Search Results

Search found 35523 results on 1421 pages for 'nullable string'.

Page 375/1421 | < Previous Page | 371 372 373 374 375 376 377 378 379 380 381 382  | Next Page >

  • Persisting high score table in flash game without a network. (Featuring: HttpListenerException)

    - by bearcdp
    Hi everyone, this question is very programming-centric, but it's for a game so I figured I might as well post it here. I'm doing polishing work on a GGJ '11 game because it will be shown at an indie arcade tomorrow afternoon, and they're expecting our final build in the morning. We'd like to have a high score table that displays during attract mode, but since it's Flash (Flixel) it would require some networking, Mochi, or something to keep a record of these scores. Only problem is the machine we'd be running on probably won't have network access. As a quick solution, I thought I'd just write up a dinky little high score server in C#/.NET that could take basic GET requests for submitting scores and getting the score list. We're talking REAL basic, like blocking while waiting for an incoming request, run & forget console app, etc. There's no guarantee that our .swf won't get reloaded, and we'd like the scores to persist, so this server would pretty much exists to keep a safe copy of the scores that the game can add to and request, and occasionally the server will write the scores to a flat text file. But, HttpListener is giving me Error Code 87 'The parameter is incorrect.' Have any idea what I'm doing wrong? Or better yet, am I barking up the wrong tree and missing an obviously simpler solution? This is all I've got so far in my Main(): HttpListener listener = new HttpListener(); listener.Prefixes.Add("http://localhost:66666/"); listener.Start(); The exception happens at listener.Start(); and the stack trace is: at System.Net.HttpListener.AddAllPrefixes() at System.Net.HttpListener.Start() at WOSEBCE_ScoreServer.Program.Main(String[] args) in C:\Users\Michael\Documents\Visual Studio 2010\VS2010 Projects\WOSEBCE_ScoreServer\WOSEBCE_ScoreServer\Program.cs:line 24 at System.AppDomain._nExecuteAssembly(RuntimeAssembly assembly, String[] args) at System.AppDomain.ExecuteAssembly(String assemblyFile, Evidence assemblySecurity, String[] args) at Microsoft.VisualStudio.HostingProcess.HostProc.RunUsersAssembly() at System.Threading.ThreadHelper.ThreadStart_Context(Object state) at System.Threading.ExecutionContext.Run(ExecutionContext executionContext, ContextCallback callback, Object state, Boolean ignoreSyncCtx) at System.Threading.ExecutionContext.Run(ExecutionContext executionContext, ContextCallback callback, Object state) at System.Threading.ThreadHelper.ThreadStart()

    Read the article

  • The better way to ask for input?

    - by Skippy
    I am wondering which is the best way to go with java code. I need to create a class with simple prompts for input.. I have tried using both classes and cannot work out the particular benefits for each. Is this because I am still in the early stages of programming or are there situations that will occur as it becomes more complex?? import java.util.Scanner; public class myClass { Scanner stdin = new Scanner(System.in); public String getInput(String prompt) { System.out.print(prompt); return stdin.nextLine(); } ... or import java.io.*; public class myClass { public static void main(String[] args) throws IOException { BufferedReader stdin = new BufferedReader (new InputStreamReader (System.in)); System.out.print("Input something: "); String name = stdin.readLine(); I know these examples are showing different methods within these classes, but thought this might serve well for the discussion. I'm really not sure which site is the best to ask this on.

    Read the article

  • Unnamed Refactoring

    - by Liam McLennan
    This post is a message in a bottle. It cast it into the sea in the hope that it will one day return to me, stuffed to the cork with enlightenment. Yesterday I  tweeted, what is the name of the pattern where you replace a multi-way conditional with an associative array? I said ‘pattern’ but I meant ‘refactoring’. Anyway, no one replied so I will describe the refactoring here. Programmers tend to think imperatively, which leads to code such as: public int GetPopulation(string country) { if (country == "Australia") { return 22360793; } else if (country == "China") { return 1324655000; } else if (country == "Switzerland") { return 7782900; } else { throw new Exception("What ain't no country I ever heard of. They speak English in what?"); } } which is horrid. We can write a cleaner version, replacing the multi-way conditional with an associative array, treating the conditional as data: public int GetPopulation(string country) { if (!Populations.ContainsKey(country)) throw new Exception("The population of " + country + " could not be found."); return Populations[country]; } private Dictionary<string, int> Populations { get { return new Dictionary<string, int> { {"Australia", 22360793}, {"China", 1324655000}, {"Switzerland", 7782900} }; } } Does this refactoring already have a name? Otherwise, I propose Replace multi-way conditional with associative array

    Read the article

  • Best Practice: What can be the hashCode() method implementation if custom field used in equals() method are null?

    - by goodspeed
    What is the best practice to return a value for hashCode() method if custom field used in equals are null ? I have a situation, where equals() override is implemented using custom fields. Usually it it is better to override hashCode() also using that custom fields used in equals(). But if all the custom fields used in equals() are null, then what would be the best implementation for hashCode()? Example: class Person { private String firstName; private String lastName; public String getFirstName() { return firstName; } public String getLastName() { return lastName; } @Override public boolean equals(Object object) { boolean result = false; if (object == null || object.getClass() != getClass()) { result = false; } else { Person person = (Person) object; if (this.firstName == person.getFirstName() && this.lastName == tiger.getLastName()) { result = true; } } return result; } @Override public int hashCode() { int hash = 3; if(this.firstName == null || this.lastName == null) { // <b>What is the best practice here, </b> // <b>is return super.hashCode() better ?</b> } hash = 7 * hash + this.firstName.hashCode(); hash = 7 * hash + this.lastName.hashCode(); return hash; } } is it required to check for null in hashCode() ? If yes, what should be returned if custom values are null ?

    Read the article

  • Convert collections of enums to collection of strings and vice versa

    - by Michael Freidgeim
    Recently I needed to convert collections of  strings, that represent enum names, to collection of enums, and opposite,  to convert collections of   enums  to collection of  strings. I didn’t find standard LINQ extensions.However, in our big collection of helper extensions I found what I needed - just with different names: /// <summary> /// Safe conversion, ignore any unexpected strings/// Consider to name as Convert extension /// </summary> /// <typeparam name="EnumType"></typeparam> /// <param name="stringsList"></param> /// <returns></returns> public static List<EnumType> StringsListAsEnumList<EnumType>(this List<string> stringsList) where EnumType : struct, IComparable, IConvertible, IFormattable     { List<EnumType> enumsList = new List<EnumType>(); foreach (string sProvider in stringsList)     {     EnumType provider;     if (EnumHelper.TryParse<EnumType>(sProvider, out provider))     {     enumsList.Add(provider);     }     }     return enumsList;     }/// <summary> /// Convert each element of collection to string /// </summary> /// <typeparam name="T"></typeparam> /// <param name="objects"></param> /// <returns></returns> public static IEnumerable<string> ToStrings<T>(this IEnumerable<T> objects) {//from http://www.c-sharpcorner.com/Blogs/997/using-linq-to-convert-an-array-from-one-type-to-another.aspx return objects.Select(en => en.ToString()); }

    Read the article

  • Are Vala and desktopcouch ready?

    - by pavolzetor
    Hi, I have started writting rss reader in Vala, but I don't know, what database system should I use, I cannot connect to couchdb and sqlite works fine, but I would like use couchdb because of ubuntu one. I have natty with latest updates public CouchDB.Session session; public CouchDB.Database db; public string feed_table = "feed"; public string item_table = "item"; public struct field { string name; string val; } // constructor public Database() { try { this.session = new CouchDB.Session(); } catch (Error e) { stderr.printf ("%s a\n", e.message); } try { this.db = new CouchDB.Database (this.session, "test"); } catch (Error e) { stderr.printf ("%s a\n", e.message); } try { this.session.get_database_info("test"); } catch (Error e) { stderr.printf ("%s aa\n", e.message); } try { var newdoc = new CouchDB.Document (); newdoc.set_boolean_field ("awesome", true); newdoc.set_string_field ("phone", "555-VALA"); newdoc.set_double_field ("pi", 3.14159); newdoc.set_int_field ("meaning_of_life", 42); this.db.put_document (newdoc); // store document } catch (Error e) { stderr.printf ("%s aaa\n", e.message); } reports $ ./xml_parser rss.xmlCannot connect to destination (127.0.0.1) aa Cannot connect to destination (127.0.0.1) aaa

    Read the article

  • Interfaces on an abstract class

    - by insta
    My coworker and I have different opinions on the relationship between base classes and interfaces. I'm of the belief that a class should not implement an interface unless that class can be used when an implementation of the interface is required. In other words, I like to see code like this: interface IFooWorker { void Work(); } abstract class BaseWorker { ... base class behaviors ... public abstract void Work() { } protected string CleanData(string data) { ... } } class DbWorker : BaseWorker, IFooWorker { public void Work() { Repository.AddCleanData(base.CleanData(UI.GetDirtyData())); } } The DbWorker is what gets the IFooWorker interface, because it is an instantiatable implementation of the interface. It completely fulfills the contract. My coworker prefers the nearly identical: interface IFooWorker { void Work(); } abstract class BaseWorker : IFooWorker { ... base class behaviors ... public abstract void Work() { } protected string CleanData(string data) { ... } } class DbWorker : BaseWorker { public void Work() { Repository.AddCleanData(base.CleanData(UI.GetDirtyData())); } } Where the base class gets the interface, and by virtue of this all inheritors of the base class are of that interface as well. This bugs me but I can't come up with concrete reasons why, outside of "the base class cannot stand on its own as an implementation of the interface". What are the pros & cons of his method vs. mine, and why should one be used over another?

