Search Results

Search found 9963 results on 399 pages for 'special commands'.

Page 393/399 | < Previous Page | 389 390 391 392 393 394 395 396 397 398 399  | Next Page >

  • Using AES encryption in .NET - CryptographicException saying the padding is invalid and cannot be removed

    - by Jake Petroules
    I wrote some AES encryption code in C# and I am having trouble getting it to encrypt and decrypt properly. If I enter "test" as the passphrase and "This data must be kept secret from everyone!" I receive the following exception: System.Security.Cryptography.CryptographicException: Padding is invalid and cannot be removed. at System.Security.Cryptography.RijndaelManagedTransform.DecryptData(Byte[] inputBuffer, Int32 inputOffset, Int32 inputCount, Byte[]& outputBuffer, Int32 outputOffset, PaddingMode paddingMode, Boolean fLast) at System.Security.Cryptography.RijndaelManagedTransform.TransformFinalBlock(Byte[] inputBuffer, Int32 inputOffset, Int32 inputCount) at System.Security.Cryptography.CryptoStream.FlushFinalBlock() at System.Security.Cryptography.CryptoStream.Dispose(Boolean disposing) at System.IO.Stream.Close() at System.IO.Stream.Dispose() ... And if I enter something less than 16 characters I get no output. I believe I need some special handling in the encryption since AES is a block cipher, but I'm not sure exactly what that is, and I wasn't able to find any examples on the web showing how. Here is my code: using System; using System.IO; using System.Security.Cryptography; using System.Text; public static class DatabaseCrypto { public static EncryptedData Encrypt(string password, string data) { return DatabaseCrypto.Transform(true, password, data, null, null) as EncryptedData; } public static string Decrypt(string password, EncryptedData data) { return DatabaseCrypto.Transform(false, password, data.DataString, data.SaltString, data.MACString) as string; } private static object Transform(bool encrypt, string password, string data, string saltString, string macString) { using (AesManaged aes = new AesManaged()) { aes.Mode = CipherMode.CBC; aes.Padding = PaddingMode.PKCS7; int key_len = aes.KeySize / 8; int iv_len = aes.BlockSize / 8; const int salt_size = 8; const int iterations = 8192; byte[] salt = encrypt ? new Rfc2898DeriveBytes(string.Empty, salt_size).Salt : Convert.FromBase64String(saltString); byte[] bc_key = new Rfc2898DeriveBytes("BLK" + password, salt, iterations).GetBytes(key_len); byte[] iv = new Rfc2898DeriveBytes("IV" + password, salt, iterations).GetBytes(iv_len); byte[] mac_key = new Rfc2898DeriveBytes("MAC" + password, salt, iterations).GetBytes(16); aes.Key = bc_key; aes.IV = iv; byte[] rawData = encrypt ? Encoding.UTF8.GetBytes(data) : Convert.FromBase64String(data); using (ICryptoTransform transform = encrypt ? aes.CreateEncryptor() : aes.CreateDecryptor()) using (MemoryStream memoryStream = encrypt ? new MemoryStream() : new MemoryStream(rawData)) using (CryptoStream cryptoStream = new CryptoStream(memoryStream, transform, encrypt ? CryptoStreamMode.Write : CryptoStreamMode.Read)) { if (encrypt) { cryptoStream.Write(rawData, 0, rawData.Length); return new EncryptedData(salt, mac_key, memoryStream.ToArray()); } else { byte[] originalData = new byte[rawData.Length]; int count = cryptoStream.Read(originalData, 0, originalData.Length); return Encoding.UTF8.GetString(originalData, 0, count); } } } } } public class EncryptedData { public EncryptedData() { } public EncryptedData(byte[] salt, byte[] mac, byte[] data) { this.Salt = salt; this.MAC = mac; this.Data = data; } public EncryptedData(string salt, string mac, string data) { this.SaltString = salt; this.MACString = mac; this.DataString = data; } public byte[] Salt { get; set; } public string SaltString { get { return Convert.ToBase64String(this.Salt); } set { this.Salt = Convert.FromBase64String(value); } } public byte[] MAC { get; set; } public string MACString { get { return Convert.ToBase64String(this.MAC); } set { this.MAC = Convert.FromBase64String(value); } } public byte[] Data { get; set; } public string DataString { get { return Convert.ToBase64String(this.Data); } set { this.Data = Convert.FromBase64String(value); } } } static void ReadTest() { Console.WriteLine("Enter password: "); string password = Console.ReadLine(); using (StreamReader reader = new StreamReader("aes.cs.txt")) { EncryptedData enc = new EncryptedData(); enc.SaltString = reader.ReadLine(); enc.MACString = reader.ReadLine(); enc.DataString = reader.ReadLine(); Console.WriteLine("The decrypted data was: " + DatabaseCrypto.Decrypt(password, enc)); } } static void WriteTest() { Console.WriteLine("Enter data: "); string data = Console.ReadLine(); Console.WriteLine("Enter password: "); string password = Console.ReadLine(); EncryptedData enc = DatabaseCrypto.Encrypt(password, data); using (StreamWriter stream = new StreamWriter("aes.cs.txt")) { stream.WriteLine(enc.SaltString); stream.WriteLine(enc.MACString); stream.WriteLine(enc.DataString); Console.WriteLine("The encrypted data was: " + enc.DataString); } }

