad: " + pdfPath + " gefunden."); } Pdf2ImageSettings settings = GetPDFSettings(); DateTime start = DateTime.Now; TimeSpan span; Console.WriteLine(""); Console.WriteLine("Extraktion der PDF Zeichnungen wird gestartet: " + start.ToShortTimeString()); Console.WriteLine(""); DirectoryInfo diretoryInfo = new DirectoryInfo(pdfPath); DirectoryInfo[] directories = diretoryInfo.GetDirectories(); Console.WriteLine(""); Console.WriteLine("Es wurden " + directories.Length + " verschiedende Verzeichnisse gefunden."); Console.WriteLine(""); List<string> filenamesPDF = Directory.GetFiles(pdfPath, "*.pdf*", SearchOption.AllDirectories).Select(x => Path.GetFullPath(x)).ToList(); List<string> filenamesOutput = Directory.GetFiles(outputPath, "*.*", SearchOption.AllDirectories).Select(x => Path.GetFullPath(x)).ToList(); Console.WriteLine(""); Console.WriteLine("Es wurden " + filenamesPDF.Count + " verschiedende PDF Zeichnungen gefunden."); Console.WriteLine(""); List<string> newFileNames = new List<string>(); int cutLength = pdfPath.Length; for (int i = 0; i < filenamesPDF.Count; i++) { string temp = filenamesPDF[i].Remove(0, cutLength); temp = outputPath + temp; temp = temp.Replace("pdf", "jpg"); newFileNames.Add(temp); } for (int i = 0; i < filenamesPDF.Count; i++) { FileInfo fi = new FileInfo(newFileNames[i]); if (!fi.Exists) { if (!Directory.Exists(fi.DirectoryName)) { Directory.CreateDirectory(fi.DirectoryName); } Bitmap firstPage = new Pdf2Image(filenamesPDF[i], settings).GetImage(); firstPage.Save(newFileNames[i], System.Drawing.Imaging.ImageFormat.Jpeg); firstPage.Dispose(); } //if (i % 20 == 0) //{ // GC.Collect(); // GC.WaitForPendingFinalizers(); //} } Console.ReadLine(); } private static Pdf2ImageSettings GetPDFSettings() { Pdf2ImageSettings settings; settings = new Pdf2ImageSettings(); settings.AntiAliasMode = AntiAliasMode.Medium; settings.Dpi = 150; settings.GridFitMode = GridFitMode.Topological; settings.ImageFormat = ImageFormat.Png24; settings.TrimMode = PdfTrimMode.CropBox; return settings; } } } unfortunately, I always get in the Pdf2Image.cs an out of memory exception. here the code: public Bitmap GetImage(int pageNumber) { Bitmap result; string workFile; //if (pageNumber < 1 || pageNumber > this.PageCount) // throw new ArgumentException("Page number is out of bounds", "pageNumber"); if (pageNumber < 1) throw new ArgumentException("Page number is out of bounds", "pageNumber"); workFile = Path.GetTempFileName(); try { this.ConvertPdfPageToImage(workFile, pageNumber); using (FileStream stream = new FileStream(workFile, FileMode.Open, FileAccess.Read)) { result = new Bitmap(stream); // --->>> here is the out of memory exception stream.Close(); stream.Dispose(); } } finally { File.Delete(workFile); } return result; } how can I fix that to avoid this exception? thanks for any help, tro

    Read the article

  • creating a Menu from SQLite values in Java

    - by shanahobo86
    I am trying to create a ListMenu using data from an SQLite database to define the name of each MenuItem. So in a class called menu.java I have defined the array String classes [] = {}; which should hold each menu item name. In a DBAdapter class I created a function so the user can insert info to a table (This all works fine btw). public long insertContact(String name, String code, String location, String comments, int days, int start, int end, String type) { ContentValues initialValues = new ContentValues(); initialValues.put(KEY_NAME, name); initialValues.put(KEY_CODE, code); initialValues.put(KEY_LOCATION, location); initialValues.put(KEY_COMMENTS, comments); initialValues.put(KEY_DAYS, days); initialValues.put(KEY_START, start); initialValues.put(KEY_END, end); initialValues.put(KEY_TYPE, type); return db.insert(DATABASE_TABLE, null, initialValues); } It would be the Strings inserted into KEY_NAME that I need to populate that String array with. Does anyone know if this is possible? Thanks so much for the help guys. If I implement that function by Sam/Mango the program crashes, am I using it incorrectly or is the error due to the unknown size of the array? DBAdapter db = new DBAdapter(this); String classes [] = db.getClasses(); edit: I should mention that if I manually define the array: String classes [] = {"test1", "test2", "test3", etc}; It works fine. The error is a NullPointerException Here's the logcat (sorry about the formatting). I hadn't initialized with db = helper.getReadableDatabase(); in the getClasses() function but unfortunately it didn't fix the problem. 11-11 22:53:39.117: D/dalvikvm(17856): Late-enabling CheckJNI 11-11 22:53:39.297: D/TextLayoutCache(17856): Using debug level: 0 - Debug Enabled: 0 11-11 22:53:39.337: D/libEGL(17856): loaded /system/lib/egl/libGLES_android.so 11-11 22:53:39.337: D/libEGL(17856): loaded /system/lib/egl/libEGL_adreno200.so 11-11 22:53:39.357: D/libEGL(17856): loaded /system/lib/egl/libGLESv1_CM_adreno200.so 11-11 22:53:39.357: D/libEGL(17856): loaded /system/lib/egl/libGLESv2_adreno200.so 11-11 22:53:39.387: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:39.407: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5c66d000 size:36593664 offset:32825344 fd:65 11-11 22:53:39.417: E/(17856): Can't open file for reading 11-11 22:53:39.417: E/(17856): Can't open file for reading 11-11 22:53:39.417: D/OpenGLRenderer(17856): Enabling debug mode 0 11-11 22:53:39.477: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5ecd3000 size:40361984 offset:36593664 fd:68 11-11 22:53:40.507: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61451000 size:7254016 offset:3485696 fd:71 11-11 22:53:41.077: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:41.077: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61c4c000 size:7725056 offset:7254016 fd:74 11-11 22:53:41.097: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x623aa000 size:8196096 offset:7725056 fd:80 11-11 22:53:41.937: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x62b7b000 size:8667136 offset:8196096 fd:83 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x61c4c000 size:7725056 offset:7254016 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x623aa000 size:8196096 offset:7725056 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x62b7b000 size:8667136 offset:8196096 11-11 22:53:42.167: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:42.177: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61c5d000 size:17084416 offset:13316096 fd:74 11-11 22:53:42.317: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x63853000 size:20852736 offset:17084416 fd:80 11-11 22:53:42.357: D/OpenGLRenderer(17856): Flushing caches (mode 0) 11-11 22:53:42.357: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x5c66d000 size:36593664 offset:32825344 11-11 22:53:42.357: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x5ecd3000 size:40361984 offset:36593664 11-11 22:53:42.367: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x61451000 size:7254016 offset:3485696 11-11 22:53:42.757: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5c56d000 size:24621056 offset:20852736 fd:65 11-11 22:53:44.247: D/AndroidRuntime(17856): Shutting down VM 11-11 22:53:44.247: W/dalvikvm(17856): threadid=1: thread exiting with uncaught exception (group=0x40ac3210) 11-11 22:53:44.257: E/AndroidRuntime(17856): FATAL EXCEPTION: main 11-11 22:53:44.257: E/AndroidRuntime(17856): java.lang.RuntimeException: Unable to instantiate activity ComponentInfo{niall.shannon.timetable/niall.shannon.timetable.menu}: java.lang.NullPointerException 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1891) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:1992) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.access$600(ActivityThread.java:127) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:1158) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.os.Handler.dispatchMessage(Handler.java:99) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.os.Looper.loop(Looper.java:137) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.main(ActivityThread.java:4441) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.reflect.Method.invokeNative(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.reflect.Method.invoke(Method.java:511) 11-11 22:53:44.257: E/AndroidRuntime(17856): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:823) 11-11 22:53:44.257: E/AndroidRuntime(17856): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:590) 11-11 22:53:44.257: E/AndroidRuntime(17856): at dalvik.system.NativeStart.main(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): Caused by: java.lang.NullPointerException 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.content.ContextWrapper.openOrCreateDatabase(ContextWrapper.java:221) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.database.sqlite.SQLiteOpenHelper.getWritableDatabase(SQLiteOpenHelper.java:157) 11-11 22:53:44.257: E/AndroidRuntime(17856): at niall.shannon.timetable.DBAdapter.getClasses(DBAdapter.java:151) 11-11 22:53:44.257: E/AndroidRuntime(17856): at niall.shannon.timetable.menu.<init>(menu.java:15) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.Class.newInstanceImpl(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.Class.newInstance(Class.java:1319) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.Instrumentation.newActivity(Instrumentation.java:1023) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1882) 11-11 22:53:44.257: E/AndroidRuntime(17856): ... 11 more 11-11 22:53:46.527: I/Process(17856): Sending signal. PID: 17856 SIG: 9

