Search Results

Search found 12898 results on 516 pages for 'expression engine'.

Page 369/516 | < Previous Page | 365 366 367 368 369 370 371 372 373 374 375 376  | Next Page >

  • regex to format a float in php

    - by Itamar Bar-Lev
    I have a PHP function for formatting a float to a given amount of decimal points that uses number_format(), and then removes the unneeded zeros (and also the '.' if possible): $float = number_format($float, $decimalPlaces, '.', ''); for ($i = 0; $i < $decimalPlaces; $i++) { if (substr($float, strlen($float) - 1, strlen($float)) == '0') { $float = substr($float, 0, strlen($float) - 1); } } if (substr($float, strlen($float) - 1, strlen($float)) == '.') { $float = substr($float, 0, strlen($float) - 1); } Is it possible to do so more effectively with a regular expression?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • What logic operator to use, as3?

    - by VideoDnd
    What operator or expression can I use that will fire on every number, including zero? I want a logic operator that will fire with ever number it receives. My animations pause at zero. This skips on zero if (numberThing> 0); This skips on 9 if (numberThing>> 0); This jitters 'fires quickly and goes back on count' if (numberThing== 0); EXPLANATION I'm catching split string values in a logic function, and feeding them to a series of IF, ELSE IF statements. I'm using this with a timer, so I can measure the discrepency. CODE • I GET VALUES FROM TIMER • STRING GOES TO TEXTFIELD 'substr' • NUMBER TRIGGERS TWEENS 'parseInt' • Goes to series of IF and ELSE IF statements

    Read the article

  • Getting an odd error, MSSQL Query using `WITH` clause

    - by Aren B
    The following query: WITH CteProductLookup(ProductId, oid) AS ( SELECT p.ProductID, p.oid FROM [dbo].[ME_CatalogProducts] p ) SELECT rel.Name as RelationshipName, pl.ProductId as FromProductId, pl2.ProductId as ToProductId FROM ( [dbo].[ME_CatalogRelationships] rel INNER JOIN CteProductLookup pl ON pl.oid = rel.from_oid ) INNER JOIN CteProductLookup pl2 ON pl2.oid = rel.to_oid WHERE rel.Name = 'BundleItem' AND pl.ProductId = 'MX12345'; Is generating this error: Msg 319, Level 15, State 1, Line 5 Incorrect syntax near the keyword 'with'. If this statement is a common table expression, an xmlnamespaces clause or a change tracking context clause, the previous statement must be terminated with a semicolon. On execution only. There are no errors/warnings in the sql statement in the managment studio. Any ideas?

    Read the article

  • How to use Visual Studio debugger visualizers built against a different framework version?

    - by michielvoo
    I compiled the ExpressionTreeVisualizer project found in the Visual Studio 2010 samples but when I try to use it in a .NET 3.5 project I get the exception below: Could not load file or assembly 'file:///C:\Program Files (x86)\Microsoft\Visual Studio 2010\Common7\Packages\Debugger\Visualizers\ExpressionTreeVisualizer.dll' or one of its dependencies. This assembly is built by a runtime newer than the currently loaded runtime and cannot be loaded. The sample project had the TargetFrameworkVersion set to v4.0 and after changing it to v3.5 and building it now works in my project. I changed the source code and project file and rebuilt it so that I now have two expression tree visualizers, one for v3.5 projects and one for v4.0 projects. Is there a better way? Thanks!

    Read the article

  • How to regex match a string of alnums and hyphens, but which doesn't begin or end with a hyphen?

    - by Shahar Evron
    I have some code validating a string of 1 to 32 characters, which may contain only alpha-numerics and hyphens ('-') but may not begin or end with a hyphen. I'm using PCRE regular expressions & PHP (albeit the PHP part is not really important in this case). Right now the pseudo-code looks like this: if (match("/^[\p{L}0-9][\p{L}0-9-]{0,31}$/u", string) and not match("/-$/", string)) print "success!" That is, I'm checking first that the string is of right contents, doesn't being with a '-' and is of the right length, and then I'm running another test to see that it doesn't end with a '-'. Any suggestions on merging this into a single PCRE regular expression? I've tried using look-ahead / look-behind assertions but couldn't get it to work.

    Read the article

  • Scala 2.8: use Java annotation with an array parameter

    - by yournamehere
    I'm trying to implement an JavaEE Session Bean with Scala 2.8. Because it's a Remote Session Bean, i have to annotate it with the following Java Annotation: @Target({ElementType.TYPE}) @Retention(RetentionPolicy.RUNTIME) public @interface Remote { Class[] value() default {}; } I only found this example for scala 2.7. In Scala 2.7, its possible to define the session bean like this: @Remote {val value = Array(classOf[ITest])} class MyEJB ... How can i use this annotation the same way with Scala 2.8? I already tried many different versions, all resulting in "annotation argument needs to be a constant", "illegal start of simple expression". All of these definitions don't work: @Remote{val value = Array(classOf[PersonScalaEJB])} @Remote(val value = Array(classOf[PersonScalaEJB])) @Remote(Array(classOf[PersonScalaEJB]))

    Read the article

  • How do I create regex groups for replacement?