    Read the article

  • Do there exist programming languages where a variable can truly know its own name?

    - by Job
    In PHP and Python one can iterate over the local variables and, if there is only once choice where the value matches, you could say that you know what the variable's name is, but this does not always work. Machine code does not have variable names. C compiles to assembly and does not have any native reflection capabilities, so it would not know it's name. (Edit: per Anton's answer the pre-processor can know the variable's name). Do there exist programming languages where a variable would know it's name? It gets tricky if you do something like b = a and b does not become a copy of a but a reference to the same place. EDIT: Why in the world would you want this? I can think of one example: error checking that can survive automatic refactoring. Consider this C# snippet: private void CheckEnumStr(string paramName, string paramValue) { if (paramName != "pony" && paramName != "horse") { string exceptionMessage = String.Format( "Unexpected value '{0}' of the parameter named '{1}'.", paramValue, paramName); throw new ArgumentException(exceptionMessage); } } ... CheckEnumStr("a", a); // Var 'a' does not know its name - this will not survive naive auto-refactoring There are other libraries provided by Microsoft and others that allow to check for errors (sorry the names have escaped me). I have seen one library which with the help of closures/lambdas can accomplish error checking that can survive refactoring, but it does not feel idiomatic. This would be one reason why I might want a language where a variable knows its name.

    Read the article

  • Why is the remove function not working for hashmaps? [migrated]

    - by John Marston
    I am working on a simple project that obtains data from an input file, gets what it needs and prints it to a file. I am basically getting word frequency so each key is a string and the value is its frequency in the document. The problem however, is that I need to print out these values to a file in descending order of frequency. After making my hashmap, this is the part of my program that sorts it and writes it to a file. //Hashmap I create Map<String, Integer> map = new ConcurrentHashMap<String, Integer>(); //function to sort hashmap while (map.isEmpty() == false){ for (Entry<String, Integer> entry: map.entrySet()){ if (entry.getValue() > valueMax){ max = entry.getKey(); System.out.println("max: " + max); valueMax = entry.getValue(); System.out.println("value: " + valueMax); } } map.remove(max); out.write(max + "\t" + valueMax + "\n"); System.out.println(max + "\t" + valueMax); } When I run this i get: t 9 t 9 t 9 t 9 t 9 .... so it appears the remove function is not working as it keeps getting the same value. I'm thinking i have an issue with a scope rule or I just don't understand hashmaps very well. If anyone knows of a better way to sort a hashmap and print it, I would welcome a suggestion. thanks

    Read the article

  • [LINQ] Master&ndash;Detail Same Record (I)

    - by JTorrecilla
    PROBLEM Firstly, I am working on a project based on LINQ, EF, and C# with VS2010. The following Table shows what I have and what I want to show. Header C1 C2 C3 1 P1 01/01/2011 2 P2 01/02/2011 Details 1 1 D1 2 1 D2 3 1 D3 4 2 D1 5 2 D4 Expected Results 1 P1 01/01/2011 D1, D2, D3 2 P2 01/02/2011 D1,D4   IDEAS At the begin I got 3 possible ways: - Doing inside the DB:  It could be achieved from DB with a CURSOR in a Stored Procedure. - Doing from .NET with LOOPS. - Doing with LINQ (I love it!!) FIRST APROX Example with a simple CLASS with a LIST: With and Employee Class that acts as Header Table: 1: public class Employee 2: { 3: public Employee () { } 4: public Int32 ID { get; set; } 5: public String FirstName{ get; set; } 6: public String LastName{ get; set; } 7: public List<string> Numbers{ get; set; } // Acts as Details Table 8: } We can show all numbers contained by Employee: 1: List<Employee > listado = new List<Employee >(); 2: //Fill Listado 3: var query= from Employee em in listado 4: let Nums= string.Join(";", em.Numbers) 5: select new { 6: em.Name, 7: Nums 8: }; The “LET” operator allows us to host the results of “Join” of the Numbers List of the Employee Class. A little example. ASAP I will post the second part to achieve the same with Entity Framework. Best Regards

    Read the article

  • How to call a WCF service using ksoap2 on android?

    - by Qing
    Hi all, Here is my code import org.ksoap2.*; import org.ksoap2.serialization.*; import org.ksoap2.transport.*; import android.app.Activity; import android.os.Bundle; import android.widget.TextView; public class ksop2test extends Activity { /** Called when the activity is first created. */ private static final String METHOD_NAME = "SayHello"; // private static final String METHOD_NAME = "HelloWorld"; private static final String NAMESPACE = "http://tempuri.org"; // private static final String NAMESPACE = "http://tempuri.org"; private static final String URL = "http://192.168.0.2:8080/HelloWCF/Service1.svc"; // private static final String URL = "http://192.168.0.2:8080/webservice1/Service1.asmx"; final String SOAP_ACTION = "http://tempuri.org/IService1/SayHello"; // final String SOAP_ACTION = "http://tempuri.org/HelloWorld"; TextView tv; StringBuilder sb; @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); tv = new TextView(this); sb = new StringBuilder(); call(); tv.setText(sb.toString()); setContentView(tv); } public void call() { try { SoapObject request = new SoapObject(NAMESPACE, METHOD_NAME); request.addProperty("name", "Qing"); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope( SoapEnvelope.VER11); envelope.dotNet = true; envelope.setOutputSoapObject(request); HttpTransportSE androidHttpTransport = new HttpTransportSE(URL); androidHttpTransport.call(SOAP_ACTION, envelope); sb.append(envelope.toString() + "\n");//cannot get the xml request send SoapPrimitive result = (SoapPrimitive)envelope.getResponse(); //to get the data String resultData = result.toString(); // 0 is the first object of data sb.append(resultData + "\n"); } catch (Exception e) { sb.append("Error:\n" + e.getMessage() + "\n"); } } } I can successfully access .asmx service, but when I try to call a wcf service the virtual machine said : Error: expected:END_TAG{http://schemas.xmlsoap.org/soap/envelope/}Body(position:END_TAG@1:712 in java.io.InputStreamReader@43ba6798 How to print what the request send? Here is the wcf wsdl: <wsdl:definitions name="Service1" targetNamespace="http://tempuri.org/"> - <wsdl:types> - <xsd:schema targetNamespace="http://tempuri.org/Imports"> <xsd:import schemaLocation="http://para-bj.para.local:8080/HelloWCF/Service1.svc?xsd=xsd0" namespace="http://tempuri.org/"/> <xsd:import schemaLocation="http://para-bj.para.local:8080/HelloWCF/Service1.svc?xsd=xsd1" namespace="http://schemas.microsoft.com/2003/10/Serialization/"/> </xsd:schema> </wsdl:types> - <wsdl:message name="IService1_SayHello_InputMessage"> <wsdl:part name="parameters" element="tns:SayHello"/> </wsdl:message> - <wsdl:message name="IService1_SayHello_OutputMessage"> <wsdl:part name="parameters" element="tns:SayHelloResponse"/> </wsdl:message> - <wsdl:portType name="IService1"> - <wsdl:operation name="SayHello"> <wsdl:input wsaw:Action="http://tempuri.org/IService1/SayHello" message="tns:IService1_SayHello_InputMessage"/> <wsdl:output wsaw:Action="http://tempuri.org/IService1/SayHelloResponse" message="tns:IService1_SayHello_OutputMessage"/> </wsdl:operation> </wsdl:portType> - <wsdl:binding name="BasicHttpBinding_IService1" type="tns:IService1"> <soap:binding transport="http://schemas.xmlsoap.org/soap/http"/> - <wsdl:operation name="SayHello"> <soap:operation soapAction="http://tempuri.org/IService1/SayHello" style="document"/> - <wsdl:input> <soap:body use="literal"/> </wsdl:input> - <wsdl:output> <soap:body use="literal"/> </wsdl:output> </wsdl:operation> </wsdl:binding> - <wsdl:service name="Service1"> - <wsdl:port name="BasicHttpBinding_IService1" binding="tns:BasicHttpBinding_IService1"> <soap:address location="http://para-bj.para.local:8080/HelloWCF/Service1.svc"/> </wsdl:port> </wsdl:service> </wsdl:definitions> It uses in tag and the asmx uses in tag what's the difference? Thanks. -Qing