    Read the article

  • Android ksoap nested soap objects in request gives error in response

    - by Smalesy
    I'm trying to do the following soap request on Android using KSOAP. It contains a list of nested soap objects. However, I must be doing something wrong as I get an error back. The request I am trying to generate is as follows: <?xml version="1.0" encoding="utf-8"?> <soap12:Envelope xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:soap12="http://www.w3.org/2003/05/soap-envelope"> <soap12:Body> <SetAttendanceMarks xmlns="http://hostname.net/"> <strSessionToken>string</strSessionToken> <LessonMarks> <Count>int</Count> <LessonMarks> <LessonMark> <StudentId>int</StudentId> <EventInstanceId>int</EventInstanceId> <Mark>string</Mark> </LessonMark> <LessonMark> <StudentId>int</StudentId> <EventInstanceId>int</EventInstanceId> <Mark>string</Mark> </LessonMark> </LessonMarks> </LessonMarks> </SetAttendanceMarks> </soap12:Body> </soap12:Envelope> My code is as follows: public boolean setAttendanceMarks(List<Mark> list) throws Exception { boolean result = false; String methodName = "SetAttendanceMarks"; String soapAction = getHost() + "SetAttendanceMarks"; SoapObject lessMarksN = new SoapObject(getHost(), "LessonMarks"); for (Mark m : list) { PropertyInfo smProp =new PropertyInfo(); smProp.setName("LessonMark"); smProp.setValue(m); smProp.setType(Mark.class); lessMarksN.addProperty(smProp); } PropertyInfo cProp =new PropertyInfo(); cProp.setName("Count"); cProp.setValue(list.size()); cProp.setType(Integer.class); SoapObject lessMarks = new SoapObject(getHost(), "LessonMarks"); lessMarks.addProperty(cProp); lessMarks.addSoapObject(lessMarksN); PropertyInfo sProp =new PropertyInfo(); sProp.setName("strSessionToken"); sProp.setValue(mSession); sProp.setType(String.class); SoapObject request = new SoapObject(getHost(), methodName); request.addProperty(sProp); request.addSoapObject(lessMarks); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope(SoapEnvelope.VER12); envelope.dotNet = true; envelope.setOutputSoapObject(request); HttpTransportSE androidHttpTransport = new HttpTransportSE(getURL()); androidHttpTransport.debug = true; androidHttpTransport.call(soapAction, envelope); String a = androidHttpTransport.requestDump; String b = androidHttpTransport.responseDump; SoapObject resultsRequestSOAP = (SoapObject) envelope.bodyIn; SoapObject res = (SoapObject) resultsRequestSOAP.getProperty(0); String resultStr = res.getPropertyAsString("Result"); if (resultStr.contentEquals("OK")) { result = true; } return result; } The error I get is as follows: <?xml version="1.0" encoding="utf-8"?><soap:Envelope xmlns:soap="http://www.w3.org/2003/05/soap-envelope" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <soap:Body> <soap:Fault> <soap:Code> <soap:Value>soap:Sender</soap:Value> </soap:Code> <soap:Reason> <soap:Text xml:lang="en">Server was unable to read request. ---&gt; There is an error in XML document (1, 383). ---&gt; The specified type was not recognized: name='LessonMarks', namespace='http://gsdregapp.net/', at &lt;LessonMarks xmlns='http://gsdregapp.net/'&gt;.</soap:Text> </soap:Reason> <soap:Detail /> </soap:Fault> </soap:Body> </soap:Envelope> Can anybody tell me what I am doing wrong? I will be most grateful for any assistance!

    Read the article

  • pass an ID with hyperlik but cant get this ID value from a fk in one table when i click in insert

    - by susan
    Something strange happened in my codes, actually I have a hyperlink that pass ID value in a query string to second page.in second page i have 2 sql datasource that both these sql datasources should get this id value and pass it to a filter parameter to show sth in datalist. so in another word I have a first page that has an hyperlink read ID value from a datasource and pass it to second page.its like below: <asp:HyperLink ID="HyperLink1" runat="server" NavigateUrl='<%# "~/forumpage.aspx?ID="+Eval("ID")%>'><%#Eval("title")%> </asp:HyperLink> then in second page i have one sql datasource with a query like this ...where ID=@id and get this id in query string from db.it work great . but i have problem with second sql datasource in second page it has a query sth like below:...forms.question_id=@id then in sql reference both to query string as ID that get by first page in hyperlink. but when i click in insert button show me error with fk. error:Error:The INSERT statement conflicted with the FOREIGN KEY constraint "FK_forumreply_forumquestions". The conflict occurred in database "forum", table "dbo.forumquestions", column 'ID'. The statement has been terminated. my tables (question(ID,user_id(fk),Cat_id(fk),title,bodytext) (reply(ID,userr_id(fk),questionn_id(fk),titlereply,bodytestreply); When by hand in cb i gave a number in questionn_id like 1 it show me successful but when it want read from a filter by datasource this field face with problem. plzzzz help i really need skip from this part.and cause i am new i guess I cant understand the logic way clearly. <asp:SqlDataSource ID="sdsreply" runat="server" ConnectionString="<%$ ConnectionStrings:forumConnectionString %>" SelectCommand="SELECT forumreply.ID, forumreply.userr_id, forumreply.questionn_id, forumreply.bodytextreply, forumreply.datetimereply, forumquestions.ID AS Expr1, forumusers.ID AS Expr2, forumusers.username FROM forumquestions INNER JOIN forumreply ON forumquestions.ID = forumreply.questionn_id INNER JOIN forumusers ON forumquestions.user_id = forumusers.ID AND forumreply.userr_id = forumusers.ID where forumreply.questionn_id=@questionn_id"> <SelectParameters> <asp:QueryStringParameter Name="questionn_id" QueryStringField="ID" /> </SelectParameters> </asp:SqlDataSource> it is cb for second page in insert button: { if (Session["userid"] != null) { lblreply.Text = Session["userid"].ToString(); } else { Session["userid"]=null; } if (HttpContext.Current.User.Identity.IsAuthenticated) { lblshow.Text = string.Empty; string d = HttpContext.Current.User.Identity.Name; lblshow.Text =d + "???? ??? ?????." ; foreach (DataListItem item in DataList2.Items) { Label questionn_idLabel = (Label)item.FindControl("questionn_idLabel"); Label userr_idLabel = (Label)item.FindControl("userr_idLabel"); lbltest.Text = string.Empty; lbltest.Text = questionn_idLabel.Text; lblreply.Text = string.Empty; lblreply.Text = userr_idLabel.Text; } } else { lblshow.Text = "??? ??? ??? ??? ?? ?? ?????? ???? ???? ???? ????? ??? ??? ? ??? ????? ???????."; } } { if(HttpContext.Current.User.Identity.IsAuthenticated) { if (Page.IsValid) { SqlConnection con = new SqlConnection(ConfigurationManager.ConnectionStrings["forumConnectionString"].ConnectionString); try { con.Open(); SqlCommand cmd = new SqlCommand("insert into forumreply (userr_id,questionn_id,bodytextreply,datetimereply)values(@userr_id,@questionn_id,@bodytextreply,@datetimereply)", con); cmd.Parameters.AddWithValue("userr_id",lblreply.Text); cmd.Parameters.AddWithValue("questionn_id",lbltest.Text); cmd.Parameters.AddWithValue("bodytextreply",txtbody.Text); cmd.Parameters.AddWithValue("datetimereply",DateTime.Now ); cmd.ExecuteNonQuery(); } catch (Exception exp) { Response.Write("<b>Error:</b>"); Response.Write(exp.Message); } finally { con.Close(); } lblmsg.Text = "???? ??? ?? ?????? ??? ?????.thx"; lblshow.Visible = false; //lbltxt.Text = txtbody.Text; txtbody.Text = string.Empty; } } else { lblmsg.Text = string.Empty; Session["rem"] = Request.UrlReferrer.AbsoluteUri; Response.Redirect("~/login.aspx"); } }

    Read the article

  • MVC 3 Remote Validation jQuery error on submit

    - by Richard Reddy
    I seem to have a weird issue with remote validation on my project. I am doing a simple validation check on an email field to ensure that it is unique. I've noticed that unless I put the cursor into the textbox and then remove it to trigger the validation at least once before submitting my form I will get a javascript error. e[h] is not a function jquery.min.js line 3 If I try to resubmit the form after the above error is returned everything works as expected. It's almost like the form tried to submit before waiting for the validation to return or something. Am I required to silently fire off a remote validation request on submit before submitting my form? Below is a snapshot of the code I'm using: (I've also tried GET instead of POST but I get the same result). As mentioned above, the code works fine but the form returns a jquery error unless the validation is triggered at least once. Model: public class RegisterModel { [Required] [Remote("DoesUserNameExist", "Account", HttpMethod = "POST", ErrorMessage = "User name taken.")] [Display(Name = "User name")] public string UserName { get; set; } [Required] [Display(Name = "Firstname")] public string Firstname { get; set; } [Display(Name = "Surname")] public string Surname { get; set; } [Required] [Remote("DoesEmailExist", "Account", HttpMethod = "POST", ErrorMessage = "Email taken.", AdditionalFields = "UserName")] [Display(Name = "Email address")] public string Email { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Password")] public string Password { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Confirm password")] public string ConfirmPassword { get; set; } [Display(Name = "Approved?")] public bool IsApproved { get; set; } } public class UserRoleModel { [Display(Name = "Assign Roles")] public IEnumerable<RoleViewModel> AllRoles { get; set; } public RegisterModel RegisterUser { get; set; } } Controller: // POST: /Account/DoesEmailExist // passing in username so that I can ignore the same email address for the same user on edit page [HttpPost] public JsonResult DoesEmailExist([Bind(Prefix = "RegisterUser.Email")]string Email, [Bind(Prefix = "RegisterUser.UserName")]string UserName) { var user = Membership.GetUserNameByEmail(Email); if (!String.IsNullOrEmpty(UserName)) { if (user == UserName) return Json(true); } return Json(user == null); } View: <script src="//ajax.googleapis.com/ajax/libs/jquery/1.7.1/jquery.min.js" type="text/javascript"></script> <script src="//ajax.googleapis.com/ajax/libs/jqueryui/1.8.17/jquery-ui.min.js" type="text/javascript"></script> <script type="text/javascript" src="/Content/web/js/jquery.unobtrusive-ajax.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.unobtrusive.min.js"></script> ...... @using (Html.BeginForm()) { @Html.AntiForgeryToken() <div class="titleh"> <h3>Edit a user account</h3> </div> <div class="body"> @Html.HiddenFor(model => model.RegisterUser.UserName) @Html.Partial("_CreateOrEdit", Model) <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(model => model.RegisterUser.IsApproved)</span> @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, true, new { @class = "uniform" }) Active @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, false, new { @class = "uniform" }) Disabled <div class="clear"></div> </div> <div class="button-box"> <input type="submit" name="submit" value="Save" class="st-button"/> @Html.ActionLink("Back to List", "Index", null, new { @class = "st-clear" }) </div> </div> } CreateEdit Partial View @model Project.Domain.Entities.UserRoleModel <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Firstname)</span> @Html.TextBoxFor(m => m.RegisterUser.Firstname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Firstname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Surname)</span> @Html.TextBoxFor(m => m.RegisterUser.Surname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Surname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Email)</span> @Html.TextBoxFor(m => m.RegisterUser.Email, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Email) <div class="clear"></div> </div> Thanks, Rich

