Search Results

Search found 17448 results on 698 pages for 'regular expressions info'.

Page 367/698 | < Previous Page | 363 364 365 366 367 368 369 370 371 372 373 374  | Next Page >

  • Python access an object byref / Need tagging

    - by Aaron C. de Bruyn
    I need to suck data from stdin and create a object. The incoming data is between 5 and 10 lines long. Each line has a process number and either an IP address or a hash. For example: pid=123 ip=192.168.0.1 - some data pid=123 hash=ABCDEF0123 - more data hash=ABCDEF123 - More data ip=192.168.0.1 - even more data I need to put this data into a class like: class MyData(): pid = None hash = None ip = None lines = [] I need to be able to look up the object by IP, HASH, or PID. The tough part is that there are multiple streams of data intermixed coming from stdin. (There could be hundreds or thousands of processes writing data at the same time.) I have regular expressions pulling out the PID, IP, and HASH that I need, but how can I access the object by any of those values? My thought was to do something like this: myarray = {} for each line in sys.stdin.readlines(): if pid and ip: #If we can get a PID out of the line myarray[pid] = MyData().pid = pid #Create a new MyData object, assign the PID, and stick it in myarray accessible by PID. myarray[pid].ip = ip #Add the IP address to the new object myarray[pid].lines.append(data) #Append the data myarray[ip] = myarray[pid] #Take the object by PID and create a key from the IP. <snip>do something similar for pid and hash, hash and ip, etc...</snip> This gives my an array with two keys (a PID and an IP) and they both point to the same object. But on the next iteration of the loop, if I find (for example) an IP and HASH and do: myarray[hash] = myarray[ip] The following is False: myarray[hash] == myarray[ip] Hopefully that was clear. I hate to admit that waaay back in the VB days, I remember being able handle objects byref instead of byval. Is there something similar in Python? Or am I just approaching this wrong?