    Read the article

  • Code Contracts with Interfaces: "Method Invocation skipped. Compiler will generate method invocation

    - by Jörg Battermann
    Good evening, I just started playing with Microsoft.Contracts (latest version) and plugging it on top of a sample interface and right now it looks like this: namespace iRMA2.Core.Interfaces { using System; using System.Collections.Generic; using System.ComponentModel.Composition; using System.Diagnostics.Contracts; /// <summary> /// Base Interface declarations for iRMA2 Extensions /// </summary> [InheritedExport] [ContractClass(typeof(IiRMA2ExtensionContract))] public interface IiRMA2Extension { /// <summary> /// Gets the name. /// </summary> /// <value>The name of the Extension.</value> string Name { get; } /// <summary> /// Gets the description. /// </summary> /// <value>The description.</value> string Description { get; } /// <summary> /// Gets the author of the extension. Please provide complete information to get in touch with author(s) and the corresponding department /// </summary> /// <value>The author of the extensions.</value> string Author { get; } /// <summary> /// Gets the major version. /// </summary> /// <value>The major version of the extension.</value> int MajorVersion { get; } /// <summary> /// Gets the minor version. /// </summary> /// <value>The minor version.</value> int MinorVersion { get; } /// <summary> /// Gets the build number. /// </summary> /// <value>The build number.</value> int BuildNumber { get; } /// <summary> /// Gets the revision. /// </summary> /// <value>The revision.</value> int Revision { get; } /// <summary> /// Gets the depends on. /// </summary> /// <value>The dependencies to other <c>IiRMA2Extension</c> this one has.</value> IList<IiRMA2Extension> DependsOn { get; } } /// <summary> /// Contract class for <c>IiRMA2Extension</c> /// </summary> [ContractClassFor(typeof(IiRMA2Extension))] internal sealed class IiRMA2ExtensionContract : IiRMA2Extension { #region Implementation of IiRMA2Extension /// <summary> /// Gets or sets the name. /// </summary> /// <value>The name of the Extension.</value> public string Name { get { Contract.Ensures(!String.IsNullOrEmpty(Contract.Result<string>())); return default(string); } set { Contract.Requires(value != null); } } /// <summary> /// Gets the description. /// </summary> /// <value>The description.</value> public string Description { get { throw new NotImplementedException(); } } /// <summary> /// Gets the author of the extension. Please provide complete information to get in touch with author(s) and the corresponding department /// </summary> /// <value>The author of the extensions.</value> public string Author { get { throw new NotImplementedException(); } } /// <summary> /// Gets the major version. /// </summary> /// <value>The major version of the extension.</value> public int MajorVersion { get { throw new NotImplementedException(); } } /// <summary> /// Gets the minor version. /// </summary> /// <value>The minor version.</value> public int MinorVersion { get { throw new NotImplementedException(); } } /// <summary> /// Gets the build number. /// </summary> /// <value>The build number.</value> public int BuildNumber { get { throw new NotImplementedException(); } } /// <summary> /// Gets the revision. /// </summary> /// <value>The revision.</value> public int Revision { get { throw new NotImplementedException(); } } /// <summary> /// Gets the Extensions this one depends on. /// </summary> /// <value>The dependencies to other <c>IiRMA2Extension</c> this one has.</value> public IList<IiRMA2Extension> DependsOn { get { Contract.Ensures(Contract.Result<IList<IiRMA2Extension>>() != null); return default(IList<IiRMA2Extension>); } } #endregion } } Now why are the two Contract.Ensures(...) 'blured' out visually with the tooltip saying "Method Invocation skipped. Compiler will generate method invocation because the method is conditional or it is partial method without implementation" and in fact the CodeContracts output does not count/show them... What am I missing & doing wrong here? -J

    Read the article

  • Having trouble binding a ksoap object to an ArrayList in Android

    - by Maskau
    I'm working on an app that calls a web service, then the webservice returns an array list. My problem is I am having trouble getting the data into the ArrayList and then displaying in a ListView. Any ideas what I am doing wrong? I know for a fact the web service returns an ArrayList. Everything seems to be working fine, just no data in the ListView or the ArrayList.....Thanks in advance! EDIT: So I added more code to the catch block of run() and now it's returning "org.ksoap2.serialization.SoapObject".....no more no less....and I am even more confused now... package com.maskau; import java.util.ArrayList; import org.ksoap2.SoapEnvelope; import org.ksoap2.serialization.PropertyInfo; import org.ksoap2.serialization.SoapObject; import org.ksoap2.serialization.SoapSerializationEnvelope; import org.ksoap2.transport.AndroidHttpTransport; import android.app.*; import android.os.*; import android.widget.ArrayAdapter; import android.widget.Button; import android.widget.EditText; import android.widget.ListView; import android.widget.TextView; import android.view.View; import android.view.View.OnClickListener; public class Home extends Activity implements Runnable{ /** Called when the activity is first created. */ public static final String SOAP_ACTION = "http://bb.mcrcog.com/GetArtist"; public static final String METHOD_NAME = "GetArtist"; public static final String NAMESPACE = "http://bb.mcrcog.com"; public static final String URL = "http://bb.mcrcog.com/karaoke/service.asmx"; String wt; public static ProgressDialog pd; TextView text1; ListView lv; static EditText myEditText; static Button but; private ArrayList<String> Artist_Result = new ArrayList<String>(); @Override public void onCreate(Bundle icicle) { super.onCreate(icicle); setContentView(R.layout.main); myEditText = (EditText)findViewById(R.id.myEditText); text1 = (TextView)findViewById(R.id.text1); lv = (ListView)findViewById(R.id.lv); but = (Button)findViewById(R.id.but); but.setOnClickListener(new OnClickListener() { @Override public void onClick(View v) { wt = ("Searching for " + myEditText.getText().toString()); text1.setText(""); pd = ProgressDialog.show(Home.this, "Working...", wt , true, false); Thread thread = new Thread(Home.this); thread.start(); } } ); } public void run() { try { SoapObject request = new SoapObject(NAMESPACE, METHOD_NAME); PropertyInfo pi = new PropertyInfo(); pi.setName("ArtistQuery"); pi.setValue(Home.myEditText.getText().toString()); request.addProperty(pi); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope(SoapEnvelope.VER11); envelope.dotNet = true; envelope.setOutputSoapObject(request); AndroidHttpTransport at = new AndroidHttpTransport(URL); at.call(SOAP_ACTION, envelope); java.util.Vector<Object> rs = (java.util.Vector<Object>)envelope.getResponse(); if (rs != null) { for (Object cs : rs) { Artist_Result.add(cs.toString()); } } } catch (Exception e) { // Added this line, throws "org.ksoap2.serialization.SoapObject" when run Artist_Result.add(e.getMessage()); } handler.sendEmptyMessage(0); } private Handler handler = new Handler() { @Override public void handleMessage(Message msg) { ArrayAdapter<String> aa; aa = new ArrayAdapter<String>(Home.this, android.R.layout.simple_list_item_1, Artist_Result); lv.setAdapter(aa); try { if (Artist_Result.isEmpty()) { text1.setText("No Results"); } else { text1.setText("Complete"); myEditText.setText("Search Artist"); } } catch(Exception e) { text1.setText(e.getMessage()); } aa.notifyDataSetChanged(); pd.dismiss(); } }; }

    Read the article

  • From AutoComplete textbox to database search and display?