    Read the article

  • BizTalk server problem

    - by WtFudgE
    Hi, we have a biztalk server (a virtual one (1!)...) at our company, and an sql server where the data is being kept. Now we have a lot of data traffic. I'm talking about hundred of thousands. So I'm actually not even sure if one server is pretty safe, but our company is not that easy to convince. Now recently we have a lot of problems. Allow me to situate in detail, so I'm not missing anything: Our server has 5 applications: One with 3 orchestrations, 12 send ports, 16 receive locations. One with 4 orchestrations, 32 send ports, 20 receive locations. One with 4 orchestrations, 24 send ports, 20 receive locations. One with 47 (yes 47) orchestrations, 37 send ports, 6 receive locations. One with common application with a couple of resources. Our problems have occured since we deployed the applications with the 47 orchestrations. A lot of these orchestrations use assign shapes which use c# code to do the mapping. This is because we use HL7 extensions and this is kind of special, so by using c# code & xpath it was a lot easier to do the mapping because a lot of these schema's look alike. The c# reads in XmlNodes received through xpath, and returns XmlNode which are then assigned again to biztalk messages. I'm not sure if this could be the cause, but I thought I'd mention it. The send and receive ports have a lot of different types: File, MQSeries, SQL, MLLP, FTP. Each of these types have a different host instances, to balance out the load. Our orchestrations use the BiztalkApplication host. On this server also a couple of scripts are running, mostly ftp upload scripts & also a zipper script, which zips files every half an hour in a daily zip and deletes the zip files after a month. We use this zipscript on our backup files (we backup a lot, backups are also on our server), we did this because the server had problems with sending files to a location where there were a lot (A LOT) of files, so after the files were reduced to zips it went better. Now the problems we are having recently are mainly two major problems: Our most important problem is the following. We kept a receive location with a lot of messages on a queue for testing. After we start this receive location which uses the 47 orchestrations, the running service instances start to sky rock. Ok, this is pretty normal. Let's say about 10000, and then we stop the receive location to see how biztalk handles these 10000 instances. Normally they would go down pretty fast, and it does sometimes, but after a while it starts to "throttle", meaning they just stop being processed and the service instances stay at the same number, for example in 30 seconds it goes down from 10000 to 4000 and then it stays at 4000 and it lowers very very very slowly, like 30 in 5minutes or something. So this means, that all the other service instances of the other applications are also stuck in here, and they are also not processed. We noticed that after restarting our host instances the instance number went down fast again. So we tried to selectively restart different host instances to locate the problem. We noticed that eventually restarting the file send/receive host instance would do the trick. So we thought file sends would be the problem. Concidering that we make a lot of backups. So we replaced the file type backups with mqseries backups. The same problem occured, and funny thing, restarting the file send/receive host still fixes the problem. No errors can be found in the event viewer either. A second problem we're having is. That sometimes at arround 6 am, all or a part of the host instances are being stopped. In the event viewer we noticed the following errors (these are more than one): The receive location "MdnBericht SQL" with URL "SQL://ZNACDBPEG/mdnd0001/" is shutting down. Details:"The error threshold has been exceeded. The receive location is shutting down.". The Messaging Engine failed to add a receive location "M2m Othello Export Start Bestand" with URL "\m2mservices\Othello_import$\DataFilter Start*.xml" to the adapter "FILE". Reason: "The FILE adapter cannot access the folder \m2mservices\Othello_import$\DataFilter Start. Verify this folder exists. Error: Logon failure: unknown user name or bad password. ". The FILE adapter cannot access the folder \m2mservices\Othello_import$\DataFilter Start. Verify this folder exists. Error: Logon failure: unknown user name or bad password. An attempt to connect to "BizTalkMsgBoxDb" SQL Server database on server "ZNACDBBTS" failed. Error: "Login failed for user ''. The user is not associated with a trusted SQL Server connection." It woould seem that there's a login failure at this time and that because of it other services are also experiencing problems, and eventually they are shut down. The thing is, our user is admin, and it's impossible that it's password is wrong "sometimes". We have concidering that the problem could be due to an infrastructure problem, but that's not really are department. I know it's a long post, but we're not sure anymore what to do. Would adding another server and balancing the load solve our problems? Is there a way to meassure our balance and know where to start splitting? What are normal numbers of load etc? I appreciate any answers because these issues are getting worse and we're also on a deadline. Thanks a lot for replies!