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Auto not being recognised by the compiler, what would be the best replacement?

    - by user1719605
    So I have wrote a program that uses auto however the compiler doesn't seem to recognize it, probably it is an earlier compiler. I was wondering for my code, with are suitable variables to fix my code so that I do not need to use the auto keyword? I'm thinking a pointer to a string? or a string iterator, though I am not sure. #include <cstdlib> #include <string> #include <iostream> #include <unistd.h> #include <algorithm> using namespace std; int main(int argc, char* argv[]) { enum MODE { WHOLE, PREFIX, SUFFIX, ANYWHERE, EMBEDDED } mode = WHOLE; bool reverse_match = false; int c; while ((c = getopt(argc, argv, ":wpsaev")) != -1) { switch (c) { case 'w': // pattern matches whole word mode = WHOLE; break; case 'p': // pattern matches prefix mode = PREFIX; break; case 'a': // pattern matches anywhere mode = ANYWHERE; break; case 's': // pattern matches suffix mode = SUFFIX; break; case 'e': // pattern matches anywhere mode = EMBEDDED; break; case 'v': // reverse sense of match reverse_match = true; break; } } argc -= optind; argv += optind; string pattern = argv[0]; string word; int matches = 0; while (cin >> word) { switch (mode) { case WHOLE: if (reverse_match) { if (pattern != word) { matches += 1; cout << word << endl; } } else if (pattern == word) { matches += 1; cout << word << endl; } break; case PREFIX: if (pattern.size() <= word.size()) { auto res = mismatch(pattern.begin(), pattern.end(), word.begin()); if (reverse_match) { if (res.first != word.end()) { matches += 1; cout << word << endl; } } else if (res.first == word.end()) { matches += 1; cout << word << endl; } } break; case ANYWHERE: if (reverse_match) { if (!word.find(pattern) != string::npos) { matches += 1; cout << word << endl; } } else if (word.find(pattern) != string::npos) { matches += 1; cout << word << endl; } break; case SUFFIX: if (pattern.size() <= word.size()) { auto res = mismatch(pattern.rbegin(), pattern.rend(), word.rbegin()); if (reverse_match) { if (res.first != word.rend()) { matches = +1; cout << word << endl; } } else if (res.first == word.rend()) { matches = +1; cout << word << endl; } } break; case EMBEDDED: if (reverse_match) { if (!pattern.find(word) != string::npos) { matches += 1; cout << word << endl;} } else if (pattern.find(word) != string::npos) { matches += 1; cout << word << endl; } break; } } return (matches == 0) ? 1 : 0; } Thanks in advance!

    Read the article

  • Retrieving Json Array

    - by Rahul Varma
    Hi, I am trying to retrieve the values from the following url: http://rentopoly.com/ajax.php?query=Bo. I want to get the values of all the suggestions to be displayed in a list view one by one. This is how i want to do... public class AlertsAdd { public ArrayList<JSONObject> retrieveJSONArray(String urlString) { String result = queryRESTurl(urlString); ArrayList<JSONObject> ALERTS = new ArrayList<JSONObject>(); if (result != null) { try { JSONObject json = new JSONObject(result); JSONArray alertsArray = json.getJSONArray("suggestions"); for (int a = 0; a < alertsArray.length(); a++) { JSONObject alertitem = alertsArray.getJSONObject(a); ALERTS.add(alertitem); } return ALERTS; } catch (JSONException e) { Log.e("JSON", "There was an error parsing the JSON", e); } } JSONObject myObject = new JSONObject(); try { myObject.put("suggestions",myObject.getJSONArray("suggestions")); ALERTS.add(myObject); } catch (JSONException e1) { Log.e("JSON", "There was an error creating the JSONObject", e1); } return ALERTS; } private String queryRESTurl(String url) { // URLConnection connection; HttpClient httpclient = new DefaultHttpClient(); HttpGet httpget = new HttpGet(url); HttpResponse response; try { response = httpclient.execute(httpget); HttpEntity entity = response.getEntity(); if (entity != null) { InputStream instream = entity.getContent(); String result = convertStreamToString(instream); instream.close(); return result; } } catch (ClientProtocolException e) { Log.e("REST", "There was a protocol based error", e); } catch (IOException e) { Log.e("REST", "There was an IO Stream related error", e); } return null; } /** * To convert the InputStream to String we use the * BufferedReader.readLine() method. We iterate until the BufferedReader * return null which means there's no more data to read. Each line will * appended to a StringBuilder and returned as String. */ private String convertStreamToString(InputStream is) { BufferedReader reader = new BufferedReader(new InputStreamReader(is)); StringBuilder sb = new StringBuilder(); String line = null; try { while ((line = reader.readLine()) != null) { sb.append(line + "\n"); } } catch (IOException e) { e.printStackTrace(); } finally { try { is.close(); } catch (IOException e) { e.printStackTrace(); } } return sb.toString(); } } Here's the adapter code... public class AlertsAdapter extends ArrayAdapter<JSONObject> { public AlertsAdapter(Activity activity, List<JSONObject> alerts) { super(activity, 0, alerts); } @Override public View getView(int position, View convertView, ViewGroup parent) { Activity activity = (Activity) getContext(); LayoutInflater inflater = activity.getLayoutInflater(); View rowView = inflater.inflate(R.layout.list_text, null); JSONObject imageAndText = getItem(position); TextView textView = (TextView) rowView.findViewById(R.id.last_build_stat); try { textView.setText((String)imageAndText.get("suggestions")); } catch (JSONException e) { textView.setText("JSON Exception"); } return rowView; } } Here's the logcat... 04-30 13:09:46.656: INFO/ActivityManager(584): Starting activity: Intent { act=android.intent.action.MAIN cat=[android.intent.category.LAUNCHER] flg=0x10000000 cmp=com.WorldToyota/.Alerts } 04-30 13:09:50.417: ERROR/JSON(924): There was an error parsing the JSON 04-30 13:09:50.417: ERROR/JSON(924): org.json.JSONException: JSONArray[0] is not a JSONObject. 04-30 13:09:50.417: ERROR/JSON(924): at org.json.JSONArray.getJSONObject(JSONArray.java:268) 04-30 13:09:50.417: ERROR/JSON(924): at com.WorldToyota.AlertsAdd.retrieveJSONArray(AlertsAdd.java:30) 04-30 13:09:50.417: ERROR/JSON(924): at com.WorldToyota.Alerts.onCreate(Alerts.java:20) 04-30 13:09:50.417: ERROR/JSON(924): at android.app.Instrumentation.callActivityOnCreate(Instrumentation.java:1123) 04-30 13:09:50.417: ERROR/JSON(924): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:2364) 04-30 13:09:50.417: ERROR/JSON(924): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:2417) 04-30 13:09:50.417: ERROR/JSON(924): at android.app.ActivityThread.access$2100(ActivityThread.java:116) 04-30 13:09:50.417: ERROR/JSON(924): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:1794) 04-30 13:09:50.417: ERROR/JSON(924): at android.os.Handler.dispatchMessage(Handler.java:99) 04-30 13:09:50.417: ERROR/JSON(924): at android.os.Looper.loop(Looper.java:123) 04-30 13:09:50.417: ERROR/JSON(924): at android.app.ActivityThread.main(ActivityThread.java:4203) 04-30 13:09:50.417: ERROR/JSON(924): at java.lang.reflect.Method.invokeNative(Native Method) 04-30 13:09:50.417: ERROR/JSON(924): at java.lang.reflect.Method.invoke(Method.java:521) 04-30 13:09:50.417: ERROR/JSON(924): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:791) 04-30 13:09:50.417: ERROR/JSON(924): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:549) 04-30 13:09:50.417: ERROR/JSON(924): at dalvik.system.NativeStart.main(Native Method) 04-30 13:09:50.688: ERROR/JSON(924): There was an error creating the JSONObject 04-30 13:09:50.688: ERROR/JSON(924): org.json.JSONException: JSONObject["suggestions"] not found. 04-30 13:09:50.688: ERROR/JSON(924): at org.json.JSONObject.get(JSONObject.java:287) 04-30 13:09:50.688: ERROR/JSON(924): at org.json.JSONObject.getJSONArray(JSONObject.java:362) 04-30 13:09:50.688: ERROR/JSON(924): at com.WorldToyota.AlertsAdd.retrieveJSONArray(AlertsAdd.java:41) 04-30 13:09:50.688: ERROR/JSON(924): at com.WorldToyota.Alerts.onCreate(Alerts.java:20) 04-30 13:09:50.688: ERROR/JSON(924): at android.app.Instrumentation.callActivityOnCreate(Instrumentation.java:1123) 04-30 13:09:50.688: ERROR/JSON(924): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:2364) 04-30 13:09:50.688: ERROR/JSON(924): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:2417) 04-30 13:09:50.688: ERROR/JSON(924): at android.app.ActivityThread.access$2100(ActivityThread.java:116) 04-30 13:09:50.688: ERROR/JSON(924): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:1794) 04-30 13:09:50.688: ERROR/JSON(924): at android.os.Handler.dispatchMessage(Handler.java:99) 04-30 13:09:50.688: ERROR/JSON(924): at android.os.Looper.loop(Looper.java:123) 04-30 13:09:50.688: ERROR/JSON(924): at android.app.ActivityThread.main(ActivityThread.java:4203) 04-30 13:09:50.688: ERROR/JSON(924): at java.lang.reflect.Method.invokeNative(Native Method) 04-30 13:09:50.688: ERROR/JSON(924): at java.lang.reflect.Method.invoke(Method.java:521) 04-30 13:09:50.688: ERROR/JSON(924): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:791) 04-30 13:09:50.688: ERROR/JSON(924): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:549) 04-30 13:09:50.688: ERROR/JSON(924): at dalvik.system.NativeStart.main(Native Method) Plz help me parsing this script and displaying the values in list format....