    - by svebee
    Hello everyone, I have a small problem so I would be grateful if anyone could help me in any way. Thank you ;) I have this little "application", and I want when someone type in a AutoComplete textbox for example "New" it automatically displays "New York" as a option and that (AutoComplete function) works fine. But I want when user type in full location (or AutoComplete do it for him) - that text (location) input is forwarded to a database search which then searches through database and "collects" all rows with user-typed location. For example if user typed in "New York", database search would find all rows with "New York" in it. When it finds one/more row(s) it would display them below. In images... I have this when user is typing... http://www.imagesforme.com/show.php/1093305_SNAG0000.jpg I have this when user choose a AutoComplete location (h)ttp://www.imagesforme.com/show.php/1093306_SNAG0001.jpg (remove () on the beggining) But I wanna this when user choose a AutoComplete location (h)ttp://www.imagesforme.com/show.php/1093307_CopyofSNAG0001.jpg (remove () on the beggining) Complete Code package com.svebee.prijevoz; import android.app.Activity; import android.database.Cursor; import android.database.sqlite.SQLiteDatabase; import android.os.Bundle; import android.util.Log; import android.widget.ArrayAdapter; import android.widget.AutoCompleteTextView; import android.widget.TextView; public class ZelimDoci extends Activity { TextView lista; static final String[] STANICE = new String[] { "New York", "Chicago", "Dallas", "Los Angeles" }; /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.zelimdoci); AutoCompleteTextView textView = (AutoCompleteTextView) findViewById(R.id.autocomplete_country); ArrayAdapter<String> adapter = new ArrayAdapter<String>(this, R.layout.list_item, STANICE); textView.setAdapter(adapter); lista = (TextView)findViewById(R.id.lista); SQLiteDatabase myDB= null; String TableName = "Database"; String Data=""; /* Create a Database. */ try { myDB = this.openOrCreateDatabase("Database", MODE_PRIVATE, null); /* Create a Table in the Database. */ myDB.execSQL("CREATE TABLE IF NOT EXISTS " + TableName + " (Field1 INT(3) UNIQUE, Field2 INT(3) UNIQUE, Field3 VARCHAR UNIQUE, Field4 VARCHAR UNIQUE);"); Cursor a = myDB.rawQuery("SELECT * FROM Database where Field1 == 1", null); a.moveToFirst(); if (a == null) { /* Insert data to a Table*/ myDB.execSQL("INSERT INTO " + TableName + " (Field1, Field2, Field3, Field4)" + " VALUES (1, 119, 'New York', 'Dallas');"); myDB.execSQL("INSERT INTO " + TableName + " (Field1, Field2, Field3, Field4)" + " VALUES (9, 587, 'California', 'New York');"); } myDB.execSQL("INSERT INTO " + TableName + " (Field1, Field2, Field3, Field4)" + " VALUES (87, 57, 'Canada', 'London');"); } /*retrieve data from database */ Cursor c = myDB.rawQuery("SELECT * FROM " + TableName , null); int Column1 = c.getColumnIndex("Field1"); int Column2 = c.getColumnIndex("Field2"); int Column3 = c.getColumnIndex("Field3"); int Column4 = c.getColumnIndex("Field4"); // Check if our result was valid. c.moveToFirst(); if (c != null) { // Loop through all Results do { String LocationA = c.getString(Column3); String LocationB = c.getString(Column4); int Id = c.getInt(Column1); int Linija = c.getInt(Column2); Data =Data +Id+" | "+Linija+" | "+LocationA+"-"+LocationB+"\n"; }while(c.moveToNext()); } lista.setText(String.valueOf(Data)); } catch(Exception e) { Log.e("Error", "Error", e); } finally { if (myDB != null) myDB.close(); } } } .xml file <?xml version="1.0" encoding="utf-8"?> <LinearLayout xmlns:android="http://schemas.android.com/apk/res/android" android:orientation="vertical" android:layout_width="fill_parent" android:layout_height="fill_parent" > <TextView android:layout_width="fill_parent" android:layout_height="wrap_content" android:textSize="20sp" android:gravity="center_horizontal" android:padding="10sp" android:text="Test AutoComplete"/> <LinearLayout xmlns:android="http://schemas.android.com/apk/res/android" android:orientation="horizontal" android:layout_width="fill_parent" android:layout_height="wrap_content" android:padding="5dp"> <TextView android:layout_width="wrap_content" android:layout_height="wrap_content" android:text="AutoComplete" /> <AutoCompleteTextView android:id="@+id/autocomplete_country" android:layout_width="fill_parent" android:layout_height="wrap_content" android:layout_marginLeft="5dp"/> </LinearLayout> </LinearLayout>

    Read the article

  • Loading FireMonkey style resourses with RTTI

    - by HeMet
    I am trying to write class that inherits from FMX TStyledControl. When style is updated it loads style resource objects to cache. I created project group for package with custom controls and test FMX HD project as it describes in Delphi help. After installing package and placing TsgSlideHost on the test form I run test app. It’s work well, but when I close it and try to rebuild package RAD Studio says “Error in rtl160.bpl” or “invalid pointer operation”. It seems what problem in LoadToCacheIfNeeded procedure from TsgStyledControl, but I’m not understand why. Is there any restriction on using RTTI with FMX styles or anything? TsgStyledControl sources: unit SlideGUI.TsgStyledControl; interface uses System.SysUtils, System.Classes, System.Types, FMX.Types, FMX.Layouts, FMX.Objects, FMX.Effects, System.UITypes, FMX.Ani, System.Rtti, System.TypInfo; type TCachedAttribute = class(TCustomAttribute) private fStyleName: string; public constructor Create(const aStyleName: string); property StyleName: string read fStyleName; end; TsgStyledControl = class(TStyledControl) private procedure CacheStyleObjects; procedure LoadToCacheIfNeeded(aField: TRttiField); protected function FindStyleResourceAs<T: class>(const AStyleLookup: string): T; function GetStyleName: string; virtual; abstract; function GetStyleObject: TControl; override; public procedure ApplyStyle; override; published { Published declarations } end; implementation { TsgStyledControl } procedure TsgStyledControl.ApplyStyle; begin inherited; CacheStyleObjects; end; procedure TsgStyledControl.CacheStyleObjects; var ctx: TRttiContext; typ: TRttiType; fld: TRttiField; begin ctx := TRttiContext.Create; try typ := ctx.GetType(Self.ClassType); for fld in typ.GetFields do LoadFromCacheIfNeeded(fld); finally ctx.Free end; end; function TsgStyledControl.FindStyleResourceAs<T>(const AStyleLookup: string): T; var fmxObj: TFmxObject; begin fmxObj := FindStyleResource(AStyleLookup); if Assigned(fmxObj) and (fmxObj is T) then Result := fmxObj as T else Result := nil; end; function TsgStyledControl.GetStyleObject: TControl; var S: TResourceStream; begin if (FStyleLookup = '') then begin if FindRCData(HInstance, GetStyleName) then begin S := TResourceStream.Create(HInstance, GetStyleName, RT_RCDATA); try Result := TControl(CreateObjectFromStream(nil, S)); Exit; finally S.Free; end; end; end; Result := inherited GetStyleObject; end; procedure TsgStyledControl.LoadToCacheIfNeeded(aField: TRttiField); var attr: TCustomAttribute; styleName: string; styleObj: TFmxObject; val: TValue; begin for attr in aField.GetAttributes do begin if attr is TCachedAttribute then begin styleName := TCachedAttribute(attr).StyleName; if styleName <> '' then begin styleObj := FindStyleResource(styleName); val := TValue.From<TFmxObject>(styleObj); aField.SetValue(Self, val); end; end; end; end; { TCachedAttribute } constructor TCachedAttribute.Create(const aStyleName: string); begin fStyleName := aStyleName; end; end. Using of TsgStyledControl: type TsgSlideHost = class(TsgStyledControl) private [TCached('SlideHost')] fSlideHost: TLayout; [TCached('SideMenu')] fSideMenuLyt: TLayout; [TCached('SlideContainer')] fSlideContainer: TLayout; fSideMenu: IsgSideMenu; procedure ReapplyProps; procedure SetSideMenu(const Value: IsgSideMenu); protected function GetStyleName: string; override; function GetStyleObject: TControl; override; procedure UpdateSideMenuLyt; public constructor Create(AOwner: TComponent); override; procedure ApplyStyle; override; published property SideMenu: IsgSideMenu read fSideMenu write SetSideMenu; end;