    Read the article

  • Batch break up after call other batch file

    - by Sven Arno Jopen
    i have the problem, that my batch process breaking up each time after call a other batch file. The batch files are used to run a make process out from IBM Rhapsody. There convert the call from Rhapsody to the Visual Studio tools. So nmake will be called from the batch after make different settings. The scripts aren’t written completely from me, I only adapt theme to run under both windows architecture versions, x86 and x64. The first script (vs2005_make.bat) will be called from Rhapsody and run to the “call” statement. The second script (Vcvars_VisualStudio2005.bat) runs to the end. But the first script isn’t resume working, at this point the process break up without a error message. I'm not very familiar with batch files, this is the first time I make more than simple console commands in a batch file. So I hope I have given all information’s which needed, otherwise ask me. Here the start script (vs2005_make.bat): :: parameter 1 - Makefile which should be used :: parameter 2 - The make target mark @echo off IF "%2"=="" set target=all IF "%2"=="all" set target=all IF "%2"=="build" set target=all IF "%2"=="rebuild" set target=clean all IF "%2"=="clean" set target=clean set RegQry="HKLM\Hardware\Description\System\CentralProcessor\0" REG.exe Query %RegQry% > checkOS.txt Find /i "x86" < CheckOS.txt > StringCheck.txt IF %ERRORLEVEL%==0 ( set arch=x86 ) ELSE ( set arch=x64 ) call "%ProgramFiles%\IBM\Rhapsody752\Share\etc\Vcvars_VisualStudio2005.bat" %arch% IF %ERRORLEVEL%==0 ( set makeflags= nmake /nologo /S /F %1 %target% ) del checkOS.txt del StringCheck.txt exit and here the called script (Vcvars_VisualStudio2005.bat): :: param 1 - Processor architecture @echo off ECHO param 1 = %1 IF %1==x86 ( SET ProgrammPath=%ProgramFiles% ) ELSE IF %1==x64 ( SET ProgrammPath=%ProgramFiles(x86)% ) ELSE ( ECHO Unknowen architectur EXIT /B 1 ) SET VSINSTALLDIR="%ProgrammPath%\Microsoft Visual Studio 8\Common7\IDE" SET VCINSTALLDIR="%ProgrammPath%\Microsoft Visual Studio 8" SET FrameworkDir=C:\WINDOWS\Microsoft.NET\Framework SET FrameworkVersion=v2.0.50727 SET FrameworkSDKDir="%ProgrammPath%\Microsoft Visual Studio 8\SDK\v2.0" rem Root of Visual Studio common files. IF %VSINSTALLDIR%=="" GOTO Usage IF %VCINSTALLDIR%=="" SET VCINSTALLDIR=%VSINSTALLDIR% rem rem Root of Visual Studio ide installed files. rem SET DevEnvDir=%VSINSTALLDIR% rem rem Root of Visual C++ installed files. rem SET MSVCDir=%VCINSTALLDIR%\VC SET PATH=%DevEnvDir%;%MSVCDir%\BIN;%VCINSTALLDIR%\Common7\Tools;%VCINSTALLDIR%Common7 \Tools\bin\prerelease;%VCINSTALLDIR%\Common7\Tools\bin;%FrameworkSDKDir%\bin;%FrameworkDir%\%FrameworkVersion%;%PATH%; SET INCLUDE=%MSVCDir%\ATLMFC\INCLUDE;%MSVCDir%\INCLUDE;%MSVCDir%\PlatformSDK\include\gl;%MSVCDir%\PlatformSDK\include;%FrameworkSDKDir%\include;%INCLUDE% SET LIB=%MSVCDir%\ATLMFC\LIB;%MSVCDir%\LIB;%MSVCDir%\PlatformSDK\lib;%FrameworkSDKDir%\lib;%LIB% GOTO end :Usage ECHO. VSINSTALLDIR variable is not set. ECHO. ECHO SYNTAX: %0 GOTO end :end Here the console output, what I not understand here and find very suspicious is that after the “IF %ERRORLEVEL%” Statement in the first script all will be put out regardless the echo is set to off… Executing: "C:\Programme\IBM\Rhapsody752\Share\etc\vs2005_make.bat" Simulation.mak build IF %ERRORLEVEL%==0 ( Mehr? set arch=x86 Mehr? ) ELSE ( Mehr? set arch=x64 Mehr? ) call "%ProgramFiles%\IBM\Rhapsody752\Share\etc\Vcvars_VisualStudio2005.bat" %arch% :: param 1 - Processor architecture @echo off ECHO param 1 = %1 param 1 = x86 IF %1==x86 ( Mehr? SET ProgrammPath=%ProgramFiles% Mehr? ) ELSE IF %1==x64 ( Mehr? SET ProgrammPath=%ProgramFiles(x86)% Mehr? ) ELSE ( Mehr? ECHO Unknowen architectur Mehr? EXIT /B 1 Mehr? ) SET VSINSTALLDIR="%ProgrammPath%\Microsoft Visual Studio 8\Common7\IDE" SET VCINSTALLDIR="%ProgrammPath%\Microsoft Visual Studio 8" SET FrameworkDir=C:\WINDOWS\Microsoft.NET\Framework SET FrameworkVersion=v2.0.50727 SET FrameworkSDKDir="%ProgrammPath%\Microsoft Visual Studio 8\SDK\v2.0" rem Root of Visual Studio common files. IF %VSINSTALLDIR%=="" GOTO Usage IF %VCINSTALLDIR%=="" SET VCINSTALLDIR=%VSINSTALLDIR% rem rem Root of Visual Studio ide installed files. rem SET DevEnvDir=%VSINSTALLDIR% rem rem Root of Visual C++ installed files. rem SET MSVCDir=%VCINSTALLDIR%\VC SET PATH=%DevEnvDir%;%MSVCDir%\BIN;%VCINSTALLDIR%\Common7\Tools;%VCINSTALLDIR%\Common7\Tools\bin\prerelease;%VCINSTALLDIR%\Common7\Tools\bin;%FrameworkSDKDir%\bin;%FrameworkDir%\%FrameworkVersion%;%PATH%; SET INCLUDE=%MSVCDir%\ATLMFC\INCLUDE;%MSVCDir%\INCLUDE;%MSVCDir%\PlatformSDK\include\gl;%MSVCDir%\PlatformSDK\include;%FrameworkSDKDir%\include;%INCLUDE% SET LIB=%MSVCDir%\ATLMFC\LIB;%MSVCDir%\LIB;%MSVCDir%\PlatformSDK\lib;%FrameworkSDKDir%\lib;%LIB% GOTO end Build Done I hope someone have an idea, i work now since two days and don't find the error... thanking you in anticipation. Note: The word “Mehr?” in the text output is german and means “more”. I don't know were it comes from and it is possible that it is a bad translation from the English output to german.

    Read the article

  • LINQ 4 XML - What is the proper way to query deep in the tree structure?