    Read the article

  • Why can I query with an int but not a string here? PHP MySQL Datatypes

    - by CT
    I am working on an Asset Database problem. I receive $id from $_GET["id"]; I then query the database and display the results. This works if my id is an integer like "93650" but if it has other characters like "wci1001", it displays this MySQL error: Unknown column 'text' in 'where clause' All fields in tables are of type: VARCHAR(50) What would I need to do to be able to use this query to search by id that includes other characters? Thank you. <?php <?php /* * ASSET DB FUNCTIONS SCRIPT * */ # connect to database function ConnectDB(){ mysql_connect("localhost", "asset_db", "asset_db") or die(mysql_error()); mysql_select_db("asset_db") or die(mysql_error()); } # find asset type returns $type function GetAssetType($id){ $sql = "SELECT asset.type From asset WHERE asset.id = $id"; $result = mysql_query($sql) or die(mysql_error()); $row = mysql_fetch_assoc($result); $type = $row['type']; return $type; } # query server returns $result (sql query array) function QueryServer($id){ $sql = " SELECT asset.id ,asset.company ,asset.location ,asset.purchaseDate ,asset.purchaseOrder ,asset.value ,asset.type ,asset.notes ,server.manufacturer ,server.model ,server.serialNumber ,server.esc ,server.warranty ,server.user ,server.prevUser ,server.cpu ,server.memory ,server.hardDrive FROM asset LEFT JOIN server ON server.id = asset.id WHERE asset.id = $id "; $result = mysql_query($sql); return $result; } # get server data returns $serverArray function GetServerData($result){ while($row = mysql_fetch_assoc($result)) { $id = $row['id']; $company = $row['company']; $location = $row['location']; $purchaseDate = $row['purchaseDate']; $purchaseOrder = $row['purchaseOrder']; $value = $row['value']; $type = $row['type']; $notes = $row['notes']; $manufacturer = $row['manufacturer']; $model = $row['model']; $serialNumber = $row['serialNumber']; $esc = $row['esc']; $warranty = $row['warranty']; $user = $row['user']; $prevUser = $row['prevUser']; $cpu = $row['cpu']; $memory = $row['memory']; $hardDrive = $row['hardDrive']; $serverArray = array($id, $company, $location, $purchaseDate, $purchaseOrder, $value, $type, $notes, $manufacturer, $model, $serialNumber, $esc, $warranty, $user, $prevUser, $cpu, $memory, $hardDrive); } return $serverArray; } # print server table function PrintServerTable($serverArray){ $id = $serverArray[0]; $company = $serverArray[1]; $location = $serverArray[2]; $purchaseDate = $serverArray[3]; $purchaseOrder = $serverArray[4]; $value = $serverArray[5]; $type = $serverArray[6]; $notes = $serverArray[7]; $manufacturer = $serverArray[8]; $model = $serverArray[9]; $serialNumber = $serverArray[10]; $esc = $serverArray[11]; $warranty = $serverArray[12]; $user = $serverArray[13]; $prevUser = $serverArray[14]; $cpu = $serverArray[15]; $memory = $serverArray[16]; $hardDrive = $serverArray[17]; echo "<table width=\"100%\" border=\"0\"><tr><td style=\"vertical-align:top\"><table width=\"100%\" border=\"0\"><tr><td colspan=\"2\"><h2>General Info</h2></td></tr><tr id=\"hightlight\"><td>Asset ID:</td><td>"; echo $id; echo "</td></tr><tr><td>Company:</td><td>"; echo $company; echo "</td></tr><tr id=\"hightlight\"><td>Location:</td><td>"; echo $location; echo "</td></tr><tr><td>Purchase Date:</td><td>"; echo $purchaseDate; echo "</td></tr><tr id=\"hightlight\"><td>Purchase Order #:</td><td>"; echo $purchaseOrder; echo "</td></tr><tr><td>Value:</td><td>"; echo $value; echo "</td></tr><tr id=\"hightlight\"><td>Type:</td><td>"; echo $type; echo "</td></tr><tr><td>Notes:</td><td>"; echo $notes; echo "</td></tr></table></td><td style=\"vertical-align:top\"><table width=\"100%\" border=\"0\"><tr><td colspan=\"2\"><h2>Server Info</h2></td></tr><tr id=\"hightlight\"><td>Manufacturer:</td><td>"; echo $manufacturer; echo "</td></tr><tr><td>Model:</td><td>"; echo $model; echo "</td></tr><tr id=\"hightlight\"><td>Serial Number:</td><td>"; echo $serialNumber; echo "</td></tr><tr><td>ESC:</td><td>"; echo $esc; echo "</td></tr><tr id=\"hightlight\"><td>Warranty:</td><td>"; echo $warranty; echo "</td></tr><tr><td colspan=\"2\">&nbsp;</td></tr><tr><td colspan=\"2\"><h2>User Info</h2></td></tr><tr id=\"hightlight\"><td>User:</td><td>"; echo $user; echo "</td></tr><tr><td>Previous User:</td><td>"; echo $prevUser; echo "</td></tr></table></td><td style=\"vertical-align:top\"><table width=\"100%\" border=\"0\"><tr><td colspan=\"2\"><h2>Specs</h2></td></tr><tr id=\"hightlight\"><td>CPU:</td><td>"; echo $cpu; echo "</td></tr><tr><td>Memory:</td><td>"; echo $memory; echo "</td></tr><tr id=\"hightlight\"><td>Hard Drive:</td><td>"; echo $hardDrive; echo "</td></tr><tr><td colspan=\"2\">&nbsp;</td></tr><tr><td colspan=\"2\">&nbsp;</td></tr><tr><td colspan=\"2\"><h2>Options</h2></td></tr><tr><td colspan=\"2\"><a href=\"#\">Edit Asset</a></td></tr><tr><td colspan=\"2\"><a href=\"#\">Delete Asset</a></td></tr></table></td></tr></table>"; } ?> __ /* * View Asset * */ # include functions script include "functions.php"; $id = $_GET["id"]; if (empty($id)):$id="000"; endif; ConnectDB(); $type = GetAssetType($id); ?> <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.1//EN" "http://www.w3.org/TR/xhtml11/DTD/xhtml11.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <link rel="stylesheet" type="text/css" href="style.css" /> <title>Wagman IT Asset</title> </head> <body> <div id="page"> <div id="header"> <img src="images/logo.png" /> </div> </div> <div id="content"> <div id="container"> <div id="main"> <div id="menu"> <ul> <table width="100%" border="0"> <tr> <td width="15%"></td> <td width="30%%"><li><a href="index.php">Search Assets</a></li></td> <td width="30%"><li><a href="addAsset.php">Add Asset</a></li></td> <td width="25%"></td> </tr> </table> </ul> </div> <div id="text"> <ul> <li> <h1>View Asset</h1> </li> </ul> <?php if (empty($type)):echo "<ul><li><h2>Asset ID does not match any database entries.</h2></li></ul>"; else: switch ($type){ case "Server": $result = QueryServer($id); $ServerArray = GetServerData($result); PrintServerTable($ServerArray); break; case "Desktop"; break; case "Laptop"; break; } endif; ?> </div> </div> </div> <div class="clear"></div> <div id="footer" align="center"> <p>&nbsp;</p> </div> </div> <div id="tagline"> Wagman Construction - Bridging Generations since 1902 </div> </body> </html>