    - by resting
    I have this sample string: Image: SGD$45.32 SKU: 3f3f3 dfdfd grg4t BP 6yhf Pack Size: 1000's Color: Green Price: SGD$45.32 SGD$45... I would like to remove all the prices namely: SGD$45.32 Price: SGD$45.32 SGD$45 I have this expression thats supposed to match the 3 groups: $pattern = '/(Price.+\sSGD\$\d+\.\d{2})(SGD\$\d+\.\d{2})(SGD\$\d+)/'; $new_snippet = preg_replace($pattern, '', $snippet);` But apparently its not working. It works if I replace a single group at a time. But, I'd like to know if it possible to replace all possible matching groups with a single statement. Tried preg_match_all($pattern, $snippet, $matches); to show matches based on the above pattern, but no matches are found if I put all 3 groups together.

    Read the article

  • Using DateDiff in Entity Framwork on a SQL CE database

    - by deverop
    I have a method which should return a list of anonymous objects with a calculated column like this: var tomorrow = DateTime.Today.AddDays(1); return from t in this.Events where (t.StartTime >= DateTime.Today && t.StartTime < tomorrow && t.EndTime.HasValue) select new { Client = t.Activity.Project.Customer.Name, Project = t.Activity.Project.Name, Task = t.Activity.Task.Name, Rate = t.Activity.Rate.Name, StartTime = t.StartTime, EndTime = t.EndTime.Value, Hours = (System.Data.Objects.SqlClient.SqlFunctions.DateDiff("m", t.StartTime, t.EndTime.Value) / 60), Description = t.Activity.Description }; Unfortunately I get the following error from the DateDiff function: The specified method 'System.Nullable1[System.Int32] DateDiff(System.String, System.Nullable1[System.DateTime], System.Nullable`1[System.DateTime])' on the type 'System.Data.Objects.SqlClient.SqlFunctions' cannot be translated into a LINQ to Entities store expression. Any ideas what I could have done wrong here? EDIT: I also tried the EntityFunctions class mentioned here, but that did not work as well. Minutes = EntityFunctions.DiffMinutes(t.EndTime, t.StartTime),

    Read the article

  • Replace text in string with delimeters using Regex

    - by user1057735
    I have a string something like, string str = "(50%silicon +20%!(20%Gold + 80%Silver)| + 30%Alumnium)"; I need a Regular Expression which would Replace the contents in between ! and | with an empty string. The result should be (50%silicon +20% + 30%Alumnium). If the string contains something like (with nested delimiters): string str = "(50%silicon +20%!(80%Gold + 80%Silver + 20%!(20%Iron + 80%Silver)|)| + 30%Alumnium)"; The result should be (50%silicon +20% + 30%Alumnium) - ignoring the nested delimiters. I've tried the following Regex, but it doesn't ignore the nesting: Regex.Replace(str , @"!.+?\|", "", RegexOptions.IgnoreCase);

    Read the article

  • How to convert an arbitrary object to String with JSTL? (calling toString())

    - by hstoerr
    Is there any way to call toString() on an object with the JSTL? (I need the String representation of an enum as index in a map in a JSP EL expression.) I hoped something like ${''+object} would work like in java, but JSTL isn't that nice, and there does not seem to be any function that does it. Clarification: I have a variable somemap that maps Strings to Strings, and I have a variable someenum that is an enumeration. I'd like to do something like ${somemap[someenum.toString()]}. (Of course .toString() does not work, but what does?)

    Read the article

  • Perl Regex Multiple Items in Single String

    - by Sho Minamimoto
    I'm trying to parse a single string and get multiple chunks of data out from the same string with the same regex conditions. I'm parsing a single HTML doc that is static (For an undisclosed reason, I can't use an HTML parser to do the job.) I have an expression that looks like $string =~ /\<img\ssrc\="(.*)"/; and I want to get the value of $1. However, in the one string, there are many img tags like this, so I need something like an array returned (@1?) is this possible?

    Read the article

  • Numbering Regex Submatches

    - by gentlylisped
    Is there a canonical ordering of submatch expressions in a regular expression? For example: What is the order of the submatches in "(([0-9]{3}).([0-9]{3}).([0-9]{3}).([0-9]{3}))\s+([A-Z]+)" ? a. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([A-Z]+) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) b. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([A-Z]+) or c. somthin' else.