    Read the article

  • ASP.NET. MVC2. Entity Framework. Cannot pass primary key value back from view to [HttpPost]

    - by Paul Connolly
    I pass a ViewModel (which contains a "Person" object) from the "EditPerson" controller action into the view. When posted back from the view, the ActionResult receives all of the Person properties except the ID (which it says is zero instead of say its real integer) Can anyone tell me why? The controllers look like this: public ActionResult EditPerson(int personID) { var personToEdit = repository.GetPerson(personID); FormationViewModel vm = new FormationViewModel(); vm.Person = personToEdit; return View(vm); } [HttpPost] public ActionResult EditPerson(FormationViewModel model) <<Passes in all properties except ID { // Persistence code } The View looks like this: <%@ Page Title="" Language="C#" MasterPageFile="~/Views/Shared/Site.Master" Inherits="System.Web.Mvc.ViewPage<Afp.Models.Formation.FormationViewModel>" %> <% using (Html.BeginForm()) {% <%= Html.ValidationSummary(true) % <fieldset> <legend>Fields</legend> <div class="editor-label"> <%= Html.LabelFor(model => model.Person.Title) %> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Person.Title) %> <%= Html.ValidationMessageFor(model => model.Person.Title) %> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.Person.Forename)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Person.Forename)%> <%= Html.ValidationMessageFor(model => model.Person.Forename)%> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.Person.Surname)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Person.Surname)%> <%= Html.ValidationMessageFor(model => model.Person.Surname)%> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.DOB) %> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.DOB, String.Format("{0:g}", Model.DOB)) <%= Html.ValidationMessageFor(model => model.DOB) %> </div>--%> <div class="editor-label"> <%= Html.LabelFor(model => model.Person.Nationality)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Person.Nationality)%> <%= Html.ValidationMessageFor(model => model.Person.Nationality)%> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.Person.Occupation)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Person.Occupation)%> <%= Html.ValidationMessageFor(model => model.Person.Occupation)%> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.Person.CountryOfResidence)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Person.CountryOfResidence)%> <%= Html.ValidationMessageFor(model => model.Person.CountryOfResidence)%> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.Person.PreviousNameForename)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Person.PreviousNameForename)%> <%= Html.ValidationMessageFor(model => model.Person.PreviousNameForename)%> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.Person.PreviousSurname)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Person.PreviousSurname)%> <%= Html.ValidationMessageFor(model => model.Person.PreviousSurname)%> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.Person.Email)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Person.Email)%> <%= Html.ValidationMessageFor(model => model.Person.Email)%> </div> <p> <input type="submit" value="Save" /> </p> </fieldset> <% } % And the Person class looks like: [MetadataType(typeof(Person_Validation))] public partial class Person { public Person() { } } [Bind(Exclude = "ID")] public class Person_Validation { public int ID { get; private set; } public string Title { get; set; } public string Forename { get; set; } public string Surname { get; set; } public System.DateTime DOB { get; set; } public string Nationality { get; set; } public string Occupation { get; set; } public string CountryOfResidence { get; set; } public string PreviousNameForename { get; set; } public string PreviousSurname { get; set; } public string Email { get; set; } } And ViewModel: public class FormationViewModel { public Company Company { get; set; } public Address RegisteredAddress { get; set; } public Person Person { get; set; } public PersonType PersonType { get; set; } public int CurrentStep { get; set; } } }

    Read the article

  • creating objects from trivial graph format text file. java. dijkstra algorithm.

    - by user560084
    i want to create objects, vertex and edge, from trivial graph format txt file. one of programmers here suggested that i use trivial graph format to store data for dijkstra algorithm. the problem is that at the moment all the information, e.g., weight, links, is in the sourcecode. i want to have a separate text file for that and read it into the program. i thought about using a code for scanning through the text file by using scanner. but i am not quite sure how to create different objects from the same file. could i have some help please? the file is v0 Harrisburg v1 Baltimore v2 Washington v3 Philadelphia v4 Binghamton v5 Allentown v6 New York # v0 v1 79.83 v0 v5 81.15 v1 v0 79.75 v1 v2 39.42 v1 v3 103.00 v2 v1 38.65 v3 v1 102.53 v3 v5 61.44 v3 v6 96.79 v4 v5 133.04 v5 v0 81.77 v5 v3 62.05 v5 v4 134.47 v5 v6 91.63 v6 v3 97.24 v6 v5 87.94 and the dijkstra algorithm code is Downloaded from: http://en.literateprograms.org/Special:Downloadcode/Dijkstra%27s_algorithm_%28Java%29 */ import java.util.PriorityQueue; import java.util.List; import java.util.ArrayList; import java.util.Collections; class Vertex implements Comparable<Vertex> { public final String name; public Edge[] adjacencies; public double minDistance = Double.POSITIVE_INFINITY; public Vertex previous; public Vertex(String argName) { name = argName; } public String toString() { return name; } public int compareTo(Vertex other) { return Double.compare(minDistance, other.minDistance); } } class Edge { public final Vertex target; public final double weight; public Edge(Vertex argTarget, double argWeight) { target = argTarget; weight = argWeight; } } public class Dijkstra { public static void computePaths(Vertex source) { source.minDistance = 0.; PriorityQueue<Vertex> vertexQueue = new PriorityQueue<Vertex>(); vertexQueue.add(source); while (!vertexQueue.isEmpty()) { Vertex u = vertexQueue.poll(); // Visit each edge exiting u for (Edge e : u.adjacencies) { Vertex v = e.target; double weight = e.weight; double distanceThroughU = u.minDistance + weight; if (distanceThroughU < v.minDistance) { vertexQueue.remove(v); v.minDistance = distanceThroughU ; v.previous = u; vertexQueue.add(v); } } } } public static List<Vertex> getShortestPathTo(Vertex target) { List<Vertex> path = new ArrayList<Vertex>(); for (Vertex vertex = target; vertex != null; vertex = vertex.previous) path.add(vertex); Collections.reverse(path); return path; } public static void main(String[] args) { Vertex v0 = new Vertex("Nottinghill_Gate"); Vertex v1 = new Vertex("High_Street_kensignton"); Vertex v2 = new Vertex("Glouchester_Road"); Vertex v3 = new Vertex("South_Kensignton"); Vertex v4 = new Vertex("Sloane_Square"); Vertex v5 = new Vertex("Victoria"); Vertex v6 = new Vertex("Westminster"); v0.adjacencies = new Edge[]{new Edge(v1, 79.83), new Edge(v6, 97.24)}; v1.adjacencies = new Edge[]{new Edge(v2, 39.42), new Edge(v0, 79.83)}; v2.adjacencies = new Edge[]{new Edge(v3, 38.65), new Edge(v1, 39.42)}; v3.adjacencies = new Edge[]{new Edge(v4, 102.53), new Edge(v2, 38.65)}; v4.adjacencies = new Edge[]{new Edge(v5, 133.04), new Edge(v3, 102.53)}; v5.adjacencies = new Edge[]{new Edge(v6, 81.77), new Edge(v4, 133.04)}; v6.adjacencies = new Edge[]{new Edge(v0, 97.24), new Edge(v5, 81.77)}; Vertex[] vertices = { v0, v1, v2, v3, v4, v5, v6 }; computePaths(v0); for (Vertex v : vertices) { System.out.println("Distance to " + v + ": " + v.minDistance); List<Vertex> path = getShortestPathTo(v); System.out.println("Path: " + path); } } } and the code for scanning file is import java.util.Scanner; import java.io.File; import java.io.FileNotFoundException; public class DataScanner1 { //private int total = 0; //private int distance = 0; private String vector; private String stations; private double [] Edge = new double []; /*public int getTotal(){ return total; } */ /* public void getMenuInput(){ KeyboardInput in = new KeyboardInput; System.out.println("Enter the destination? "); String val = in.readString(); return val; } */ public void readFile(String fileName) { try { Scanner scanner = new Scanner(new File(fileName)); scanner.useDelimiter (System.getProperty("line.separator")); while (scanner.hasNext()) { parseLine(scanner.next()); } scanner.close(); } catch (FileNotFoundException e) { e.printStackTrace(); } } public void parseLine(String line) { Scanner lineScanner = new Scanner(line); lineScanner.useDelimiter("\\s*,\\s*"); vector = lineScanner.next(); stations = lineScanner.next(); System.out.println("The current station is " + vector + " and the destination to the next station is " + stations + "."); //total += distance; //System.out.println("The total distance is " + total); } public static void main(String[] args) { /* if (args.length != 1) { System.err.println("usage: java TextScanner2" + "file location"); System.exit(0); } */ DataScanner1 scanner = new DataScanner1(); scanner.readFile(args[0]); //int total =+ distance; //System.out.println(""); //System.out.println("The total distance is " + scanner.getTotal()); } }