    Read the article

  • C# Threads.Abort()

    - by Betamoo
    If a thread is running a function func1 that calls another function func2 inside it... Then I called thread.Abort() Will this stop func1 only OR func1 and func2 and all the functions func1 has called?? Thanks Edit: Here are more detail: func1 is called in a new thread, it continuously calls func2 on regular basis... func2 begin doing some work only if some array is not null.. it finishes it and return When supervisor wants to save data, it aborts Thread of func1- and then makes array null, saves data, then fill in the array with new one.. and starts Thread with func1 again.. Sometimes exception is raised because array is null in func2.. so func1 abort did not affect func2

    Read the article

  • regex to format a float in php

    - by Itamar Bar-Lev
    I have a PHP function for formatting a float to a given amount of decimal points that uses number_format(), and then removes the unneeded zeros (and also the '.' if possible): $float = number_format($float, $decimalPlaces, '.', ''); for ($i = 0; $i < $decimalPlaces; $i++) { if (substr($float, strlen($float) - 1, strlen($float)) == '0') { $float = substr($float, 0, strlen($float) - 1); } } if (substr($float, strlen($float) - 1, strlen($float)) == '.') { $float = substr($float, 0, strlen($float) - 1); } Is it possible to do so more effectively with a regular expression?

    Read the article

  • Using Regex groups in bash

    - by AlexeyMK
    Greetings, I've got a directory with a list of pdfs in it: file1.pdf, file2.pdf, morestuff.pdf ... etc. I want to convert these pdfs to pngs, ie file1.png, file2.png, morestuff.png ... etc. The basic command is, convert from to, But I'm having trouble getting convert to rename to the same file name. The obvious 'I wish it worked this way' is convert *.pdf *.png But clearly that doesn't work. My thought process is that I should utilize regular expression grouping here, to say somethink like convert (*).pdf %1.png but that clearly isn't the right syntax. I'm wondering what the correct syntax is, and whether there's a better approach (that doesn't require jumping into perl or python) that I'm ignoring. Thanks!

    Read the article

  • what the true nature of @ in Transct-SQL

    - by Richard77
    Hello, I reading some old ScottGu's blogs on Linq2SQL. Now I'm doing the SPROC part. I'd like to know what's the exact meaning of @variable. See this from ScottGu's Blog ALTER PROCEDURE dbo.GetCustomersDetails ( @customerID nchar(5), @companyName nvarchar(40) output ) AS SELECT @companyName = CompanyName FROM Customers WHERE CustomerID = @customerID SELECT * FROM Orders WHERE CustomerID = @customerID ORDER BY OrderID I'm kind of lost as, so far, I've though of anything preceded by a '@' as a placeholder for user input. But, in the example above, it looks like '@companyName' is used as a regular variable like in C# for instance (SELECT @companyName = ...). But, @companyName is not known yet. So, what the true nature a something preceded by a '@' like above? a vriable? a simple placeholder to accommodate user entered value? Thanks for helping