    Read the article

  • EF Code First to SQL Azure

    - by Predrag Pejic
    I am using EF Code First to create a database on local .\SQLEXPRESS. Among others. I have these 2 classes: public class Shop { public int ShopID { get; set; } [Required(AllowEmptyStrings = false, ErrorMessage = "You must enter a name!")] [MaxLength(25, ErrorMessage = "Name must be 25 characters or less")] public string Name { get; set; } [Required(AllowEmptyStrings = false, ErrorMessage = "You must enter an address!")] [MaxLength(30, ErrorMessage = "Address must be 30 characters or less")] public string Address { get; set; } [Required(AllowEmptyStrings = false, ErrorMessage = "You must enter a valid city name!")] [MaxLength(30, ErrorMessage = "City name must be 30 characters or less")] public string City { get; set; } [Required(AllowEmptyStrings = false, ErrorMessage = "You must enter a phone number!")] [MaxLength(14, ErrorMessage = "Phone number must be 14 characters or less")] public string Phone { get; set; } [MaxLength(100, ErrorMessage = "Description must be 50 characters or less")] public string Description { get; set; } [Required(AllowEmptyStrings = false, ErrorMessage = "You must enter a WorkTime!")] public DateTime WorkTimeBegin { get; set; } [Required(AllowEmptyStrings = false, ErrorMessage = "You must enter a WorkTime!")] public DateTime WorkTimeEnd { get; set; } public DateTime? SaturdayWorkTimeBegin { get; set; } public DateTime? SaturdayWorkTimeEnd { get; set; } public DateTime? SundayWorkTimeBegin { get; set; } public DateTime? SundayWorkTimeEnd { get; set; } public int ShoppingPlaceID { get; set; } public virtual ShoppingPlace ShoppingPlace { get; set; } public virtual ICollection<Category> Categories { get; set; } } public class ShoppingPlace { [Key] public int ShopingplaceID { get; set; } [Required(AllowEmptyStrings = false, ErrorMessage = "You must enter a name!")] [MaxLength(25, ErrorMessage = "Name must be 25 characters or less")] public string Name { get; set; } [Required(AllowEmptyStrings = false, ErrorMessage = "You must enter an address!")] [MaxLength(50, ErrorMessage = "Address must be 50 characters or less")] public string Address { get; set; } [Required(AllowEmptyStrings = false, ErrorMessage = "You must enter a city name!")] [MaxLength(30, ErrorMessage = "City must be 30 characters or less")] public string City { get; set; } [Required(AllowEmptyStrings = false, ErrorMessage = "You must enter a valid phone number!")] [MaxLength(14, ErrorMessage = "Phone number must be 14 characters or less")] public string Phone { get; set; } public int ShoppingCenterID { get; set; } public virtual ShoppingCenter ShoppingCenter { get; set; } public virtual ICollection<Shop> Shops { get; set; } } and a method in DbContext: modelBuilder.Entity<Item>() .HasRequired(p => p.Category) .WithMany(a => a.Items) .HasForeignKey(a => a.CategoryID) .WillCascadeOnDelete(false); modelBuilder.Entity<Category>() .HasRequired(a => a.Shop) .WithMany(a => a.Categories) .HasForeignKey(a => a.ShopID) .WillCascadeOnDelete(false); modelBuilder.Entity<Shop>() .HasOptional(a => a.ShoppingPlace) .WithMany(a => a.Shops) .HasForeignKey(a => a.ShoppingPlaceID) .WillCascadeOnDelete(false); modelBuilder.Entity<ShoppingPlace>() .HasOptional(a => a.ShoppingCenter) .WithMany(a => a.ShoppingPlaces) .HasForeignKey(a => a.ShoppingCenterID) .WillCascadeOnDelete(false); Why I can't create Shop without creating and populating ShopingPlace. How to achieve that? EDIT: Tried with: modelBuilder.Entity<Shop>() .HasOptional(a => a.ShoppingPlace) .WithOptionalPrincipal(); modelBuilder.Entity<ShoppingPlace>() .HasOptional(a => a.ShoppingCenter) .WithOptionalPrincipal(); and it passed, but what is the difference? And why in SQL Server i am allowed to see ShoppingPlaceID and ShoppingPlace_ShopingPlaceID when in the case of Item and Category i see only one?

    Read the article

  • running multi threads in Java

    - by owca
    My task is to simulate activity of couple of persons. Each of them has few activities to perform in some random time: fast (0-5s), medium(5-10s), slow(10-20s) and very slow(20-30s). Each person performs its task independently in the same time. At the beginning of new task I should print it's random time, start the task and then after time passes show next task's time and start it. I've written run() function that counts time, but now it looks like threads are done one after another and not in the same time or maybe they're just printed in this way. public class People{ public static void main(String[] args){ Task tasksA[]={new Task("washing","fast"), new Task("reading","slow"), new Task("shopping","medium")}; Task tasksM[]={new Task("sleeping zzzzzzzzzz","very slow"), new Task("learning","slow"), new Task(" :** ","slow"), new Task("passing an exam","slow") }; Task tasksJ[]={new Task("listening music","medium"), new Task("doing nothing","slow"), new Task("walking","medium") }; BusyPerson friends[]={ new BusyPerson("Alice",tasksA), new BusyPerson("Mark",tasksM), new BusyPerson("John",tasksJ)}; System.out.println("STARTING....................."); for(BusyPerson f: friends) (new Thread(f)).start(); System.out.println("DONE........................."); } } class Task { private String task; private int time; private Task[]tasks; public Task(String t, String s){ task = t; Speed speed = new Speed(); time = speed.getSpeed(s); } public Task(Task[]tab){ Task[]table=new Task[tab.length]; for(int i=0; i < tab.length; i++){ table[i] = tab[i]; } this.tasks = table; } } class Speed { private static String[]hows = {"fast","medium","slow","very slow"}; private static int[]maxs = {5000, 10000, 20000, 30000}; public Speed(){ } public static int getSpeed( String speedString){ String s = speedString; int up_limit=0; int down_limit=0; int time=0; //get limits of time for(int i=0; i<hows.length; i++){ if(s.equals(hows[i])){ up_limit = maxs[i]; if(i>0){ down_limit = maxs[i-1]; } else{ down_limit = 0; } } } //get random time within the limits Random rand = new Random(); time = rand.nextInt(up_limit) + down_limit; return time; } } class BusyPerson implements Runnable { private String name; private Task[] person_tasks; private BusyPerson[]persons; public BusyPerson(String s, Task[]t){ name = s; person_tasks = t; } public BusyPerson(BusyPerson[]tab){ BusyPerson[]table=new BusyPerson[tab.length]; for(int i=0; i < tab.length; i++){ table[i] = tab[i]; } this.persons = table; } public void run() { int time = 0; double t1=0; for(Task t: person_tasks){ t1 = (double)t.time/1000; System.out.println(name+" is... "+t.task+" "+t.speed+ " ("+t1+" sec)"); while (time == t.time) { try { Thread.sleep(10); } catch(InterruptedException exc) { System.out.println("End of thread."); return; } time = time + 100; } } } } And my output : STARTING..................... DONE......................... Mark is... sleeping zzzzzzzzzz very slow (36.715 sec) Mark is... learning slow (10.117 sec) Mark is... :** slow (29.543 sec) Mark is... passing an exam slow (23.429 sec) Alice is... washing fast (1.209 sec) Alice is... reading slow (23.21 sec) Alice is... shopping medium (11.237 sec) John is... listening music medium (8.263 sec) John is... doing nothing slow (13.576 sec) John is... walking medium (11.322 sec) Whilst it should be like this : STARTING..................... DONE......................... John is... listening music medium (7.05 sec) Alice is... washing fast (3.268 sec) Mark is... sleeping zzzzzzzzzz very slow (23.71 sec) Alice is... reading slow (15.516 sec) John is... doing nothing slow (13.692 sec) Alice is... shopping medium (8.371 sec) Mark is... learning slow (13.904 sec) John is... walking medium (5.172 sec) Mark is... :** slow (12.322 sec) Mark is... passing an exam very slow (27.1 sec)

    Read the article

  • How to include multiple XML files in a single XML file for deserialization by XmlSerializer in .NET

    - by harrydev
    Hi, is it possible to use the XmlSerializer in .NET to load an XML file which includes other XML files? And how? This, in order to share XML state easily in two "parent" XML files, e.g. AB and BC in below. Example: using System; using System.IO; using System.Xml.Serialization; namespace XmlSerializerMultipleFilesTest { [Serializable] public class A { public int Value { get; set; } } [Serializable] public class B { public double Value { get; set; } } [Serializable] public class C { public string Value { get; set; } } [Serializable] public class AB { public A A { get; set; } public B B { get; set; } } [Serializable] public class BC { public B B { get; set; } public C C { get; set; } } class Program { public static void Serialize<T>(T data, string filePath) { using (var writer = new StreamWriter(filePath)) { var xmlSerializer = new XmlSerializer(typeof(T)); xmlSerializer.Serialize(writer, data); } } public static T Deserialize<T>(string filePath) { using (var reader = new StreamReader(filePath)) { var xmlSerializer = new XmlSerializer(typeof(T)); return (T)xmlSerializer.Deserialize(reader); } } static void Main(string[] args) { const string fileNameA = @"A.xml"; const string fileNameB = @"B.xml"; const string fileNameC = @"C.xml"; const string fileNameAB = @"AB.xml"; const string fileNameBC = @"BC.xml"; var a = new A(){ Value = 42 }; var b = new B(){ Value = Math.PI }; var c = new C(){ Value = "Something rotten" }; Serialize(a, fileNameA); Serialize(b, fileNameB); Serialize(c, fileNameC); // How can AB and BC be deserialized from single // files which include two of the A, B or C files. // Using ideally something like: var ab = Deserialize<AB>(fileNameAB); var bc = Deserialize<BC>(fileNameBC); // That is, so that A, B, C xml file // contents are shared across these two } } } Thus, the A, B, C files contain the following: A.xml: <?xml version="1.0" encoding="utf-8"?> <A xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <Value>42</Value> </A> B.xml: <?xml version="1.0" encoding="utf-8"?> <B xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <Value>3.1415926535897931</Value> </B> C.xml: <?xml version="1.0" encoding="utf-8"?> <C xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <Value>Something rotten</Value> </C> And then the "parent" XML files would contain a XML include file of some sort (I have not been able to find anything like this), such as: AB.xml: <?xml version="1.0" encoding="utf-8"?> <AB xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <A include="A.xml"/> <B include="B.xml"/> </AB> BC.xml: <?xml version="1.0" encoding="utf-8"?> <BC xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <B include="B.xml"/> <C include="C.xml"/> </BC> Of course, I guess this can be solved by implementing IXmlSerializer for AB and BC, but I was hoping there was an easier solution or a generic solution with which classes themselves only need the [Serializable] attribute and nothing else. That is, the split into multiple files is XML only and handled by XmlSerializer itself or a custom generic serializer on top of this. I know this should be somewhat possible with app.config (as in http://stackoverflow.com/questions/480538/use-xml-includes-or-config-references-in-app-config-to-include-other-config-files), but I would prefer a solution based on XmlSerializer. Thanks.