    - by Keith Barrows
    I have an XML structure that is 4 deep: <?xml version="1.0" encoding="utf-8"?> <EmailRuleList xmlns:xsd="EmailRules.xsd"> <TargetPST name="Tech Communities"> <Parse emailAsList="true" useJustDomain="false" fromAddress="false" toAddress="true"> <EmailRule address="@aspadvice.com" folder="Lists, ASP" saveAttachments="false" /> <EmailRule address="@sqladvice.com" folder="Lists, SQL" saveAttachments="false" /> <EmailRule address="@xmladvice.com" folder="Lists, XML" saveAttachments="false" /> </Parse> <Parse emailAsList="false" useJustDomain="false" fromAddress="false" toAddress="true"> <EmailRule address="[email protected]" folder="Special Interest Groups|Northern Colorado Architects Group" saveAttachments="false" /> <EmailRule address="[email protected]" folder="Support|SpamBayes" saveAttachments="false" /> </Parse> <Parse emailAsList="false" useJustDomain="false" fromAddress="true" toAddress="false"> <EmailRule address="[email protected]" folder="Support|GoDaddy" saveAttachments="false" /> <EmailRule address="[email protected]" folder="Support|No-IP.com" saveAttachments="false" /> <EmailRule address="[email protected]" folder="Discussions|Orchard Project" saveAttachments="false" /> </Parse> <Parse emailAsList="false" useJustDomain="true" fromAddress="true" toAddress="false"> <EmailRule address="@agilejournal.com" folder="Newsletters|Agile Journal" saveAttachments="false"/> <EmailRule address="@axosoft.ccsend.com" folder="Newsletters|Axosoft Newsletter" saveAttachments="false"/> <EmailRule address="@axosoft.com" folder="Newsletters|Axosoft Newsletter" saveAttachments="false"/> <EmailRule address="@cmcrossroads.com" folder="Newsletters|CM Crossroads" saveAttachments="false" /> <EmailRule address="@urbancode.com" folder="Newsletters|Urbancode" saveAttachments="false" /> <EmailRule address="@urbancode.ccsend.com" folder="Newsletters|Urbancode" saveAttachments="false" /> <EmailRule address="@Infragistics.com" folder="Newsletters|Infragistics" saveAttachments="false" /> <EmailRule address="@zdnet.online.com" folder="Newsletters|ZDNet Tech Update Today" saveAttachments="false" /> <EmailRule address="@sqlservercentral.com" folder="Newsletters|SQLServerCentral.com" saveAttachments="false" /> <EmailRule address="@simple-talk.com" folder="Newsletters|Simple-Talk Newsletter" saveAttachments="false" /> </Parse> </TargetPST> <TargetPST name="[Sharpen the Saw]"> <Parse emailAsList="false" useJustDomain="false" fromAddress="false" toAddress="true"> <EmailRule address="[email protected]" folder="Head Geek|Job Alerts" saveAttachments="false" /> <EmailRule address="[email protected]" folder="Social|LinkedIn USMC" saveAttachments="false"/> </Parse> <Parse emailAsList="false" useJustDomain="false" fromAddress="true" toAddress="false"> <EmailRule address="[email protected]" folder="Head Geek|Job Alerts" saveAttachments="false" /> <EmailRule address="[email protected]" folder="Head Geek|Job Alerts" saveAttachments="false" /> <EmailRule address="[email protected]" folder="Social|Cruise Critic" saveAttachments="false"/> </Parse> <Parse emailAsList="false" useJustDomain="true" fromAddress="true" toAddress="false"> <EmailRule address="@moody.edu" folder="Social|5 Love Languages" saveAttachments="false" /> <EmailRule address="@postmaster.twitter.com" folder="Social|Twitter" saveAttachments="false"/> <EmailRule address="@diabetes.org" folder="Physical|American Diabetes Association" saveAttachments="false"/> <EmailRule address="@membership.webshots.com" folder="Social|Webshots" saveAttachments="false"/> </Parse> </TargetPST> </EmailRuleList> Now, I have both an FromAddress and a ToAddress that is parsed from an incoming email. I would like to do a LINQ query against a class set that was deserialized from this XML. For instance: ToAddress = [email protected] FromAddress = [email protected] Query: Get EmailRule.Include(Parse).Include(TargetPST) where address == ToAddress AND Parse.ToAddress==true AND Parse.useJustDomain==false Get EmailRule.Include(Parse).Include(TargetPST) where address == [ToAddress Domain Only] AND Parse.ToAddress==true AND Parse.useJustDomain==true Get EmailRule.Include(Parse).Include(TargetPST) where address == FromAddress AND Parse.FromAddress==true AND Parse.useJustDomain==false Get EmailRule.Include(Parse).Include(TargetPST) where address == [FromAddress Domain Only] AND Parse.FromAddress==true AND Parse.useJustDomain==true I am having a hard time figuring this LINQ query out. I can, of course, loop on all the bits in the XML like so (includes deserialization into objects): XmlSerializer s = new XmlSerializer(typeof(EmailRuleList)); TextReader r = new StreamReader(path); _emailRuleList = (EmailRuleList)s.Deserialize(r); TargetPST[] PSTList = _emailRuleList.Items; foreach (TargetPST targetPST in PSTList) { olRoot = GetRootFolder(targetPST.name); if (olRoot != null) { Parse[] ParseList = targetPST.Items; foreach (Parse parseRules in ParseList) { EmailRule[] EmailRuleList = parseRules.Items; foreach (EmailRule targetFolders in EmailRuleList) { } } } } However, this means going through all these loops for each and every address. It makes more sense to me to query against the Objects. Any tips appreciated!

    Read the article

  • Error loading Mongrel in Aptana Ruby Application on Vista

    - by floatingfrisbee
    I'm brand new at Ruby. Trying to set up the first application/project using Aptana Studio. Here are my ruby and gem versions c:\>ruby -v ruby 1.9.1p378 (2010-01-10 revision 26273) [i386-mingw32] c:\>gem -v 1.3.6 I am seeing this error below while starting my ruby application. I'm developing on Vista (sucks, I know but am working on changing that) C:/Ruby/lib/ruby/gems/1.9.1/gems/activesupport-2.3.4/lib/active_support/dependencies.rb:156:in `require': 126: The specified module could not be found. - C:/Ruby/lib/ruby/gems/1.9.1/gems/mongrel-1.1.5-x86-mingw32/lib/http11.so (LoadError) from C:/Ruby/lib/ruby/gems/1.9.1/gems/activesupport-2.3.4/lib/active_support/dependencies.rb:156:in `block in require' from C:/Ruby/lib/ruby/gems/1.9.1/gems/activesupport-2.3.4/lib/active_support/dependencies.rb:521:in `new_constants_in' from C:/Ruby/lib/ruby/gems/1.9.1/gems/activesupport-2.3.4/lib/active_support/dependencies.rb:156:in `require' from C:/Ruby/lib/ruby/gems/1.9.1/gems/mongrel-1.1.5-x86-mingw32/lib/mongrel.rb:12:in `<top (required)>' from C:/Ruby/lib/ruby/gems/1.9.1/gems/activesupport-2.3.4/lib/active_support/dependencies.rb:156:in `require' from C:/Ruby/lib/ruby/gems/1.9.1/gems/activesupport-2.3.4/lib/active_support/dependencies.rb:156:in `block in require' from C:/Ruby/lib/ruby/gems/1.9.1/gems/activesupport-2.3.4/lib/active_support/dependencies.rb:521:in `new_constants_in' from C:/Ruby/lib/ruby/gems/1.9.1/gems/activesupport-2.3.4/lib/active_support/dependencies.rb:156:in `require' from C:/Ruby/lib/ruby/gems/1.9.1/gems/rack-1.0.0/lib/rack/handler/mongrel.rb:1:in `<top (required)>' from C:/Ruby/lib/ruby/gems/1.9.1/gems/rack-1.0.0/lib/rack/handler.rb:17:in `const_get' from C:/Ruby/lib/ruby/gems/1.9.1/gems/rack-1.0.0/lib/rack/handler.rb:17:in `block in get' from C:/Ruby/lib/ruby/gems/1.9.1/gems/rack-1.0.0/lib/rack/handler.rb:17:in `each' from C:/Ruby/lib/ruby/gems/1.9.1/gems/rack-1.0.0/lib/rack/handler.rb:17:in `get' from C:/Ruby/lib/ruby/gems/1.9.1/gems/rails-2.3.4/lib/commands/server.rb:45:in `<top (required)>' from C:/Users/Me - Admin/My Documents/Aptana RadRails Workspace/EventBuzz/script/server:3:in `require' from C:/Users/Me - Admin/My Documents/Aptana RadRails Workspace/EventBuzz/script/server:3:in `<top (required)>' from -e:2:in `load' from -e:2:in `<main>' As a part of fixing this issue, I've installed the following gems and updates c:\>gem update --system Updating RubyGems Nothing to update c:\>gem install rails capistrano mongrel mongrel_cluster Successfully installed rails-2.3.5 Successfully installed net-ssh-2.0.21 Successfully installed net-sftp-2.0.4 Successfully installed net-scp-1.0.2 Successfully installed net-ssh-gateway-1.0.1 Successfully installed highline-1.5.2 Successfully installed capistrano-2.5.18 Successfully installed mongrel-1.1.5-x86-mingw32 Successfully installed mongrel_cluster-1.0.5 9 gems installed Installing ri documentation for rails-2.3.5... Installing ri documentation for net-ssh-2.0.21... Installing ri documentation for net-sftp-2.0.4... Installing ri documentation for net-scp-1.0.2... Installing ri documentation for net-ssh-gateway-1.0.1... Installing ri documentation for highline-1.5.2... Installing ri documentation for capistrano-2.5.18... Installing ri documentation for mongrel-1.1.5-x86-mingw32... Installing ri documentation for mongrel_cluster-1.0.5... Updating class cache with 1380 classes... Installing RDoc documentation for rails-2.3.5... Installing RDoc documentation for net-ssh-2.0.21... Installing RDoc documentation for net-sftp-2.0.4... Installing RDoc documentation for net-scp-1.0.2... Installing RDoc documentation for net-ssh-gateway-1.0.1... Installing RDoc documentation for highline-1.5.2... Installing RDoc documentation for capistrano-2.5.18... Installing RDoc documentation for mongrel-1.1.5-x86-mingw32... Installing RDoc documentation for mongrel_cluster-1.0.5... c:\>gem install mysql Successfully installed mysql-2.8.1-x86-mingw32 1 gem installed Installing ri documentation for mysql-2.8.1-x86-mingw32... Updating class cache with 1641 classes... Installing RDoc documentation for mysql-2.8.1-x86-mingw32... Ideas as to what is going on?