    Read the article

  • Font serialization in vb.net

    - by jovany
    Hello all, as the title says , I need to serialize my font. I have tried the following approach unfortunately to no avail. This is what I have and what happens; I have a drawing application and certain variables and properties need to be serialized. (So , Xml.Serialization has been used.) Now this has already been done in a huge portion and I've created some other attributes which needed to be serialized and it works. There is one base class and classes such as drawablestar, drawableeclipse ,etc. all inherit from this class. As does my drawabletextboxclass. The base class is Serializable as can be seen in the sample below. It looks like this... Imports System.Xml.Serialization <Serializable()> _ Public MustInherit Class Drawable ' Drawing characteristics. 'Font characteristics <XmlIgnore()> Public FontFamily As String <XmlIgnore()> Public FontSize As Integer <XmlIgnore()> Public FontType As Integer <XmlIgnore()> Public ForeColor As Color <XmlIgnore()> Public FillColor As Color <XmlAttributeAttribute()> Public LineWidth As Integer = 0 <XmlAttributeAttribute()> Public X1 As Integer <XmlAttributeAttribute()> Public Y1 As Integer <XmlAttributeAttribute()> Public X2 As Integer <XmlAttributeAttribute()> Public Y2 As Integer ' attributes for size textbox <XmlAttributeAttribute()> Public widthLabel As Integer <XmlAttributeAttribute()> Public heightLabel As Integer '<XmlTextAttribute()> Public FontFamily As String '<XmlAttributeAttribute()> Public FontSize As Integer 'this should actually not be here.. <XmlAttributeAttribute()> Public s_InsertLabel As String ' Indicates whether we should draw as selected. <XmlIgnore()> Public IsSelected As Boolean = False ' Constructors. Public Sub New() ForeColor = Color.Black FillColor = Color.White 'FontFamily = "Impact" 'FontSize = 12 End Sub Friend WriteOnly Property _Label() As String Set(ByVal Value As String) s_InsertLabel = Value End Set End Property Public Sub New(ByVal fore_color As Color, ByVal fill_color As Color, Optional ByVal line_width As Integer = 0) LineWidth = line_width ForeColor = fore_color FillColor = fill_color ' FontFamily = Font_Family ' FontSize = Font_Size End Sub ' Property procedures to serialize and ' deserialize ForeColor and FillColor. <XmlAttributeAttribute("ForeColor")> _ Public Property ForeColorArgb() As Integer Get Return ForeColor.ToArgb() End Get Set(ByVal Value As Integer) ForeColor = Color.FromArgb(Value) End Set End Property <XmlAttributeAttribute("BackColor")> _ Public Property FillColorArgb() As Integer Get Return FillColor.ToArgb() End Get Set(ByVal Value As Integer) FillColor = Color.FromArgb(Value) End Set End Property 'Property procedures to serialize and 'deserialize Font <XmlAttributeAttribute("InsertLabel")> _ Public Property InsertLabel_() As String Get Return s_InsertLabel End Get Set(ByVal value As String) s_InsertLabel = value End Set End Property <XmlAttributeAttribute("FontSize")> _ Public Property FontSizeGet() As Integer Get Return FontSize End Get Set(ByVal value As Integer) FontSize = value End Set End Property <XmlAttributeAttribute("FontFamily")> _ Public Property FontFamilyGet() As String Get Return FontFamily End Get Set(ByVal value As String) FontFamily = value End Set End Property <XmlAttributeAttribute("FontType")> _ Public Property FontType_() As Integer Get Return FontType End Get Set(ByVal value As Integer) FontType = value End Set End Property #Region "Methods to override" Public MustOverride Sub Draw(ByVal gr As Graphics) ' Return the object's bounding rectangle. Public MustOverride Function GetBounds() As Rectangle ...... ........ ..... End Class [/code] My textbox class which looks like this , is the one that needs to save it's font. Imports System.Math Imports System.Xml.Serialization Imports System.Windows.Forms <Serializable()> _ Public Class DrawableTextBox Inherits Drawable Private i_StringLength As Integer Private i_StringWidth As Integer Private drawFont As Font = New Font(FontFamily, 12, FontStyle.Regular) Private brsTextColor As Brush = Brushes.Black Private s_insertLabelTextbox As String = "label" ' Constructors. Public Sub New() End Sub Public Sub New(ByVal objCanvas As PictureBox, ByVal fore_color As Color, ByVal fill_color As Color, Optional ByVal line_width As Integer = 0, Optional ByVal new_x1 As Integer = 0, Optional ByVal new_y1 As Integer = 0, Optional ByVal new_x2 As Integer = 1, Optional ByVal new_y2 As Integer = 1) MyBase.New(fore_color, fill_color, line_width) Dim objGraphics As Graphics = objCanvas.CreateGraphics() X1 = new_x1 Y1 = new_y1 'Only rectangles ,circles and stars can resize for now b_Movement b_Movement = True Dim frm As New frmTextbox frm.MyFont = drawFont frm.ShowDialog() If frm.DialogResult = DialogResult.OK Then FontFamily = frm.MyFont.FontFamily.Name FontSize = frm.MyFont.Size FontType = frm.MyFont.Style 'drawFont = frm.MyFont drawFont = New Font(FontFamily, FontSize) drawFont = FontAttributes() brsTextColor = New SolidBrush(frm.txtLabel.ForeColor) s_InsertLabel = frm.txtLabel.Text i_StringLength = s_InsertLabel.Length 'gefixtf Dim objSizeF As SizeF = objGraphics.MeasureString(s_InsertLabel, drawFont, New PointF(X2 - X1, Y2 - Y1), New StringFormat(StringFormatFlags.NoClip)) Dim objPoint As Point = objCanvas.PointToClient(New Point(X1 + objSizeF.Width, Y1 + objSizeF.Height)) widthLabel = objSizeF.Width heightLabel = objSizeF.Height X2 = X1 + widthLabel Y2 = Y1 + heightLabel Else Throw New ApplicationException() End If End Sub ' Draw the object on this Graphics surface. Public Overrides Sub Draw(ByVal gr As System.Drawing.Graphics) ' Make a Rectangle representing this rectangle. Dim rectString As Rectangle rectString = New Rectangle(X1, Y1, widthLabel, heightLabel) rectString = GetBounds() ' See if we're selected. If IsSelected Then gr.DrawString(s_InsertLabel, drawFont, brsTextColor, X1, Y1) 'gr.DrawRectangle(Pens.Black, rect) ' Pens.Transparent gr.DrawRectangle(Pens.Black, rectString) ' Draw grab handles. DrawGrabHandle(gr, X1, Y1) DrawGrabHandle(gr, X1, Y2) DrawGrabHandle(gr, X2, Y2) DrawGrabHandle(gr, X2, Y1) Else gr.DrawString(s_InsertLabel, drawFont, brsTextColor, X1, Y1) 'gr.DrawRectangle(Pens.Black, rect) ' Pens.Transparent gr.DrawRectangle(Pens.Black, rectString) End If End Sub 'get fontattributes Public Function FontAttributes() As Font Return New Font(FontFamily, 12, FontStyle.Regular) End Function ' Return the object's bounding rectangle. Public Overrides Function GetBounds() As System.Drawing.Rectangle Return New Rectangle( _ Min(X1, X1), _ Min(Y1, Y1), _ Abs(widthLabel), _ Abs(heightLabel)) End Function ' Return True if this point is on the object. Public Overrides Function IsAt(ByVal x As Integer, ByVal y As Integer) As Boolean Return (x >= Min(X1, X2)) AndAlso _ (x <= Max(X1, X2)) AndAlso _ (y >= Min(Y1, Y2)) AndAlso _ (y <= Max(Y1, Y2)) End Function ' Move the second point. Public Overrides Sub NewPoint(ByVal x As Integer, ByVal y As Integer) X2 = x Y2 = y End Sub ' Return True if the object is empty (e.g. a zero-length line). Public Overrides Function IsEmpty() As Boolean Return (X1 = X2) AndAlso (Y1 = Y2) End Function End Class The coordinates ( X1 ,X2,Y1, Y2 ) are needed to draw a circle , rectangle etc. ( in the other classes ).This all works. If I load my saved file it shows me the correct location and correct size of drawn objects. If I open my xml file I can see all values are correctly saved ( including my FontFamily ). Also the color which can be adjusted is saved and then properly displayed when I load a previously saved drawing. Of course because the coordinates work, if I insert a textField ,the location where it is being displayed is correct. However here comes the problem , my fontSize and fontfamily don't work. As you can see I created them in the base class, However this does not work. Is my approach completely off? What can I do ? Before saving img14.imageshack.us/i/beforeos.jpg/ After loading the Font jumps back to Sans serif and size 12. I could really use some help here.. Edit: I've been using the sample from this website http://www.vb-helper.com/howto_net_drawing_framework.html

    Read the article

  • In Flex, how to drag a component into a column of DataGrid (not the whole DataGrid)?