    Read the article

  • Convert PDF to PDF/A-1

    - by AZtec
    I know this probably is not strictly a programming-question (well maybe it is, i don't know) but i'm having serious problems trying to convert a regular pdf (with hyperlinks, bookmarks, images, embedded fonts etc.) into a PDF/A-1 format. I get all kinds of errors when i check it with pdfaPilot. How can i prepare a pdf so no problems will occur when i try to convert to PDF/A-1. Most problems can be fixed with pdfaPilot but apparently not all. One of the problems i get is with the XMP Metadata which are "not properly defined". Wat exactly does this mean, and can i do something to prevent this. Another one is: "Syntax problem: Array with more than 8191 elements" (i hope this one is solvable) I hope someone can help me out here, since i'm in a tight spot right now with deadlines that are killing me.

    Read the article

  • F# List SelectMany

    - by Tuomas Hietanen
    This is quite simple question but I didn't find an answer: Is there any Seq/List operation in F# to match the LINQ SelectMany? I know I can use System.Linq in F# if I want to. I know I can make a recursive method and use F# Computation Expressions (and make even more powerful things). But if I try to prove that F# List operations are more powerful than LINQ... .Where = List.filter .Select = List.map .Aggregate = List.fold ... In C# SelectMany usage syntax is pretty simple: var flattenedList = from i in items1 from j in items2 select ... Is there any easy direct match, List.flatten, List.bind or something like that? SelectMany has a couple of signatures, but the most complex one seems to be: IEnumerable<TResult> SelectMany<TSource, TCollection, TResult>( this IEnumerable<TSource> source, Func<TSource, IEnumerable<TCollection>> collectionSelector, Func<TSource, TCollection, TResult> resultSelector ); In F# terms this would be: ('a -> 'b list) -> ('a -> 'b -> 'c) -> 'a list -> 'c list

    Read the article

  • Multiple Forms on the Same Page with Rails

    - by Eric Koslow
    So I'm building a rails app for high school students and I've hit a problem when it comes to creating users. I want the students to only be able to create accounts if they select their school and type in their school's password correctly. What is the correct / easiest way of doing this? Should I create a gatekeeper to the user#new action that they have to pass first or if their a way that on the same page a student can submit to forms. One would be the regular username, email, password using: form_for @user do ... end But then creating another form for the high-school / high-school password selection. Ideally the controller would be able to get the params of the high-school form, validate those, then go on to create the user from the user params. Is this possible using rails? My setup: Rails 3 and Ruby 1.9.2dev Thank you!

    Read the article

  • Using string.Format for simple things?

    - by Gerrie Schenck
    In my early .Net programming days, I used string.Format() only for complex string concatenations, for example to compile strings as Problem with customer order 234 of date 2/2/2002 and payment id 55543. But now I use string.Format for almost every string concatenation I have to do, also simple ones such as prefixing a string with something. Console.WriteLine(string.Format("\t\t{0}", myString)); Is there any possible overhead on this? Maybe I should use the regular + operator to do these simple operations? What's your opinion on this?

    Read the article

  • building mono from svn - android target

    - by Jeremy Bell
    There were patches made to mono on trunk svn to support android. My understanding is that essentially instead of Koush's system which builds mono using the android NDK build system directly, these patches add support for the android NDK using the regular mono configure.sh process. I'd like to play around with this patch, but not being an expert in the mono build system, I have no idea how to tell it to target the android NDK, or even where to look. I've been able to build mono from SVN using the default target (linux) on Ubuntu, but no documentation on how to target android was given with the patches. Since anyone not submitting or reviewing a patch is generally ignored on the mono mailing list, I figured I'd post the question here.