    Read the article

  • Unable to use factory girl with Cucumber and rails 3 (bundler problem)

    - by jbpros
    Hi there, I'm trying to run cucumber features with factory girl factories on a fresh Rails 3 application. Here is my Gemfile: source "http://gemcutter.org" gem "rails", "3.0.0.beta" gem "pg" gem "factory_girl", :git => "git://github.com/thoughtbot/factory_girl.git", :branch => "rails3" gem "rspec-rails", ">= 2.0.0.beta.4" gem "capybara" gem "database_cleaner" gem "cucumber-rails", :require => false Then the bundle install commande just runs smoothly: $ bundle install /usr/lib/ruby/gems/1.8/gems/bundler-0.9.3/lib/bundler/installer.rb:81:Warning: Gem::Dependency#version_requirements is deprecated and will be removed on or after August 2010. Use #requirement Updating git://github.com/thoughtbot/factory_girl.git Fetching source index from http://gemcutter.org Resolving dependencies Installing abstract (1.0.0) from system gems Installing actionmailer (3.0.0.beta) from system gems Installing actionpack (3.0.0.beta) from system gems Installing activemodel (3.0.0.beta) from system gems Installing activerecord (3.0.0.beta) from system gems Installing activeresource (3.0.0.beta) from system gems Installing activesupport (3.0.0.beta) from system gems Installing arel (0.2.1) from system gems Installing builder (2.1.2) from system gems Installing bundler (0.9.13) from system gems Installing capybara (0.3.6) from system gems Installing cucumber (0.6.3) from system gems Installing cucumber-rails (0.3.0) from system gems Installing culerity (0.2.9) from system gems Installing database_cleaner (0.5.0) from system gems Installing diff-lcs (1.1.2) from system gems Installing erubis (2.6.5) from system gems Installing factory_girl (1.2.3) from git://github.com/thoughtbot/factory_girl.git (at rails3) Installing ffi (0.6.3) from system gems Installing i18n (0.3.6) from system gems Installing json_pure (1.2.3) from system gems Installing mail (2.1.3) from system gems Installing memcache-client (1.7.8) from system gems Installing mime-types (1.16) from system gems Installing nokogiri (1.4.1) from system gems Installing pg (0.9.0) from system gems Installing polyglot (0.3.0) from system gems Installing rack (1.1.0) from system gems Installing rack-mount (0.4.7) from system gems Installing rack-test (0.5.3) from system gems Installing rails (3.0.0.beta) from system gems Installing railties (3.0.0.beta) from system gems Installing rake (0.8.7) from system gems Installing rspec (2.0.0.beta.4) from system gems Installing rspec-core (2.0.0.beta.4) from system gems Installing rspec-expectations (2.0.0.beta.4) from system gems Installing rspec-mocks (2.0.0.beta.4) from system gems Installing rspec-rails (2.0.0.beta.4) from system gems Installing selenium-webdriver (0.0.17) from system gems Installing term-ansicolor (1.0.5) from system gems Installing text-format (1.0.0) from system gems Installing text-hyphen (1.0.0) from system gems Installing thor (0.13.4) from system gems Installing treetop (1.4.4) from system gems Installing tzinfo (0.3.17) from system gems Installing webrat (0.7.0) from system gems Your bundle is complete! When I run cucumber, here is the error I get: $ rake cucumber (in /home/jbpros/projects/deorbitburn) /usr/lib/ruby/gems/1.8/gems/bundler-0.9.3/lib/bundler/resolver.rb:97:Warning: Gem::Dependency#version_requirements is deprecated and will be removed on or after August 2010. Use #requirement NOTICE: CREATE TABLE will create implicit sequence "posts_id_seq" for serial column "posts.id" NOTICE: CREATE TABLE / PRIMARY KEY will create implicit index "posts_pkey" for table "posts" /usr/bin/ruby1.8 -I "/usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/lib:lib" "/usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/cucumber" --profile default Using the default profile... git://github.com/thoughtbot/factory_girl.git (at rails3) is not checked out. Please run `bundle install` (Bundler::PathError) /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/source.rb:282:in `load_spec_files' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/source.rb:190:in `local_specs' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:36:in `runtime_gems' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:35:in `each' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:35:in `runtime_gems' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/index.rb:5:in `build' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:34:in `runtime_gems' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:14:in `index' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/index.rb:5:in `build' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:13:in `index' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:55:in `resolve_locally' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:28:in `specs' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:65:in `specs_for' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:23:in `requested_specs' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/runtime.rb:18:in `setup' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler.rb:68:in `setup' /home/jbpros/projects/deorbitburn/config/boot.rb:7 /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `gem_original_require' /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `polyglot_original_require' /usr/lib/ruby/gems/1.8/gems/polyglot-0.3.0/lib/polyglot.rb:65:in `require' /home/jbpros/projects/deorbitburn/config/application.rb:1 /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `gem_original_require' /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `polyglot_original_require' /usr/lib/ruby/gems/1.8/gems/polyglot-0.3.0/lib/polyglot.rb:65:in `require' /home/jbpros/projects/deorbitburn/config/environment.rb:2 /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `gem_original_require' /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `polyglot_original_require' /usr/lib/ruby/gems/1.8/gems/polyglot-0.3.0/lib/polyglot.rb:65:in `require' /home/jbpros/projects/deorbitburn/features/support/env.rb:8 /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `gem_original_require' /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `polyglot_original_require' /usr/lib/ruby/gems/1.8/gems/polyglot-0.3.0/lib/polyglot.rb:65:in `require' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/../lib/cucumber/rb_support/rb_language.rb:124:in `load_code_file' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/../lib/cucumber/step_mother.rb:85:in `load_code_file' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/../lib/cucumber/step_mother.rb:77:in `load_code_files' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/../lib/cucumber/step_mother.rb:76:in `each' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/../lib/cucumber/step_mother.rb:76:in `load_code_files' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/../lib/cucumber/cli/main.rb:48:in `execute!' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/../lib/cucumber/cli/main.rb:20:in `execute' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/cucumber:8 rake aborted! Command failed with status (1): [/usr/bin/ruby1.8 -I "/usr/lib/ruby/gems/1....] (See full trace by running task with --trace) Do I have to do something special for bundler to check out factory girl's repository on github?