    Read the article

  • (type theoretical) How is ([] ==) [] typed in haskell?

    - by Ingo
    It sounds silly, but I can't get it. Why can the expression [] == [] be typed at all? More specifically, which type (in class Eq) is inferred to the type of list elements? In a ghci session, I see the following: Prelude> :t (==[]) (==[]) :: (Eq [a]) => [a] -> Bool But the constraint Eq [a] implies Eq a also, as is shown here: Prelude> (==[]) ([]::[IO ()]) <interactive>:1:1: No instance for (Eq (IO ())) arising from use of `==' at <interactive>:1:1-2 Probable fix: add an instance declaration for (Eq (IO ())) In the definition of `it': it = (== []) ([] :: [IO ()]) Thus, in []==[], the type checker must assume that the list element is some type a that is in class Eq. But which one? The type of [] is just [a], and this is certainly more general than Eq a = [a].

    Read the article

  • Create Sum of calculated rows in Microsoft Reporting Services

    - by kd7iwp
    This seems like it should be simple but I can't find anything yet. In Reporting Services I have a table with up to 6 rows that all have calculated values and dynamic visibility. I would like to sum these rows. Basically I have a number of invoice items and want to make a total. I can't change anything on the DB side since my stored procedures are used elsewhere in the system. Each row pulls data from a different dataset as well, so I can't do a sum of the dataset. Can I sum all the rows with a table footer? Similarly to totaling a number of rows in Excel? It seems very redundant to put my visibility expression from each row into my footer row to calculate the sum.

    Read the article

  • Check for default value of attribute in XPath

    - by iref
    Hi, i have XML schema: <xsd:complexType name="contactsType"> <xsd:sequence> <xsd:element name="contact" type="contactType" minOccurs="0" maxOccurs="unbounded"/> </xsd:sequence> <xsd:attribute name="visible" type="xsd:boolean" default="true"/> </xsd:complexType> and i want to find all contacts which have @visible=true, //contacts[@visible='true'] but this expression doesn' t return nodes without set @visible like this: <contacts /> so i want to know if there is any function in XPath which returns also default values of attributes Thanks Jan

    Read the article

  • C++ Templates: implicit conversion, no matching function for call to ctor

    - by noname
    template<class T> class test { public: test() { } test(T& e) { } }; int main() { test<double> d(4.3); return 0; } Compiled using g++ 4.4.1 with the following errors: g++ test.cpp -Wall -o test.exe test.cpp: In function 'int main()': test.cpp:18: error: no matching function for call to 'test<double>::test(double) ' test.cpp:9: note: candidates are: test<T>::test(T&) [with T = double] test.cpp:5: note: test<T>::test() [with T = double] test.cpp:3: note: test<double>::test(const test<double>&) make: *** [test.exe] Error 1 However, this works: double a=1.1; test<double> d(a); Why is this happing? Is it possible that g++ cannot implicitly convert literal expression 1.1 to double? Thanks.

    Read the article

  • Function Pointer from base class

    - by camelord
    Hi there, i need a Function Pointer from a base class. Here is the code: class CActionObjectBase { ... void AddResultStateErrorMessage( const char* pcMessage , ULONG iResultStateCode); ... } CActionObjectCalibration( ): CActionObjectBase() { ... m_Calibration = new CCalibration(&CActionObjectBase::AddResultStateErrorMessage); } class CCalibration { ... CCalibration(void (CActionObjectBase::* AddErrorMessage)(const char*, ULONG )); ... void (CActionObjectBase::* m_AddErrorMessage)(const char*, ULONG ); } Inside CCalibration in a Function occurs the Error. I try to call the Function Pointer like this: if(m_AddErrorMessage) { ... m_AddErrorMessage("bla bla", RSC_FILE_ERROR); } The Problem is, that I cannot compile. The Error Message says something like: error C2064: Expression is no Function, that takes two Arguments. What is wrong? regards camelord

    Read the article

  • Problem with nested lambda expressions.

    - by Lehto
    Hey I'm trying to do a nested lambda expression like to following: textLocalizationTable.Where( z => z.SpokenLanguage.Any( x => x.FromCulture == "en-GB") ).ToList(); but i get the error: Member access 'System.String FromCulture' of 'DomainModel.Entities.SpokenLanguage' not legal on type 'System.Data.Linq.EntitySet`1[DomainModel.Entities.SpokenLanguage]. TextLocalization has this relation to spokenlanguage: [Association(OtherKey = "LocalizationID", ThisKey = "LocalizationID", Storage = "_SpokenLanguage")] private EntitySet<SpokenLanguage> _SpokenLanguage = new EntitySet<SpokenLanguage>(); public EntitySet<SpokenLanguage> SpokenLanguage { set { _SpokenLanguage = value; } get { return _SpokenLanguage; } } Any idea what is wrong?