    - by Yousui
    Hi guys, I have a custom component: <?xml version="1.0" encoding="utf-8"?> <s:Group xmlns:fx="http://ns.adobe.com/mxml/2009" xmlns:s="library://ns.adobe.com/flex/spark" xmlns:mx="library://ns.adobe.com/flex/mx"> <fx:Declarations> </fx:Declarations> <fx:Script> <![CDATA[ [Bindable] public var label:String = "don't know"; [Bindable] public var imageName:String = "x.gif"; ]]> </fx:Script> <s:HGroup paddingLeft="8" paddingTop="8" paddingRight="8" paddingBottom="8"> <mx:Image id="img" source="assets/{imageName}" /> <s:Label text="{label}"/> </s:HGroup> </s:Group> and a custom render, which will be used in my DataGrid: <?xml version="1.0" encoding="utf-8"?> <s:MXDataGridItemRenderer xmlns:fx="http://ns.adobe.com/mxml/2009" xmlns:s="library://ns.adobe.com/flex/spark" xmlns:mx="library://ns.adobe.com/flex/mx" focusEnabled="true" xmlns:components="components.*"> <s:VGroup> <components:Person label="{dataGridListData.label}"> </components:Person> </s:VGroup> </s:MXDataGridItemRenderer> This is my application: <?xml version="1.0" encoding="utf-8"?> <s:Application xmlns:fx="http://ns.adobe.com/mxml/2009" xmlns:s="library://ns.adobe.com/flex/spark" xmlns:mx="library://ns.adobe.com/flex/mx" minWidth="955" minHeight="600" xmlns:services="services.*"> <s:layout> <s:VerticalLayout/> </s:layout> <fx:Script> <![CDATA[ import mx.collections.ArrayCollection; import mx.controls.Alert; import mx.controls.Image; import mx.rpc.events.ResultEvent; import mx.utils.ArrayUtil; ]]> </fx:Script> <fx:Declarations> <fx:XMLList id="employees"> <employee> <name>Christina Coenraets</name> <phone>555-219-2270</phone> <email>[email protected]</email> <active>true</active> <image>assets/001.png</image> </employee> <employee> <name>Joanne Wall</name> <phone>555-219-2012</phone> <email>[email protected]</email> <active>true</active> <image>assets/002.png</image> </employee> <employee> <name>Maurice Smith</name> <phone>555-219-2012</phone> <email>[email protected]</email> <active>false</active> <image>assets/003.png</image> </employee> <employee> <name>Mary Jones</name> <phone>555-219-2000</phone> <email>[email protected]</email> <active>true</active> <image>assets/004.png</image> </employee> </fx:XMLList> </fx:Declarations> <s:HGroup> <mx:DataGrid dataProvider="{employees}" width="100%" dropEnabled="true"> <mx:columns> <mx:DataGridColumn headerText="Employee Name" dataField="name"/> <mx:DataGridColumn headerText="Email" dataField="email"/> <mx:DataGridColumn headerText="Image" dataField="image" itemRenderer="renderers.render1"/> </mx:columns> </mx:DataGrid> <s:List dragEnabled="true" dragMoveEnabled="false"> <s:dataProvider> <s:ArrayCollection> <fx:String>aaa</fx:String> <fx:String>bbb</fx:String> <fx:String>ccc</fx:String> <fx:String>ddd</fx:String> </s:ArrayCollection> </s:dataProvider> </s:List> </s:HGroup> </s:Application> Now what I want to do is let the user drag an one or more item from the left List component and drop at the third column of the DataGrid, then using the dragged data to create another <components:Person /> object. So in the final result, maybe the first line contains just one <components:Person /> object at the third column, the second line contains two <components:Person /> object at the third column and so on. Can this be implemented in Flex? How? Great thanks.

    Read the article

  • Optimizing sorting container of objects with heap-allocated buffers - how to avoid hard-copying buff

    - by Kache4
    I was making sure I knew how to do the op= and copy constructor correctly in order to sort() properly, so I wrote up a test case. After getting it to work, I realized that the op= was hard-copying all the data_. I figure if I wanted to sort a container with this structure (its elements have heap allocated char buffer arrays), it'd be faster to just swap the pointers around. Is there a way to do that? Would I have to write my own sort/swap function? #include <deque> //#include <string> //#include <utility> //#include <cstdlib> #include <cstring> #include <iostream> //#include <algorithm> // I use sort(), so why does this still compile when commented out? #include <boost/filesystem.hpp> #include <boost/foreach.hpp> using namespace std; namespace fs = boost::filesystem; class Page { public: // constructor Page(const char* path, const char* data, int size) : path_(fs::path(path)), size_(size), data_(new char[size]) { // cout << "Creating Page..." << endl; strncpy(data_, data, size); // cout << "done creating Page..." << endl; } // copy constructor Page(const Page& other) : path_(fs::path(other.path())), size_(other.size()), data_(new char[other.size()]) { // cout << "Copying Page..." << endl; strncpy(data_, other.data(), size_); // cout << "done copying Page..." << endl; } // destructor ~Page() { delete[] data_; } // accessors const fs::path& path() const { return path_; } const char* data() const { return data_; } int size() const { return size_; } // operators Page& operator = (const Page& other) { if (this == &other) return *this; char* newImage = new char[other.size()]; strncpy(newImage, other.data(), other.size()); delete[] data_; data_ = newImage; path_ = fs::path(other.path()); size_ = other.size(); return *this; } bool operator < (const Page& other) const { return path_ < other.path(); } private: fs::path path_; int size_; char* data_; }; class Book { public: Book(const char* path) : path_(fs::path(path)) { cout << "Creating Book..." << endl; cout << "pushing back #1" << endl; pages_.push_back(Page("image1.jpg", "firstImageData", 14)); cout << "pushing back #3" << endl; pages_.push_back(Page("image3.jpg", "thirdImageData", 14)); cout << "pushing back #2" << endl; pages_.push_back(Page("image2.jpg", "secondImageData", 15)); cout << "testing operator <" << endl; cout << pages_[0].path().string() << (pages_[0] < pages_[1]? " < " : " > ") << pages_[1].path().string() << endl; cout << pages_[1].path().string() << (pages_[1] < pages_[2]? " < " : " > ") << pages_[2].path().string() << endl; cout << pages_[0].path().string() << (pages_[0] < pages_[2]? " < " : " > ") << pages_[2].path().string() << endl; cout << "sorting" << endl; BOOST_FOREACH (Page p, pages_) cout << p.path().string() << endl; sort(pages_.begin(), pages_.end()); cout << "done sorting\n"; BOOST_FOREACH (Page p, pages_) cout << p.path().string() << endl; cout << "checking datas" << endl; BOOST_FOREACH (Page p, pages_) { char data[p.size() + 1]; strncpy((char*)&data, p.data(), p.size()); data[p.size()] = '\0'; cout << p.path().string() << " " << data << endl; } cout << "done Creating Book" << endl; } private: deque<Page> pages_; fs::path path_; }; int main() { Book* book = new Book("/some/path/"); }

    Read the article

  • Need help with copy constructor for very basic implementation of singly linked lists