    Read the article

  • w3schools xsd example won't work with dom4j. How do I use dom4j to validate xml using xsds?

    - by HappyEngineer
    I am trying to use dom4j to validate the xml at http://www.w3schools.com/Schema/schema_example.asp using the xsd from that same page. It fails with the following error: org.xml.sax.SAXParseException: cvc-elt.1: Cannot find the declaration of element 'shiporder'. I'm using the following code: SAXReader reader = new SAXReader(); reader.setValidation(true); reader.setFeature("http://apache.org/xml/features/validation/schema", true); reader.setErrorHandler(new XmlErrorHandler()); reader.read(in); where in is an InputStream and XmlErrorHandler is a simple class that just logs all errors. I'm using the following xml file: <?xml version="1.0" encoding="ISO-8859-1"?> <shiporder orderid="889923" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:noNamespaceSchemaLocation="test1.xsd"> <orderperson>John Smith</orderperson> <shipto> <name>Ola Nordmann</name> <address>Langgt 23</address> <city>4000 Stavanger</city> <country>Norway</country> </shipto> <item> <title>Empire Burlesque</title> <note>Special Edition</note> <quantity>1</quantity> <price>10.90</price> </item> <item> <title>Hide your heart</title> <quantity>1</quantity> <price>9.90</price> </item> </shiporder> and the corresponding xsd: <?xml version="1.0" encoding="ISO-8859-1" ?> <xs:schema xmlns:xs="http://www.w3.org/2001/XMLSchema"> <xs:simpleType name="stringtype"> <xs:restriction base="xs:string"/> </xs:simpleType> <xs:simpleType name="inttype"> <xs:restriction base="xs:positiveInteger"/> </xs:simpleType> <xs:simpleType name="dectype"> <xs:restriction base="xs:decimal"/> </xs:simpleType> <xs:simpleType name="orderidtype"> <xs:restriction base="xs:string"> <xs:pattern value="[0-9]{6}"/> </xs:restriction> </xs:simpleType> <xs:complexType name="shiptotype"> <xs:sequence> <xs:element name="name" type="stringtype"/> <xs:element name="address" type="stringtype"/> <xs:element name="city" type="stringtype"/> <xs:element name="country" type="stringtype"/> </xs:sequence> </xs:complexType> <xs:complexType name="itemtype"> <xs:sequence> <xs:element name="title" type="stringtype"/> <xs:element name="note" type="stringtype" minOccurs="0"/> <xs:element name="quantity" type="inttype"/> <xs:element name="price" type="dectype"/> </xs:sequence> </xs:complexType> <xs:complexType name="shipordertype"> <xs:sequence> <xs:element name="orderperson" type="stringtype"/> <xs:element name="shipto" type="shiptotype"/> <xs:element name="item" maxOccurs="unbounded" type="itemtype"/> </xs:sequence> <xs:attribute name="orderid" type="orderidtype" use="required"/> </xs:complexType> <xs:element name="shiporder" type="shipordertype"/> </xs:schema> The xsd and xml file are in the same directory. What is the problem?