    Read the article

  • NVP request - CreateRecurringPaymentsProfile

    - by jiwanje.mp
    Im facing problem with Trail period and first month payemnt. My requirement is users can signup with trial period which allow new users to have a 30 day free trial. This means they will not be charged the monthly price until after the first 30 days the regular amount will be charged to user. but the next billing date should be one month later the profile start date. but next billing data and profile start date shows same when i query by GetRecurringPaymentProfile? Please help me how can i send the Recurring bill payment for this functionality. Thanks in advance, jiwan

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How do I put my return data from an asmx into JSON? I'm having trouble finding decent literature

    - by jphenow
    I want to return an array of javascript objects from my asp.net asmx file. ie. variable = [ { *value1*: 'value1', *value2*: 'value2', ..., }, { . . } ]; I seem have been having trouble reaching this. I'd put this into code but I've been hacking away at it so much it'd probably do more harm than good in having this answered. Basically I am using a web service to find names as people type the name. I'd use a regular text file or something but its a huge database that's always changing - and don't worry I've indexed the names so searching can be a little snappier - but I would really prefer to stick with this method and just figure out how to get usable JSON back to javascript. I've seen a few that sort of attempt to describe how one would approach this but I honestly think microsofts articles are damn near unreadable. Thanks in advance for assistance.

    Read the article

  • Seemingly normal link does not work in MVC, IIS5, SparkView.

    - by Matt W
    I have a regular link being generated in MVC1.0 as: /Login/Logout This link does not work. The code for it is: <a href="${Links.Logout}" class="SignOut">Sign out</a> As I am using SparkView. I am using IIS5.1 on WinXP Pro. I cannot work out why the link on the page calls the MVC action if I open the link in a separate browser tab but not when I click directly on it in the original page. This feels like a browser bug (Chrome, Firefox, IE8) but they all perform the same way. Thanks, Matt.

    Read the article

  • How to skip "Loose Object" popup when running 'git gui'

    - by Michael Donohue
    When I run 'git gui' I get a popup that says This repository currently has approximately 1500 loose objects. It then suggests compressing the database. I've done this before, and it reduces the loose objects to about 250, but that doesn't suppress the popup. Compressing again doesn't change the number of loose objects. Our current workflow requires significant use of 'rebase' as we are transitioning from Perforce, and Perforce is still the canonical SCM. Once Git is the canonical SCM, we will do regular merges, and the loose objects problem should be greatly mitigated. In the mean time, I'd really like to make this 'helpful' popup go away.

    Read the article

  • NSString: EOL and rangeOfString issues

    - by carloe
    Could someone please tell me if I am missing something here... I am trying to parse individual JSON objects out of a data stream. The data stream is buffered in a regular NSString, and the individual JSON objects are delineated by a EOL marker. if([dataBuffer rangeOfString:@"\n"].location != NSNotFound) { NSString *tmp = [dataBuffer stringByReplacingOccurrencesOfString:@"\n" withString:@"NEWLINE"]; NSLog(@"%@", tmp); } The code above outputs "...}NEWLINE{..." as expected. But if I change the @"\n" in the if-statement above to @"}\n", I get nothing.

    Read the article

  • Replace text in string with delimeters using Regex

    - by user1057735
    I have a string something like, string str = "(50%silicon +20%!(20%Gold + 80%Silver)| + 30%Alumnium)"; I need a Regular Expression which would Replace the contents in between ! and | with an empty string. The result should be (50%silicon +20% + 30%Alumnium). If the string contains something like (with nested delimiters): string str = "(50%silicon +20%!(80%Gold + 80%Silver + 20%!(20%Iron + 80%Silver)|)| + 30%Alumnium)"; The result should be (50%silicon +20% + 30%Alumnium) - ignoring the nested delimiters. I've tried the following Regex, but it doesn't ignore the nesting: Regex.Replace(str , @"!.+?\|", "", RegexOptions.IgnoreCase);