    Read the article

  • Convert PDF to Image Batch

    - by tro
    I am working on a solution where I can convert pdf files to images. I am using the following example from codeproject: http://www.codeproject.com/Articles/317700/Convert-a-PDF-into-a-series-of-images-using-Csharp?msg=4134859#xx4134859xx now I tried with the following code to generate from more then 1000 pdf files new images: using Cyotek.GhostScript; using Cyotek.GhostScript.PdfConversion; using System; using System.Collections.Generic; using System.Drawing; using System.IO; using System.Linq; using System.Text; using System.Threading.Tasks; namespace RefClass_PDF2Image { class Program { static void Main(string[] args) { string outputPath = Properties.Settings.Default.outputPath; string pdfPath = Properties.Settings.Default.pdfPath; if (!Directory.Exists(outputPath)) { Console.WriteLine("Der angegebene Pfad " + outputPath + " für den Export wurde nicht gefunden. Bitte ändern Sie den Pfad (outputPath) in der App.Config Datei."); return; } else { Console.WriteLine("Output Pfad: " + outputPath + " gefunden."); } if (!Directory.Exists(pdfPath)) { Console.WriteLine("Der angegebene Pfad " + pdfPath + " zu den PDF Zeichnungen wurde nicht gefunden. Bitte ändern Sie den Pfad (pdfPath) in der App.Config Datei."); return; } else { Console.WriteLine("PDF Pfad: " + pdfPath + " gefunden."); } Pdf2ImageSettings settings = GetPDFSettings(); DateTime start = DateTime.Now; TimeSpan span; Console.WriteLine(""); Console.WriteLine("Extraktion der PDF Zeichnungen wird gestartet: " + start.ToShortTimeString()); Console.WriteLine(""); DirectoryInfo diretoryInfo = new DirectoryInfo(pdfPath); DirectoryInfo[] directories = diretoryInfo.GetDirectories(); Console.WriteLine(""); Console.WriteLine("Es wurden " + directories.Length + " verschiedende Verzeichnisse gefunden."); Console.WriteLine(""); List<string> filenamesPDF = Directory.GetFiles(pdfPath, "*.pdf*", SearchOption.AllDirectories).Select(x => Path.GetFullPath(x)).ToList(); List<string> filenamesOutput = Directory.GetFiles(outputPath, "*.*", SearchOption.AllDirectories).Select(x => Path.GetFullPath(x)).ToList(); Console.WriteLine(""); Console.WriteLine("Es wurden " + filenamesPDF.Count + " verschiedende PDF Zeichnungen gefunden."); Console.WriteLine(""); List<string> newFileNames = new List<string>(); int cutLength = pdfPath.Length; for (int i = 0; i < filenamesPDF.Count; i++) { string temp = filenamesPDF[i].Remove(0, cutLength); temp = outputPath + temp; temp = temp.Replace("pdf", "jpg"); newFileNames.Add(temp); } for (int i = 0; i < filenamesPDF.Count; i++) { FileInfo fi = new FileInfo(newFileNames[i]); if (!fi.Exists) { if (!Directory.Exists(fi.DirectoryName)) { Directory.CreateDirectory(fi.DirectoryName); } Bitmap firstPage = new Pdf2Image(filenamesPDF[i], settings).GetImage(); firstPage.Save(newFileNames[i], System.Drawing.Imaging.ImageFormat.Jpeg); firstPage.Dispose(); } //if (i % 20 == 0) //{ // GC.Collect(); // GC.WaitForPendingFinalizers(); //} } Console.ReadLine(); } private static Pdf2ImageSettings GetPDFSettings() { Pdf2ImageSettings settings; settings = new Pdf2ImageSettings(); settings.AntiAliasMode = AntiAliasMode.Medium; settings.Dpi = 150; settings.GridFitMode = GridFitMode.Topological; settings.ImageFormat = ImageFormat.Png24; settings.TrimMode = PdfTrimMode.CropBox; return settings; } } } unfortunately, I always get in the Pdf2Image.cs an out of memory exception. here the code: public Bitmap GetImage(int pageNumber) { Bitmap result; string workFile; //if (pageNumber < 1 || pageNumber > this.PageCount) // throw new ArgumentException("Page number is out of bounds", "pageNumber"); if (pageNumber < 1) throw new ArgumentException("Page number is out of bounds", "pageNumber"); workFile = Path.GetTempFileName(); try { this.ConvertPdfPageToImage(workFile, pageNumber); using (FileStream stream = new FileStream(workFile, FileMode.Open, FileAccess.Read)) { result = new Bitmap(stream); // --->>> here is the out of memory exception stream.Close(); stream.Dispose(); } } finally { File.Delete(workFile); } return result; } how can I fix that to avoid this exception? thanks for any help, tro

    Read the article

  • How to add Category in DotClear blog with HttpWebRequest or MetaWeblog API

    - by Pitming
    I'm trying to create/modify dotclear blogs. For most of the options, i use XmlRpc API (DotClear.MetaWeblog). But didn't find any way to handle categories. So I start to look at the Http packet and try to do "the same as the browser". Here si the method I use to "Http POST" protected HttpStatusCode HttpPost(Uri url_, string data_, bool allowAutoRedirect_) { HttpWebRequest Request; HttpWebResponse Response = null; Stream ResponseStream = null; Request = (System.Net.HttpWebRequest)HttpWebRequest.Create(url_); Request.UserAgent = "Mozilla/5.0 (Windows; U; Windows NT 5.1; fr; rv:1.9.1.5) Gecko/20091102 Firefox/3.5.5 (.NET CLR 3.5.30729)"; Request.Accept = "text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8"; Request.AllowAutoRedirect = allowAutoRedirect_; // Add the network credentials to the request. Request.Credentials = new NetworkCredential(Username, Password); string authInfo = Username + ":" + Password; authInfo = Convert.ToBase64String(Encoding.Default.GetBytes(authInfo)); Request.Headers["Authorization"] = "Basic " + authInfo; Request.Method = "POST"; Request.CookieContainer = Cookies; if(ConnectionCookie!=null) Request.CookieContainer.Add(url_, ConnectionCookie); if (dcAdminCookie != null) Request.CookieContainer.Add(url_, dcAdminCookie); Request.PreAuthenticate = true; ASCIIEncoding encoding = new ASCIIEncoding(); string postData = data_; byte[] data = encoding.GetBytes(postData); //Encoding.UTF8.GetBytes(data_); //encoding.GetBytes(postData); Request.ContentLength = data.Length; Request.ContentType = "application/x-www-form-urlencoded"; Stream newStream = Request.GetRequestStream(); // Send the data. newStream.Write(data, 0, data.Length); newStream.Close(); try { // get the response from the server. Response = (HttpWebResponse)Request.GetResponse(); if (!allowAutoRedirect_) { foreach (Cookie c in Response.Cookies) { if (c.Name == "dcxd") ConnectionCookie = c; if (c.Name == "dc_admin") dcAdminCookie = c; } Cookies.Add(Response.Cookies); } // Get the response stream. ResponseStream = Response.GetResponseStream(); // Pipes the stream to a higher level stream reader with the required encoding format. StreamReader readStream = new StreamReader(ResponseStream, Encoding.UTF8); string result = readStream.ReadToEnd(); if (Request.RequestUri == Response.ResponseUri) { _log.InfoFormat("{0} ==&gt; {1}({2})", Request.RequestUri, Response.StatusCode, Response.StatusDescription); } else { _log.WarnFormat("RequestUri:{0}\r\nResponseUri:{1}\r\nstatus code:{2} Status descr:{3}", Request.RequestUri, Response.ResponseUri, Response.StatusCode, Response.StatusDescription); } } catch (WebException wex) { Response = wex.Response as HttpWebResponse; if (Response != null) { _log.ErrorFormat("{0} ==&gt; {1}({2})", Request.RequestUri, Response.StatusCode, Response.StatusDescription); } Request.Abort(); } finally { if (Response != null) { // Releases the resources of the response. Response.Close(); } } if(Response !=null) return Response.StatusCode; return HttpStatusCode.Ambiguous; } So the first thing to do is to Authenticate as admin. Here is the code: protected bool HttpAuthenticate() { Uri u = new Uri(this.Url); Uri url = new Uri(string.Format("{0}/admin/auth.php", u.GetLeftPart(UriPartial.Authority))); string data = string.Format("user_id={0}&user_pwd={1}&user_remember=1", Username, Password); var ret = HttpPost(url,data,false); return (ret == HttpStatusCode.OK || ret==HttpStatusCode.Found); } 3.Now that I'm authenticate, i need to get a xd_chek info (that i can find on the page so basically it's a GET on /admin/category.php + Regex("dotclear[.]nonce = '(.*)'")) 4.so I'm authenticate and have the xd_check info. The last thing to do seems to post the next category. But of course it does not work at all... here is the code: string postData = string.Format("cat_title={0}&new_cat_parent={1}&xd_check={2}", category_, 0, xdCheck); HttpPost(url, postData, true); If anyone can help me and explain were is it wrong ? thanks in advance.