    Read the article

  • error executing aapt, all of the sudden

    - by pjv
    I know there are a lot of these topics around but none seem to help in my case, nor describe it exactly. The best similar one is aapt not found under the right path. My problem is that I can be using Eclipse for a whole evening programming, compiling and using my device, and then suddenly I get "error executing aapt" for my current project and ofcourse R.java isn't (properly) generated anymore. I then restart Eclipse and everything goes away. I'm seeing this once a day on average however. I've recently switched to amd64 and installed the latest Android-2.3 SDK and matching tools. I know that there is now a platform-tools folder that has an aapt version that should work SDK version independently. At first I had added this directory to my PATH, as instructed on the SDK website. I've also tried not adding it to my path and making a link platforms/android-9/tools so that every SDK version might use it's own old copy. Needless to say, platform-tools/aapt is there and has the right permissions, and I have been able to execute it on the command-line at any time. When I do write a faulty xml file or sorts, and appropriately get an error, I see an extra line that says "aapt: /lib32/libz.so.1: no version information available". I'm running a recent Gentoo linux system. I have everything installed to support x86 on amd64, but have re-emerged emul-linux-x86-baselibs and zlib just to be sure. The problem persists. I do see some pages that spell horror over some zlib bugs, but I'm not sure if that's related. I realize I'm not on the reference Ubuntu platform, but surely the difference cannot be that great? It might very well be a bug in aapt or the tools itself. Why would it suddenly stop working? I also experience that the ids in R.java were incorrect, namely that simple findViewById() code would give ClassCastExceptions because of mixed ids the one time, and then work perfectly without any changes bu only a "clean project", in the aftermath of a failing aapt. Finally, I've run a few commands on aapt, that don't seem to add any extra information: #ldd aapt ./aapt: /lib32/libz.so.1: no version information available (required by ./aapt) linux-gate.so.1 => (0xffffe000) librt.so.1 => /lib32/librt.so.1 (0x4f864000) libpthread.so.0 => /lib32/libpthread.so.0 (0x4f849000) libz.so.1 => /lib32/libz.so.1 (0xf7707000) libstdc++.so.6 => /usr/lib/gcc/x86_64-pc-linux-gnu/4.4.4/32/libstdc++.so.6 (0x415e9000) libm.so.6 => /lib32/libm.so.6 (0x4f876000) libgcc_s.so.1 => /lib32/libgcc_s.so.1 (0x4fac6000) libc.so.6 => /lib32/libc.so.6 (0x4f5ed000) /lib/ld-linux.so.2 (0x4f5ca000) #file aapt aapt: ELF 32-bit LSB executable, Intel 80386, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.15, not stripped Can anybody tell anything wrong with my configuration? Does it smell like a bug perhaps (otherwise let's report it (again))? Update 2010-01-06: I've gained some more knowledge. When I recently was trying to export a signed apk, I ran into another error message (full details from the Eclipse error view) regarding aapt I hadn't seen before. Note here too, that I can just restart Eclipse and can export apks again without problems, at least for a little while. I'm starting to think it is related to lack of memory on my system. The message "onvoldoende geheugen beschikbaar" means "insufficient memory available". I have also been seeing insufficient memory errors in DDMS when I'm dumping HPROF files. Here is the error log (shortened): !ENTRY com.android.ide.eclipse.adt 4 0 2011-01-05 23:11:16.097 !MESSAGE Export Wizard Error !STACK 1 org.eclipse.core.runtime.CoreException: Failed to export application at com.android.ide.eclipse.adt.internal.project.ExportHelper.exportReleaseApk(Unknown Source) at com.android.ide.eclipse.adt.internal.wizards.export.ExportWizard.doExport(Unknown Source) at com.android.ide.eclipse.adt.internal.wizards.export.ExportWizard.access$0(Unknown Source) at com.android.ide.eclipse.adt.internal.wizards.export.ExportWizard$1.run(Unknown Source) at org.eclipse.jface.operation.ModalContext$ModalContextThread.run(ModalContext.java:121) Caused by: com.android.ide.eclipse.adt.internal.build.AaptExecException: Error executing aapt. Please check aapt is present at /opt/android-sdk/android-sdk-linux_x86-1.6_r1/platform-tools/aapt at com.android.ide.eclipse.adt.internal.build.BuildHelper.executeAapt(Unknown Source) at com.android.ide.eclipse.adt.internal.build.BuildHelper.packageResources(Unknown Source) ... 5 more Caused by: java.io.IOException: Cannot run program "/opt/android-sdk/android-sdk-linux_x86-1.6_r1/platform-tools/aapt": java.io.IOException: error=12, Onvoldoende geheugen beschikbaar ... Caused by: java.io.IOException: java.io.IOException: error=12, Onvoldoende geheugen beschikbaar ... !SUBENTRY 1 com.android.ide.eclipse.adt 4 0 2011-01-05 23:11:16.098 !MESSAGE Failed to export application !STACK 0 com.android.ide.eclipse.adt.internal.build.AaptExecException: Error executing aapt. Please check aapt is present at /opt/android-sdk/android-sdk-linux_x86-1.6_r1/platform-tools/aapt at com.android.ide.eclipse.adt.internal.build.BuildHelper.executeAapt(Unknown Source) at com.android.ide.eclipse.adt.internal.build.BuildHelper.packageResources(Unknown Source) at com.android.ide.eclipse.adt.internal.project.ExportHelper.exportReleaseApk(Unknown Source) at com.android.ide.eclipse.adt.internal.wizards.export.ExportWizard.doExport(Unknown Source) at com.android.ide.eclipse.adt.internal.wizards.export.ExportWizard.access$0(Unknown Source) at com.android.ide.eclipse.adt.internal.wizards.export.ExportWizard$1.run(Unknown Source) at org.eclipse.jface.operation.ModalContext$ModalContextThread.run(ModalContext.java:121) Caused by: java.io.IOException: Cannot run program "/opt/android-sdk/android-sdk-linux_x86-1.6_r1/platform-tools/aapt": java.io.IOException: error=12, Onvoldoende geheugen beschikbaar ... Caused by: java.io.IOException: java.io.IOException: error=12, Onvoldoende geheugen beschikbaar

    Read the article

  • Communication with HyperTerminal [ QT and WINApi ]