    Read the article

  • Open C: Directly with `FileStream` without `CreateFile` API

    - by DxCK
    I trying to open C: directly with FileStream without success: new FileStream("C:", FileMode.Open, FileAccess.Read, FileShare.ReadWrite); System.UnauthorizedAccessException was unhandled Message="Access to the path 'C:\' is denied." Source="mscorlib" StackTrace: in System.IO.__Error.WinIOError(Int32 errorCode, String maybeFullPath) in System.IO.FileStream.Init(String path, FileMode mode, FileAccess access, Int32 rights, Boolean useRights, FileShare share, Int32 bufferSize, FileOptions options, SECURITY_ATTRIBUTES secAttrs, String msgPath, Boolean bFromProxy) in System.IO.FileStream..ctor(String path, FileMode mode, FileAccess access, FileShare share, Int32 bufferSize, FileOptions options, String msgPath, Boolean bFromProxy) in System.IO.FileStream..ctor(String path, FileMode mode, FileAccess access, FileShare share) in ReadingMftNewTest.Program.Main(String[] args) in D:\CS\2008\ReadingMftNewTest\ReadingMftNewTest\Program.cs:line 76 Note that i openning "C:" but the error says "C:\", where did this slash came from? :\ Is there any chance to open C: without using the CreateFile API? I really don't want be depending on WIN32 API because this code should also run on Mono that dont support WIN32 API, but successfully openning devices with regular FileStream (Mono 1 Microsoft 0).

    Read the article

  • Getting Unit Tests to work with Komodo IDE for Python

    - by devoured elysium
    I've tried to run the following code on Komodo IDE (for python): import unittest class MathLibraryTests(unittest.TestCase): def test1Plus1Equals2(self): self.assertEqual(1+1, 2) Then, I created a new test plan, pointing to this project(file) directory and tried to run it the test plan. It seems to run but it doesn't seem to find any tests. If I try to run the following code with the "regular" run command (F7) class MathLibraryTests(unittest.TestCase): def testPlus1Equals2(self): self.assertEqual(1+1, 2) if __name__ == "__main__": unittest.main() it works. I get the following output: ---------------------------------------------------------------------- Ran 1 test in 0.000s OK What might I be doing wrong?

    Read the article

  • Combining aggregate functions in an (ANSI) SQL statement

    - by morpheous
    I have aggregate functions foo(), foobar(), fredstats(), barneystats() I want to create a domain specific query language (DSQL) above my DB, to facilitate using using a domain language to query the DB. The 'language' comprises of boolean expressions (or more specifically SQL like criteria) which I then 'translate' back into pure (ANSI) SQL and send to the underlying Db. The following lines are examples of what the language statements will look like, and hopefully, it will help further clarify the concept: **Example 1** DQL statement: foobar('yellow') between 1 and 3 and fredstats('weight') > 42 Translation: fetch all rows in an underlying table where computed values for aggregate function foobar() is between 1 and 3 AND computed value for AGG FUNC fredstats() is greater than 42 **Example 2** DQL statement: fredstats('weight') < barneystats('weight') AND foo('fighter') in (9,10,11) AND foobar('green') <> 42 Translation: Fetch all rows where the specified criteria matches **Example 3** DQL statement: foobar('green') / foobar('red') <> 42 Translation: Fetch all rows where the specified criteria matches **Example 4** DQL statement: foobar('green') - foobar('red') >= 42 Translation: Fetch all rows where the specified criteria matches Given the following information: The table upon which the queries above are being executed is called 'tbl' table 'tbl' has the following structure (id int, name varchar(32), weight float) The result set returns only the tbl.id, tbl.name and the names of the aggregate functions as columns in the result set - so for example the foobar() AGG FUNC column will be called foobar in the result set. So for example, the first DQL query will return a result set with the following columns: id, name, foobar, fredstats Given the above, my questions then are: What would be the underlying SQL required for Example1 ? What would be the underlying SQL required for Example3 ? Given an algebraic equation comprising of AGGREGATE functions, Is there a way of generalizing the algorithm needed to generate the required ANSI SQL statement(s)? I am using PostgreSQL as the db, but I would prefer to use ANSI SQL wherever possible.

    Read the article

  • MS Access 2003 - Is there a way to programmatically define the data for a chart?