    Read the article

  • MVC 3 Remote Validation jQuery error on submit

    - by Richard Reddy
    I seem to have a weird issue with remote validation on my project. I am doing a simple validation check on an email field to ensure that it is unique. I've noticed that unless I put the cursor into the textbox and then remove it to trigger the validation at least once before submitting my form I will get a javascript error. e[h] is not a function jquery.min.js line 3 If I try to resubmit the form after the above error is returned everything works as expected. It's almost like the form tried to submit before waiting for the validation to return or something. Am I required to silently fire off a remote validation request on submit before submitting my form? Below is a snapshot of the code I'm using: (I've also tried GET instead of POST but I get the same result). As mentioned above, the code works fine but the form returns a jquery error unless the validation is triggered at least once. Model: public class RegisterModel { [Required] [Remote("DoesUserNameExist", "Account", HttpMethod = "POST", ErrorMessage = "User name taken.")] [Display(Name = "User name")] public string UserName { get; set; } [Required] [Display(Name = "Firstname")] public string Firstname { get; set; } [Display(Name = "Surname")] public string Surname { get; set; } [Required] [Remote("DoesEmailExist", "Account", HttpMethod = "POST", ErrorMessage = "Email taken.", AdditionalFields = "UserName")] [Display(Name = "Email address")] public string Email { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Password")] public string Password { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Confirm password")] public string ConfirmPassword { get; set; } [Display(Name = "Approved?")] public bool IsApproved { get; set; } } public class UserRoleModel { [Display(Name = "Assign Roles")] public IEnumerable<RoleViewModel> AllRoles { get; set; } public RegisterModel RegisterUser { get; set; } } Controller: // POST: /Account/DoesEmailExist // passing in username so that I can ignore the same email address for the same user on edit page [HttpPost] public JsonResult DoesEmailExist([Bind(Prefix = "RegisterUser.Email")]string Email, [Bind(Prefix = "RegisterUser.UserName")]string UserName) { var user = Membership.GetUserNameByEmail(Email); if (!String.IsNullOrEmpty(UserName)) { if (user == UserName) return Json(true); } return Json(user == null); } View: <script src="//ajax.googleapis.com/ajax/libs/jquery/1.7.1/jquery.min.js" type="text/javascript"></script> <script src="//ajax.googleapis.com/ajax/libs/jqueryui/1.8.17/jquery-ui.min.js" type="text/javascript"></script> <script type="text/javascript" src="/Content/web/js/jquery.unobtrusive-ajax.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.unobtrusive.min.js"></script> ...... @using (Html.BeginForm()) { @Html.AntiForgeryToken() <div class="titleh"> <h3>Edit a user account</h3> </div> <div class="body"> @Html.HiddenFor(model => model.RegisterUser.UserName) @Html.Partial("_CreateOrEdit", Model) <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(model => model.RegisterUser.IsApproved)</span> @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, true, new { @class = "uniform" }) Active @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, false, new { @class = "uniform" }) Disabled <div class="clear"></div> </div> <div class="button-box"> <input type="submit" name="submit" value="Save" class="st-button"/> @Html.ActionLink("Back to List", "Index", null, new { @class = "st-clear" }) </div> </div> } CreateEdit Partial View @model Project.Domain.Entities.UserRoleModel <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Firstname)</span> @Html.TextBoxFor(m => m.RegisterUser.Firstname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Firstname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Surname)</span> @Html.TextBoxFor(m => m.RegisterUser.Surname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Surname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Email)</span> @Html.TextBoxFor(m => m.RegisterUser.Email, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Email) <div class="clear"></div> </div> Thanks, Rich

    Read the article

  • creating a Menu from SQLite values in Java

    - by shanahobo86
    I am trying to create a ListMenu using data from an SQLite database to define the name of each MenuItem. So in a class called menu.java I have defined the array String classes [] = {}; which should hold each menu item name. In a DBAdapter class I created a function so the user can insert info to a table (This all works fine btw). public long insertContact(String name, String code, String location, String comments, int days, int start, int end, String type) { ContentValues initialValues = new ContentValues(); initialValues.put(KEY_NAME, name); initialValues.put(KEY_CODE, code); initialValues.put(KEY_LOCATION, location); initialValues.put(KEY_COMMENTS, comments); initialValues.put(KEY_DAYS, days); initialValues.put(KEY_START, start); initialValues.put(KEY_END, end); initialValues.put(KEY_TYPE, type); return db.insert(DATABASE_TABLE, null, initialValues); } It would be the Strings inserted into KEY_NAME that I need to populate that String array with. Does anyone know if this is possible? Thanks so much for the help guys. If I implement that function by Sam/Mango the program crashes, am I using it incorrectly or is the error due to the unknown size of the array? DBAdapter db = new DBAdapter(this); String classes [] = db.getClasses(); edit: I should mention that if I manually define the array: String classes [] = {"test1", "test2", "test3", etc}; It works fine. The error is a NullPointerException Here's the logcat (sorry about the formatting). I hadn't initialized with db = helper.getReadableDatabase(); in the getClasses() function but unfortunately it didn't fix the problem. 11-11 22:53:39.117: D/dalvikvm(17856): Late-enabling CheckJNI 11-11 22:53:39.297: D/TextLayoutCache(17856): Using debug level: 0 - Debug Enabled: 0 11-11 22:53:39.337: D/libEGL(17856): loaded /system/lib/egl/libGLES_android.so 11-11 22:53:39.337: D/libEGL(17856): loaded /system/lib/egl/libEGL_adreno200.so 11-11 22:53:39.357: D/libEGL(17856): loaded /system/lib/egl/libGLESv1_CM_adreno200.so 11-11 22:53:39.357: D/libEGL(17856): loaded /system/lib/egl/libGLESv2_adreno200.so 11-11 22:53:39.387: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:39.407: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5c66d000 size:36593664 offset:32825344 fd:65 11-11 22:53:39.417: E/(17856): Can't open file for reading 11-11 22:53:39.417: E/(17856): Can't open file for reading 11-11 22:53:39.417: D/OpenGLRenderer(17856): Enabling debug mode 0 11-11 22:53:39.477: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5ecd3000 size:40361984 offset:36593664 fd:68 11-11 22:53:40.507: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61451000 size:7254016 offset:3485696 fd:71 11-11 22:53:41.077: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:41.077: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61c4c000 size:7725056 offset:7254016 fd:74 11-11 22:53:41.097: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x623aa000 size:8196096 offset:7725056 fd:80 11-11 22:53:41.937: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x62b7b000 size:8667136 offset:8196096 fd:83 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x61c4c000 size:7725056 offset:7254016 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x623aa000 size:8196096 offset:7725056 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x62b7b000 size:8667136 offset:8196096 11-11 22:53:42.167: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:42.177: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61c5d000 size:17084416 offset:13316096 fd:74 11-11 22:53:42.317: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x63853000 size:20852736 offset:17084416 fd:80 11-11 22:53:42.357: D/OpenGLRenderer(17856): Flushing caches (mode 0) 11-11 22:53:42.357: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x5c66d000 size:36593664 offset:32825344 11-11 22:53:42.357: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x5ecd3000 size:40361984 offset:36593664 11-11 22:53:42.367: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x61451000 size:7254016 offset:3485696 11-11 22:53:42.757: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5c56d000 size:24621056 offset:20852736 fd:65 11-11 22:53:44.247: D/AndroidRuntime(17856): Shutting down VM 11-11 22:53:44.247: W/dalvikvm(17856): threadid=1: thread exiting with uncaught exception (group=0x40ac3210) 11-11 22:53:44.257: E/AndroidRuntime(17856): FATAL EXCEPTION: main 11-11 22:53:44.257: E/AndroidRuntime(17856): java.lang.RuntimeException: Unable to instantiate activity ComponentInfo{niall.shannon.timetable/niall.shannon.timetable.menu}: java.lang.NullPointerException 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1891) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:1992) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.access$600(ActivityThread.java:127) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:1158) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.os.Handler.dispatchMessage(Handler.java:99) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.os.Looper.loop(Looper.java:137) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.main(ActivityThread.java:4441) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.reflect.Method.invokeNative(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.reflect.Method.invoke(Method.java:511) 11-11 22:53:44.257: E/AndroidRuntime(17856): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:823) 11-11 22:53:44.257: E/AndroidRuntime(17856): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:590) 11-11 22:53:44.257: E/AndroidRuntime(17856): at dalvik.system.NativeStart.main(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): Caused by: java.lang.NullPointerException 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.content.ContextWrapper.openOrCreateDatabase(ContextWrapper.java:221) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.database.sqlite.SQLiteOpenHelper.getWritableDatabase(SQLiteOpenHelper.java:157) 11-11 22:53:44.257: E/AndroidRuntime(17856): at niall.shannon.timetable.DBAdapter.getClasses(DBAdapter.java:151) 11-11 22:53:44.257: E/AndroidRuntime(17856): at niall.shannon.timetable.menu.<init>(menu.java:15) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.Class.newInstanceImpl(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.Class.newInstance(Class.java:1319) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.Instrumentation.newActivity(Instrumentation.java:1023) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1882) 11-11 22:53:44.257: E/AndroidRuntime(17856): ... 11 more 11-11 22:53:46.527: I/Process(17856): Sending signal. PID: 17856 SIG: 9