    Read the article

  • Javascript substrings multiline replace by RegExp

    - by Radek Šimko
    Hi, I'm having some troubles with matching a regular expression in multi-line string. <script> var str="Welcome to Google!\n"; str = str + "We are proud to announce that Microsoft has \n"; str = str + "one of the worst Web Developers sites in the world."; document.write(str.replace(/.*(microsoft).*/gmi, "$1")); </script> http://jsbin.com/osoli3/3/edit As you may see on the link above, the output of the code looks like this: Welcome to Google! Microsoft one of the worst Web Developers sites in the world. Which means, that the replace() method goes line by line and if there's no match in that line, it returns just the whole line... Even if it has the "m" (multiline) modifier...

    Read the article

  • How can I capture multiple matches from the same Perl regex?

    - by Sho Minamimoto
    I'm trying to parse a single string and get multiple chunks of data out from the same string with the same regex conditions. I'm parsing a single HTML doc that is static (For an undisclosed reason, I can't use an HTML parser to do the job.) I have an expression that looks like: $string =~ /\<img\ssrc\="(.*)"/; and I want to get the value of $1. However, in the one string, there are many img tags like this, so I need something like an array returned (@1?) is this possible?

    Read the article

  • x86 Assembly Question about outputting

    - by jdea
    My code looks like this _declspec(naked) void f(unsigned int input,unsigned int *output) { __asm{ push dword ptr[esp+4] call factorial pop ecx mov [output], eax //copy result ret } } __declspec(naked) unsigned int factorial(unsigned int n) { __asm{ push esi mov esi, dword ptr [esp+8] cmp esi, 1 jg RECURSE mov eax, 1 jmp END RECURSE: dec esi push esi call factorial pop esi inc esi mul esi END: pop esi ret } } Its a factorial function and I'm trying to output the answer after it recursively calculates the number that was passed in But what I get returned as an output is the same large number I keep getting Not sure about what is wrong with my output, by I also see this error CXX0030: Error: expression cannot be evaluated Thanks!

    Read the article

  • Copy constructor demo (crashing... case 2)

    - by AKN
    Please have a glance at this program: class CopyCon { public: char *name; CopyCon() { name = new char[20]; name = "Hai";//_tcscpy(name,"Hai"); } CopyCon(const CopyCon &objCopyCon) { name = new char[_tcslen(objCopyCon.name)+1]; _tcscpy(name,objCopyCon.name); } ~CopyCon() { if( name != NULL ) { delete[] name; name = NULL; } } }; int main() { CopyCon obj1; CopyCon obj2(obj1); cout<<obj1.name<<endl; cout<<obj2.name<<endl; } This program crashes on execution. Error: "Expression: _BLOCK_TYPE_IS_VALID(pHead-nBlockUse)" If I assign "Hai" to name using aasignment operator, its crashing. Where as when I use string func _tcscpy to assign "Hai" to name, its working perfectly. Can some one explain why so?

    Read the article

  • Delphi component or library to display mathematical expressions

    - by Svein Bringsli
    I'm looking for a simple component that displays mathematical expressions in Delphi. When I started out I thought it would be easy to find something on the net, but it turns out it was harder than anticipated. There are lots and lots of components that will parse mathematical expressions, but few (none?) that will display them. Ideally I would like a component as simple as a TLabel, where I could set the caption to some expression and it would be displayed correctly, but some sort of library that let's me draw expressions to a canvas would also be sufficient for my needs. Update: I'm not talking about plotting graphs of functions or something like that. I want to display (for instance) (X^2+3)/X like this:

    Read the article

  • Why does gcc think that I am trying to make a function call in my template function signature?

    - by nieldw
    GCC seem to think that I am trying to make a function call in my template function signature. Can anyone please tell me what is wrong with the following? 227 template<class edgeDecor, class vertexDecor, bool dir> 228 vector<Vertex<edgeDecor,vertexDecor,dir>> Graph<edgeDecor,vertexDecor,dir>::vertices() 229 { 230 return V; 231 }; GCC is giving the following: graph.h:228: error: a function call cannot appear in a constant-expression graph.h:228: error: template argument 3 is invalid graph.h:228: error: template argument 1 is invalid graph.h:228: error: template argument 2 is invalid graph.h:229: error: expected unqualified-id before ‘{’ token Thanks a lot.

    Read the article

< Previous Page | 365 366 367 368 369 370 371 372 373 374 375 376  | Next Page >