    - by Justin
    So I have some VBA for taking charts built with the Form's Chart Wizard, and automatically inserting it into PowerPoint Presentation slides. I use those chart-forms as sub forms within a larger forms that has parameters the user can select to determine what is on the chart. The idea is that the user can determine the parameter, build the chart to his/her liking, and click a button and have it in a ppt slide with the company's background template, blah blah blah..... So it works, though it is very bulky in terms of the amount of objects I have to use to accomplish this. I use expressions such as the following: like forms!frmMain.Month&* to get the input values into the saved queries, which was fine when i first started, but it went over so well and they want so many options, that it is driving the number of saved queries/objects up. I need several saved forms with charts because of the number of different types of charts I need to have this be able to handle. SO FINALLY TO MY QUESTION: I would much rather do all this on the fly with some VBA. I know how to insert list boxes, and text boxes on a form, and I know how to use SQL in VBA to get the values I want from tables/queries using VBA, I just don't know if there is some vba I can use to set the data values of the charts from a resulting recordset: DIM rs AS DAO.Rescordset DIM db AS DAO.Database DIM sql AS String sql = "SELECT TOP 5 Count(tblMain.TransactionID) AS Total, tblMain.Location FROM tblMain WHERE (((tblMain.Month) = """ & me.txtMonth & """ )) ORDER BY Count (tblMain.TransactionID) DESC;" set db = currentDB set rs = db.OpenRecordSet(sql) rs.movefirst some kind of cool code in here to make this recordset the data of chart in frmChart ("Chart01") thanks for your help. apologies for the length of the explanation.

    Read the article

  • Display subclass data in XCode Expression window

    - by Nick VanderPyle
    I'm debugging an iPhone application I've written using XCode 3.2 and I cannot view the relevant public properties of an object I pull from Core Data. When I watch the object in the Expressions window it only displays the data from the base NSManagedObject. I'd like to see the properties that are on the subclass, not the superclass. If it helps, here's some of the code I'm using. Settings is a subclass of NSManagedObject. I created it using XCode's built-in modeler. Declared like: @interface Settings : NSManagedObject { } @property (nonatomic, retain) NSNumber * hasNews; @property (nonatomic, retain) NSString * logoUrl; @property (nonatomic, retain) NSNumber * hasPaymentGateway; @property (nonatomic, retain) NSString * customerCode; ... In the interface of my controller I have: Settings *settings; I populate settings with: settings = (Settings *)[NSEntityDescription insertNewObjectForEntityForName:@"Settings" inManagedObjectContext:UIAppManagedObjectContext()]; I then set the properties like: settings.hasNews = [NSNumber numberWithBool:TRUE]; I've tried casting settings as (Settings *) in the Expression window but that doesn't help. All I see are the properties to NSManagedObject. I'm using NSLog but would rather not.

    Read the article

  • Javascript substrings multiline replace by RegExp

    - by Radek Šimko
    Hi, I'm having some troubles with matching a regular expression in multi-line string. <script> var str="Welcome to Google!\n"; str = str + "We are proud to announce that Microsoft has \n"; str = str + "one of the worst Web Developers sites in the world."; document.write(str.replace(/.*(microsoft).*/gmi, "$1")); </script> http://jsbin.com/osoli3/3/edit As you may see on the link above, the output of the code looks like this: Welcome to Google! Microsoft one of the worst Web Developers sites in the world. Which means, that the replace() method goes line by line and if there's no match in that line, it returns just the whole line... Even if it has the "m" (multiline) modifier...

    Read the article

  • Invoking play on a QTMovie causes screensaver to deactivate on Snow Leopard

    - by ressaw
    I'm trying to port a working Leopard screensaver to Snow Leopard but it's deactivating after about half a second. The screensaver seems to deactivate upon invoking play on a QTMovie. And it deactivates both upon -play on the QTMovie object itself, and -play:self on the QTMovieView. If I don't actually call -play on the object, the screensaver does not deactivate and sits still on the first frame of the movie. Setting up the same code in a regular Cocoa Application works fine, and the screensaver also works fine in preview mode in the System Preferences. Any help is greatly appreciated.

    Read the article

< Previous Page | 363 364 365 366 367 368 369 370 371 372 373 374  | Next Page >