    Read the article

  • Android ksoap nested soap objects in request gives error in response

    - by Smalesy
    I'm trying to do the following soap request on Android using KSOAP. It contains a list of nested soap objects. However, I must be doing something wrong as I get an error back. The request I am trying to generate is as follows: <?xml version="1.0" encoding="utf-8"?> <soap12:Envelope xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:soap12="http://www.w3.org/2003/05/soap-envelope"> <soap12:Body> <SetAttendanceMarks xmlns="http://hostname.net/"> <strSessionToken>string</strSessionToken> <LessonMarks> <Count>int</Count> <LessonMarks> <LessonMark> <StudentId>int</StudentId> <EventInstanceId>int</EventInstanceId> <Mark>string</Mark> </LessonMark> <LessonMark> <StudentId>int</StudentId> <EventInstanceId>int</EventInstanceId> <Mark>string</Mark> </LessonMark> </LessonMarks> </LessonMarks> </SetAttendanceMarks> </soap12:Body> </soap12:Envelope> My code is as follows: public boolean setAttendanceMarks(List<Mark> list) throws Exception { boolean result = false; String methodName = "SetAttendanceMarks"; String soapAction = getHost() + "SetAttendanceMarks"; SoapObject lessMarksN = new SoapObject(getHost(), "LessonMarks"); for (Mark m : list) { PropertyInfo smProp =new PropertyInfo(); smProp.setName("LessonMark"); smProp.setValue(m); smProp.setType(Mark.class); lessMarksN.addProperty(smProp); } PropertyInfo cProp =new PropertyInfo(); cProp.setName("Count"); cProp.setValue(list.size()); cProp.setType(Integer.class); SoapObject lessMarks = new SoapObject(getHost(), "LessonMarks"); lessMarks.addProperty(cProp); lessMarks.addSoapObject(lessMarksN); PropertyInfo sProp =new PropertyInfo(); sProp.setName("strSessionToken"); sProp.setValue(mSession); sProp.setType(String.class); SoapObject request = new SoapObject(getHost(), methodName); request.addProperty(sProp); request.addSoapObject(lessMarks); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope(SoapEnvelope.VER12); envelope.dotNet = true; envelope.setOutputSoapObject(request); HttpTransportSE androidHttpTransport = new HttpTransportSE(getURL()); androidHttpTransport.debug = true; androidHttpTransport.call(soapAction, envelope); String a = androidHttpTransport.requestDump; String b = androidHttpTransport.responseDump; SoapObject resultsRequestSOAP = (SoapObject) envelope.bodyIn; SoapObject res = (SoapObject) resultsRequestSOAP.getProperty(0); String resultStr = res.getPropertyAsString("Result"); if (resultStr.contentEquals("OK")) { result = true; } return result; } The error I get is as follows: <?xml version="1.0" encoding="utf-8"?><soap:Envelope xmlns:soap="http://www.w3.org/2003/05/soap-envelope" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <soap:Body> <soap:Fault> <soap:Code> <soap:Value>soap:Sender</soap:Value> </soap:Code> <soap:Reason> <soap:Text xml:lang="en">Server was unable to read request. ---&gt; There is an error in XML document (1, 383). ---&gt; The specified type was not recognized: name='LessonMarks', namespace='http://gsdregapp.net/', at &lt;LessonMarks xmlns='http://gsdregapp.net/'&gt;.</soap:Text> </soap:Reason> <soap:Detail /> </soap:Fault> </soap:Body> </soap:Envelope> Can anybody tell me what I am doing wrong? I will be most grateful for any assistance!

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • pass an ID with hyperlik but cant get this ID value from a fk in one table when i click in insert

    - by susan
    Something strange happened in my codes, actually I have a hyperlink that pass ID value in a query string to second page.in second page i have 2 sql datasource that both these sql datasources should get this id value and pass it to a filter parameter to show sth in datalist. so in another word I have a first page that has an hyperlink read ID value from a datasource and pass it to second page.its like below: <asp:HyperLink ID="HyperLink1" runat="server" NavigateUrl='<%# "~/forumpage.aspx?ID="+Eval("ID")%>'><%#Eval("title")%> </asp:HyperLink> then in second page i have one sql datasource with a query like this ...where ID=@id and get this id in query string from db.it work great . but i have problem with second sql datasource in second page it has a query sth like below:...forms.question_id=@id then in sql reference both to query string as ID that get by first page in hyperlink. but when i click in insert button show me error with fk. error:Error:The INSERT statement conflicted with the FOREIGN KEY constraint "FK_forumreply_forumquestions". The conflict occurred in database "forum", table "dbo.forumquestions", column 'ID'. The statement has been terminated. my tables (question(ID,user_id(fk),Cat_id(fk),title,bodytext) (reply(ID,userr_id(fk),questionn_id(fk),titlereply,bodytestreply); When by hand in cb i gave a number in questionn_id like 1 it show me successful but when it want read from a filter by datasource this field face with problem. plzzzz help i really need skip from this part.and cause i am new i guess I cant understand the logic way clearly. <asp:SqlDataSource ID="sdsreply" runat="server" ConnectionString="<%$ ConnectionStrings:forumConnectionString %>" SelectCommand="SELECT forumreply.ID, forumreply.userr_id, forumreply.questionn_id, forumreply.bodytextreply, forumreply.datetimereply, forumquestions.ID AS Expr1, forumusers.ID AS Expr2, forumusers.username FROM forumquestions INNER JOIN forumreply ON forumquestions.ID = forumreply.questionn_id INNER JOIN forumusers ON forumquestions.user_id = forumusers.ID AND forumreply.userr_id = forumusers.ID where forumreply.questionn_id=@questionn_id"> <SelectParameters> <asp:QueryStringParameter Name="questionn_id" QueryStringField="ID" /> </SelectParameters> </asp:SqlDataSource> it is cb for second page in insert button: { if (Session["userid"] != null) { lblreply.Text = Session["userid"].ToString(); } else { Session["userid"]=null; } if (HttpContext.Current.User.Identity.IsAuthenticated) { lblshow.Text = string.Empty; string d = HttpContext.Current.User.Identity.Name; lblshow.Text =d + "???? ??? ?????." ; foreach (DataListItem item in DataList2.Items) { Label questionn_idLabel = (Label)item.FindControl("questionn_idLabel"); Label userr_idLabel = (Label)item.FindControl("userr_idLabel"); lbltest.Text = string.Empty; lbltest.Text = questionn_idLabel.Text; lblreply.Text = string.Empty; lblreply.Text = userr_idLabel.Text; } } else { lblshow.Text = "??? ??? ??? ??? ?? ?? ?????? ???? ???? ???? ????? ??? ??? ? ??? ????? ???????."; } } { if(HttpContext.Current.User.Identity.IsAuthenticated) { if (Page.IsValid) { SqlConnection con = new SqlConnection(ConfigurationManager.ConnectionStrings["forumConnectionString"].ConnectionString); try { con.Open(); SqlCommand cmd = new SqlCommand("insert into forumreply (userr_id,questionn_id,bodytextreply,datetimereply)values(@userr_id,@questionn_id,@bodytextreply,@datetimereply)", con); cmd.Parameters.AddWithValue("userr_id",lblreply.Text); cmd.Parameters.AddWithValue("questionn_id",lbltest.Text); cmd.Parameters.AddWithValue("bodytextreply",txtbody.Text); cmd.Parameters.AddWithValue("datetimereply",DateTime.Now ); cmd.ExecuteNonQuery(); } catch (Exception exp) { Response.Write("<b>Error:</b>"); Response.Write(exp.Message); } finally { con.Close(); } lblmsg.Text = "???? ??? ?? ?????? ??? ?????.thx"; lblshow.Visible = false; //lbltxt.Text = txtbody.Text; txtbody.Text = string.Empty; } } else { lblmsg.Text = string.Empty; Session["rem"] = Request.UrlReferrer.AbsoluteUri; Response.Redirect("~/login.aspx"); } }

    Read the article

< Previous Page | 371 372 373 374 375 376 377 378 379 380 381 382  | Next Page >