    - by Jesus
    Last week, we created a program that manages sets of strings, using classes and vectors. I was able to complete this 100%. This week, we have to replace the vector we used to store strings in our class with simple singly linked lists. The function basically allows users to declare sets of strings that are empty, and sets with only one element. In the main file, there is a vector whose elements are a struct that contain setName and strSet (class). HERE IS MY PROBLEM: It deals with the copy constructor of the class. When I remove/comment out the copy constructor, I can declare as many empty or single sets as I want, and output their values without a problem. But I know I will obviously need the copy constructor for when I implement the rest of the program. When I leave the copy constructor in, I can declare one set, either single or empty, and output its value. But if I declare a 2nd set, and i try to output either of the first two sets, i get a Segmentation Fault. Moreover, if i try to declare more then 2 sets, I get a Segmentation Fault. Any help would be appreciated!! Here is my code for a very basic implementation of everything: Here is the setcalc.cpp: (main file) #include <iostream> #include <cctype> #include <cstring> #include <string> #include "help.h" #include "strset2.h" using namespace std; // Declares of structure to hold all the sets defined struct setsOfStr { string nameOfSet; strSet stringSet; }; // Checks if the set name inputted is unique bool isSetNameUnique( vector<setsOfStr> strSetArr, string setName) { for(unsigned int i = 0; i < strSetArr.size(); i++) { if( strSetArr[i].nameOfSet == setName ) { return false; } } return true; } int main(int argc, char *argv[]) { char commandChoice; // Declares a vector with our declared structure as the type vector<setsOfStr> strSetVec; string setName; string singleEle; // Sets a loop that will constantly ask for a command until 'q' is typed while (1) { // declaring a set to be empty if(commandChoice == 'd') { cin >> setName; // Check that the set name inputted is unique if (isSetNameUnique(strSetVec, setName) == true) { strSet emptyStrSet; setsOfStr set1; set1.nameOfSet = setName; set1.stringSet = emptyStrSet; strSetVec.push_back(set1); } else { cerr << "ERROR: Re-declaration of set '" << setName << "'\n"; } } // declaring a set to be a singleton else if(commandChoice == 's') { cin >> setName; cin >> singleEle; // Check that the set name inputted is unique if (isSetNameUnique(strSetVec, setName) == true) { strSet singleStrSet(singleEle); setsOfStr set2; set2.nameOfSet = setName; set2.stringSet = singleStrSet; strSetVec.push_back(set2); } else { cerr << "ERROR: Re-declaration of set '" << setName << "'\n"; } } // using the output function else if(commandChoice == 'o') { cin >> setName; if(isSetNameUnique(strSetVec, setName) == false) { // loop through until the set name is matched and call output on its strSet for(unsigned int k = 0; k < strSetVec.size(); k++) { if( strSetVec[k].nameOfSet == setName ) { (strSetVec[k].stringSet).output(); } } } else { cerr << "ERROR: No such set '" << setName << "'\n"; } } // quitting else if(commandChoice == 'q') { break; } else { cerr << "ERROR: Ignoring bad command: '" << commandChoice << "'\n"; } } return 0; } Here is the strSet2.h: #ifndef _STRSET_ #define _STRSET_ #include <iostream> #include <vector> #include <string> struct node { std::string s1; node * next; }; class strSet { private: node * first; public: strSet (); // Create empty set strSet (std::string s); // Create singleton set strSet (const strSet &copy); // Copy constructor // will implement destructor later void output() const; strSet& operator = (const strSet& rtSide); // Assignment }; // End of strSet class #endif // _STRSET_ And here is the strSet2.cpp (implementation of class) #include <iostream> #include <vector> #include <string> #include "strset2.h" using namespace std; strSet::strSet() { first = NULL; } strSet::strSet(string s) { node *temp; temp = new node; temp->s1 = s; temp->next = NULL; first = temp; } strSet::strSet(const strSet& copy) { cout << "copy-cst\n"; node *n = copy.first; node *prev = NULL; while (n) { node *newNode = new node; newNode->s1 = n->s1; newNode->next = NULL; if (prev) { prev->next = newNode; } else { first = newNode; } prev = newNode; n = n->next; } } void strSet::output() const { if(first == NULL) { cout << "Empty set\n"; } else { node *temp; temp = first; while(1) { cout << temp->s1 << endl; if(temp->next == NULL) break; temp = temp->next; } } } strSet& strSet::operator = (const strSet& rtSide) { first = rtSide.first; return *this; }

    Read the article

  • Httpsession with Spring 3 MVC

    - by vipul12389
    I want to use httpsession in Spring 3 MVC..i have searched all the web and got this solution..at http://forum.springsource.org/showthread.php?98850-Adding-to-stuff-to-the-session-while-using-ResponseBody Basically, My application auto authenticates user by getting winId and authorizes through LDAP..(Its a intranet site) Here is the flow of the application, 1. User enters Aplication url (http://localhost:8082/eIA_Mock_5) it has a welcome page (index.jsp) Index.jsp gets winId through jQuery and hits login.html (through Ajax) and passes windowsId login.html (Controller) authenticates through LDAP and gives back 'Valid' String as a response javascript, upon getting the correct response, redirects/loads welcome page i.e. goes to localhost:8082/eIA_Mock_5/welcome.html Now, i have filter associated with it..which checks for is session valid for each incoming request..Now the problem is even though i set data on to httpsession, yet the filter or any other controller fails to get the data through session as a result it doesnt proceeds further.. here is the code..and could you suggest what is wrong actually ?? Home_Controller.java @Controller public class Home_Controller { public static Log logger = LogFactory.getLog(Home_Controller.class); @RequestMapping(value={"/welcome"}) public ModelAndView loadWelcomePage(HttpServletRequest request,HttpServletResponse response) { ModelAndView mdv = new ModelAndView(); try{ /*HttpSession session = request.getSession(); UserMasterBean userBean = (UserMasterBean)session.getAttribute("userBean"); String userName=userBean.getWindowsId(); if(userName==null || userName.equalsIgnoreCase("")) { mdv.setViewName("homePage"); System.out.println("Unable to authenticate user "); logger.debug("Unable to authenticate user "); } else { System.out.println("Welcome User "+userName); logger.debug("Welcome User "+userName); */ mdv.setViewName("homePage"); /*}*/ } catch(Exception e){ logger.debug("inside authenticateUser ",e); e.printStackTrace(); } return mdv; } @RequestMapping(value = "/login", method = RequestMethod.GET) public @ResponseBody String authenticateUser(@RequestParam String userName,HttpSession session) { logger.debug("inside authenticateUser"); String returnResponse=new String(); try{ logger.debug("userName for Authentication "+userName); System.out.println("userName for Authentication "+userName); //HttpSession session = request.getSession(); if(userName==null || userName.trim().equalsIgnoreCase("")) returnResponse="Invalid"; else { System.out.println("uname "+userName); String ldapResponse = LDAPConnectUtil.isValidActiveDirectoryUser(userName, ""); if(ldapResponse.equalsIgnoreCase("true")) { returnResponse="Valid"; System.out.println(userName+" Authenticated"); logger.debug(userName+" Authenticated"); UserMasterBean userBean = new UserMasterBean(); userBean.setWindowsId(userName); //if(session.getAttribute("userBean")==null) session.setAttribute("userBean", userBean); } else { returnResponse="Invalid"; //session.setAttribute("userBean", null); System.out.println("Unable to Authenticate the user through Ldap"); logger.debug("Unable to Authenticate the user through Ldap"); } System.out.println("ldapResponse "+ldapResponse); logger.debug("ldapResponse "+ldapResponse); System.out.println("returnResponse "+returnResponse); } UserMasterBean u = (UserMasterBean)session.getAttribute("userBean"); System.out.println("winId "+u.getWindowsId()); } catch(Exception e){ e.printStackTrace(); logger.debug("Exception in authenticateUser ",e); } return returnResponse; } Filter public void doFilter(ServletRequest request, ServletResponse response, FilterChain chain) { System.out.println("in PageFilter"); boolean flag = false; HttpServletRequest objHttpServletRequest = (HttpServletRequest)request; HttpServletResponse objHttpServletResponse = (HttpServletResponse)response; HttpSession session = objHttpServletRequest.getSession(); String contextPath = objHttpServletRequest.getContextPath(); String servletPath = objHttpServletRequest.getSession().getServletContext().getRealPath(objHttpServletRequest.getServletPath()); logger.debug("contextPath :" + contextPath); logger.debug("servletPath :" + servletPath); System.out.println("in PageFilter, contextPath :" + contextPath); System.out.println("in PageFilter, servletPath :" + servletPath); if (servletPath.endsWith("\\") || servletPath.endsWith("/") || servletPath.indexOf("css") > 0 || servletPath.indexOf("jsp") > 0 || servletPath.indexOf("images") > 0 || servletPath.indexOf("js") > 0 || servletPath.endsWith("index.jsp") || servletPath.indexOf("xls") > 0 || servletPath.indexOf("ini") > 0 || servletPath.indexOf("login.html") > 0 || /*servletPath.endsWith("welcome.html") ||*/ servletPath.endsWith("logout.do") ) { System.out.println("User is trying to access allowed pages like Login.jsp, errorPage.jsp, js, images, css"); logger.debug("User is trying to access allowed pages like Login.jsp, errorPage.jsp, js, images, css"); flag = true; } if (flag== false) { System.out.println("flag = false"); if(session.getAttribute("userBean") == null) System.out.println("yes session.userbean is null"); if ((session != null) && (session.getAttribute("userBean") != null)) { System.out.println("session!=null && session.getAttribute(userId)!=null"); logger.debug("IF Part"); UserMasterBean userBean = (UserMasterBean)session.getAttribute("userBean"); String windowsId = userBean.getWindowsId(); logger.debug("User Id " + windowsId + " allowed access"); System.out.println("User Id " + windowsId + " allowed access"); flag = true; } else { System.out.println("else .....session!=null && session.getAttribute(userId)!=null"); logger.debug("Else Part"); flag = false; } } if (flag == true) { try { System.out.println("before chain.doFilter(request, response)"); chain.doFilter(request, response); } catch (Exception e) { e.printStackTrace(); try { objHttpServletResponse.sendRedirect(contextPath + "/logout.do"); } catch (Exception ex) { ex.printStackTrace(); } } } else { try { System.out.println("before sendRedirect"); objHttpServletResponse.sendRedirect(contextPath + "/jsp/errorPage.jsp"); } catch (Exception ex) { ex.printStackTrace(); } } System.out.println("end of PageFilter"); } Index.jsp <script type="text/javascript"> //alert("inside s13"); var WinNetwork = new ActiveXObject("WScript.Network"); var userName=WinNetwork.UserName; alert(userName); $.ajax({ url : "login.html", data : "userName="+userName, success : function(result) { alert("result == "+result); if(result=="Valid") window.location = "http://10.160.118.200:8082/eIA_Mock_5/welcome.html"; } }); </script> web.xml has a filter entry with URL pattern as * I am using spring 3 mvc

    Read the article

  • Trouble calling a method from an external class

    - by Bradley Hobbs
    Here is my employee database program: import java.util.*; import java.io.*; import java.io.File; import java.io.FileReader; import java.util.ArrayList; public class P { //Instance Variables private static String empName; private static String wage; private static double wages; private static double salary; private static double numHours; private static double increase; // static ArrayList<String> ARempName = new ArrayList<String>(); // static ArrayList<Double> ARwages = new ArrayList<Double>(); // static ArrayList<Double> ARsalary = new ArrayList<Double>(); static ArrayList<Employee> emp = new ArrayList<Employee>(); public static void main(String[] args) throws Exception { clearScreen(); printMenu(); question(); exit(); } public static void printArrayList(ArrayList<Employee> emp) { for (int i = 0; i < emp.size(); i++){ System.out.println(emp.get(i)); } } public static void clearScreen() { System.out.println("\u001b[H\u001b[2J"); } private static void exit() { System.exit(0); } private static void printMenu() { System.out.println("\t------------------------------------"); System.out.println("\t|Commands: n - New employee |"); System.out.println("\t| c - Compute paychecks |"); System.out.println("\t| r - Raise wages |"); System.out.println("\t| p - Print records |"); System.out.println("\t| d - Download data |"); System.out.println("\t| u - Upload data |"); System.out.println("\t| q - Quit |"); System.out.println("\t------------------------------------"); System.out.println(""); } public static void question() { System.out.print("Enter command: "); Scanner q = new Scanner(System.in); String input = q.nextLine(); input.replaceAll("\\s","").toLowerCase(); boolean valid = (input.equals("n") || input.equals("c") || input.equals("r") || input.equals("p") || input.equals("d") || input.equals("u") || input.equals("q")); if (!valid){ System.out.println("Command was not recognized; please try again."); printMenu(); question(); } else if (input.equals("n")){ System.out.print("Enter the name of new employee: "); Scanner stdin = new Scanner(System.in); empName = stdin.nextLine(); System.out.print("Hourly (h) or salaried (s): "); Scanner stdin2 = new Scanner(System.in); wage = stdin2.nextLine(); wage.replaceAll("\\s","").toLowerCase(); if (!(wage.equals("h") || wage.equals("s"))){ System.out.println("Input was not h or s; please try again"); } else if (wage.equals("h")){ System.out.print("Enter hourly wage: "); Scanner stdin4 = new Scanner(System.in); wages = stdin4.nextDouble(); Employee emp1 = new HourlyEmployee(empName, wages); emp.add(emp1); printMenu(); question();} else if (wage.equals("s")){ System.out.print("Enter annual salary: "); Scanner stdin5 = new Scanner(System.in); salary = stdin5.nextDouble(); Employee emp1 = new SalariedEmployee(empName, salary); printMenu(); question();}} else if (input.equals("c")){ for (int i = 0; i < emp.size(); i++){ System.out.println("Enter number of hours worked by " + emp.get(i) + ":"); } Scanner stdin = new Scanner(System.in); numHours = stdin.nextInt(); System.out.println("Pay: " + emp1.computePay(numHours)); System.out.print("Enter number of hours worked by " + empName); Scanner stdin2 = new Scanner(System.in); numHours = stdin2.nextInt(); System.out.println("Pay: " + emp1.computePay(numHours)); printMenu(); question();} else if (input.equals("r")){ System.out.print("Enter percentage increase: "); Scanner stdin = new Scanner(System.in); increase = stdin.nextDouble(); System.out.println("\nNew Wages"); System.out.println("---------"); // System.out.println(Employee.toString()); printMenu(); question(); } else if (input.equals("p")){ printArrayList(emp); printMenu(); question(); } else if (input.equals("q")){ exit(); } } } Here is one of the class files: public abstract class Employee { private String name; private double wage; protected Employee(String name, double wage){ this.name = name; this.wage = wage; } public String getName() { return name; } public double getWage() { return wage; } public void setName(String name) { this.name = name; } public void setWage(double wage) { this.wage = wage; } public void percent(double wage, double percent) { wage *= percent; } } And here are the errors: P.java:108: cannot find symbol symbol : variable emp1 location: class P System.out.println("Pay: " + emp1.computePay(numHours)); ^ P.java:112: cannot find symbol symbol : variable emp1 location: class P System.out.println("Pay: " + emp1.computePay(numHours)); ^ 2 errors I'm trying to the get paycheck to print out but i'm having trouble with how to call the method. It should take the user inputed numHours and calculate it then print on the paycheck for each employee. Thanks!

    Read the article

  • Mulit-tenant ASP.NET MVC – Controllers

    - by zowens
    Part I – Introduction Part II – Foundation   The time has come to talk about controllers in a multi-tenant ASP.NET MVC architecture. This is actually the most critical design decision you will make when dealing with multi-tenancy with MVC. In my design, I took into account the design goals I mentioned in the introduction about inversion of control and what a tenant is to my design. Be aware that this is only one way to achieve multi-tenant controllers.   The Premise MvcEx (which is a sample written by Rob Ashton) utilizes dynamic controllers. Essentially a controller is “dynamic” in that multiple action results can be placed in different “controllers” with the same name. This approach is a bit too complicated for my design. I wanted to stick with plain old inheritance when dealing with controllers. The basic premise of my controller design is that my main host defines a set of universal controllers. It is the responsibility of the tenant to decide if the tenant would like to utilize these core controllers. This can be done either by straight usage of the controller or inheritance for extension of the functionality defined by the controller. The controller is resolved by a StructureMap container that is attached to the tenant, as discussed in Part II.   Controller Resolution I have been thinking about two different ways to resolve controllers with StructureMap. One way is to use named instances. This is a really easy way to simply pull the controller right out of the container without a lot of fuss. I ultimately chose not to use this approach. The reason for this decision is to ensure that the controllers are named properly. If a controller has a different named instance that the controller type, then the resolution has a significant disconnect and there are no guarantees. The final approach, the one utilized by the sample, is to simply pull all controller types and correlate the type with a controller name. This has a bit of a application start performance disadvantage, but is significantly more approachable for maintainability. For example, if I wanted to go back and add a “ControllerName” attribute, I would just have to change the ControllerFactory to suit my needs.   The Code The container factory that I have built is actually pretty simple. That’s really all we need. The most significant method is the GetControllersFor method. This method makes the model from the Container and determines all the concrete types for IController.  The thing you might notice is that this doesn’t depend on tenants, but rather containers. You could easily use this controller factory for an application that doesn’t utilize multi-tenancy. public class ContainerControllerFactory : IControllerFactory { private readonly ThreadSafeDictionary<IContainer, IDictionary<string, Type>> typeCache; public ContainerControllerFactory(IContainerResolver resolver) { Ensure.Argument.NotNull(resolver, "resolver"); this.ContainerResolver = resolver; this.typeCache = new ThreadSafeDictionary<IContainer, IDictionary<string, Type>>(); } public IContainerResolver ContainerResolver { get; private set; } public virtual IController CreateController(RequestContext requestContext, string controllerName) { var controllerType = this.GetControllerType(requestContext, controllerName); if (controllerType == null) return null; var controller = this.ContainerResolver.Resolve(requestContext).GetInstance(controllerType) as IController; // ensure the action invoker is a ContainerControllerActionInvoker if (controller != null && controller is Controller && !((controller as Controller).ActionInvoker is ContainerControllerActionInvoker)) (controller as Controller).ActionInvoker = new ContainerControllerActionInvoker(this.ContainerResolver); return controller; } public void ReleaseController(IController controller) { if (controller != null && controller is IDisposable) ((IDisposable)controller).Dispose(); } internal static IEnumerable<Type> GetControllersFor(IContainer container) { Ensure.Argument.NotNull(container); return container.Model.InstancesOf<IController>().Select(x => x.ConcreteType).Distinct(); } protected virtual Type GetControllerType(RequestContext requestContext, string controllerName) { Ensure.Argument.NotNull(requestContext, "requestContext"); Ensure.Argument.NotNullOrEmpty(controllerName, "controllerName"); var container = this.ContainerResolver.Resolve(requestContext); var typeDictionary = this.typeCache.GetOrAdd(container, () => GetControllersFor(container).ToDictionary(x => ControllerFriendlyName(x.Name))); Type found = null; if (typeDictionary.TryGetValue(ControllerFriendlyName(controllerName), out found)) return found; return null; } private static string ControllerFriendlyName(string value) { return (value ?? string.Empty).ToLowerInvariant().Without("controller"); } } One thing to note about my implementation is that we do not use namespaces that can be utilized in the default ASP.NET MVC controller factory. This is something that I don’t use and have no desire to implement and test. The reason I am not using namespaces in this situation is because each tenant has its own namespaces and the routing would not make sense in this case.   Because we are using IoC, dependencies are automatically injected into the constructor. For example, a tenant container could implement it’s own IRepository and a controller could be defined in the “main” project. The IRepository from the tenant would be injected into the main project’s controller. This is quite a useful feature.   Again, the source code is on GitHub here.   Up Next Up next is the view resolution. This is a complicated issue, so be prepared. I hope that you have found this series useful. If you have any questions about my implementation so far, send me an email or DM me on Twitter. I have had a lot of great conversations about multi-tenancy so far and I greatly appreciate the feedback!

    Read the article

< Previous Page | 363 364 365 366 367 368 369 370 371 372 373 374  | Next Page >