    - by javaAmator
    Hi! I write program to communicate with modem (it useing Hayes commands) and this is working. GUI is programmed with QT, but communication with COM port is write with winapi library. I have problem when I want to send with my program message from one computer to another, i can't send Polish chars (they are repleaced by '?'), how can I fix it ? Does anyone have idea ?? And I have one more problem, I can't send message from my program to Microsoft HyperTerminal, HyperTerminal receive something, but not that what I send. Thx for any help :) Important pieces of code: Connect with port: portHandle = CreateFile (portName, GENERIC_WRITE | GENERIC_READ, 0, NULL, OPEN_EXISTING, 0, NULL); GetCommState (portHandle, &dcb); switch(ui->comboBox->currentIndex()) { case 0 : dcb.BaudRate=CBR_110; break; case 1 : dcb.BaudRate=CBR_300; break; case 2 : dcb.BaudRate=CBR_600; break; case 3 : dcb.BaudRate=CBR_1200; break; case 4 : dcb.BaudRate=CBR_2400; break; case 5 : dcb.BaudRate=CBR_4800; break; case 6 : dcb.BaudRate=CBR_9600; break; case 7 : dcb.BaudRate=CBR_14400; break; case 8 : dcb.BaudRate=CBR_19200; break; case 9 : dcb.BaudRate=CBR_38400; break; case 10 : dcb.BaudRate=CBR_56000; break; case 11 : dcb.BaudRate=CBR_57600; break; case 12 : dcb.BaudRate=CBR_115200; break; case 13 : dcb.BaudRate=CBR_128000; break; case 14 : dcb.BaudRate=CBR_256000; break; } dcb.fBinary = TRUE; dcb.fParity = TRUE; dcb.fOutxCtsFlow = FALSE; dcb.fOutxDsrFlow = FALSE; dcb.fDtrControl = DTR_CONTROL_ENABLE; dcb.fDsrSensitivity = FALSE; dcb.fTXContinueOnXoff = TRUE; dcb.fOutX = FALSE; dcb.fInX = FALSE; dcb.fErrorChar = FALSE; dcb.fNull = FALSE; dcb.fRtsControl = RTS_CONTROL_ENABLE; dcb.fAbortOnError = FALSE; //dcb.ByteSize = dataBits; dcb.DCBlength = sizeof (DCB); switch(ui->comboBox_3->currentIndex()) { case 1 : dcb.Parity = EVENPARITY; break; case 3 : dcb.Parity = MARKPARITY; break; case 2 : dcb.Parity = ODDPARITY; break; case 4 : dcb.Parity = SPACEPARITY; break; case 0 : dcb.Parity = NOPARITY; break; } switch (ui->comboBox_4->currentIndex()) { case 0 : dcb.StopBits = ONESTOPBIT; break; case 1 : dcb.StopBits = ONE5STOPBITS;break; case 2 : dcb.StopBits = TWOSTOPBITS; break; } switch (ui->comboBox_2->currentIndex()) { case 0 : dcb.ByteSize = 5; break; case 1 : dcb.ByteSize = 6;break; case 2 : dcb.ByteSize= 7; break; case 3 : dcb.ByteSize = 8; break; } SetCommState (portHandle, &dcb); GetCommTimeouts (portHandle, &CommTimeouts); CommTimeouts.ReadIntervalTimeout = MAXDWORD; CommTimeouts.ReadTotalTimeoutMultiplier = 0; CommTimeouts.ReadTotalTimeoutConstant = 0; CommTimeouts.WriteTotalTimeoutMultiplier = 10; CommTimeouts.WriteTotalTimeoutConstant = 1000; SetCommTimeouts (portHandle, &CommTimeouts); Send MSG: void MainWindow::Send(char c) { do {WriteFile(portHandle, &c, 1, &cbWritten, NULL); } while (!(cbWritten)); } void MainWindow::on_pushButton_clicked() { QString str = ui->lineEdit->text(); std::string str2; ui->lineEdit->clear(); str2 = str.toStdString(); for(int i=0; i < str2.size();i++) { Send(str2[i]); //qDebug()<< str2[i]; } Send(char(13)); } Receive MSG: void ReaderThread::run() { char c; while(1) { c = Receive(); if(c==13) { emit insertPlainText("\n"); } else { emit insertPlainText(QString(c)); } } } char ReaderThread::Receive() { char c; do{ ReadFile(portHandle, &c, 1, &cbRead, NULL); } while (!(cbRead)); return c; }

    Read the article

  • Ejabberd clustering problem with amazon EC2 server

    - by user353362
    Hello Guys! I have been trying to install ejabberd server on Amazons EC2 instance. I am kinds a stuck at this step right now. I am following this guide: http://tdewolf.blogspot.com/2009/07/clustering-ejabberd-nodes-using-mnes... From the guide I have sucessfully completed the Set up First Node (on ejabberd1) part. But am stuck in part 4 of Set up Second Node (on ejabberd2) So all in all, I created the main node and am able to run the server on that node and access its admin console from then internet. In the second node I have installed ejabberd. But I am stuck at point 4 of setting up the node instruction presented in this blog (http://tdewolf.blogspot.com/2009/07/clustering-ejabberd-nodes-using-mnes...). I execute this command " erl -sname ejabberd@domU-12-31-39-0F-7D-14 -mnesia dir '"/var/lib/ejabberd/"' -mnesia extra_db_nodes "['ejabberd@domU-12-31-39-02-C8-36']" -s mnesia " on the second server and get a crashing error: root@domU-12-31-39-0F-7D-14:/var/lib/ejabberd# erl -sname ejabberd@domU-12-31-39-0F-7D-14 -mnesia dir '"/var/lib/ejabberd/"' -mnesia extra_db_nodes "['ejabberd@domU-12-31-39-02-C8-36']" -s mnesia {error_logger,{{2010,5,28},{23,52,25}},"Protocol: ~p: register error: ~p~n",["inet_tcp",{{badmatch,{error,duplicate_name}},[{inet_tcp_dist,listen,1},{net_kernel,start_protos,4},{net_kernel,start_protos,3},{net_kernel,init_node,2},{net_kernel,init,1},{gen_server,init_it,6},{proc_lib,init_p_do_apply,3}]}]} {error_logger,{{2010,5,28},{23,52,25}},crash_report,[[{pid,<0.21.0},{registered_name,net_kernel},{error_info,{exit,{error,badarg},[{gen_server,init_it,6},{proc_lib,init_p_do_apply,3}]}},{initial_call,{net_kernel,init,['Argument__1']}},{ancestors,[net_sup,kernel_sup,<0.8.0]},{messages,[]},{links,[#Port<0.52,<0.18.0]},{dictionary,[{longnames,false}]},{trap_exit,true},{status,running},{heap_size,610},{stack_size,23},{reductions,518}],[]]} {error_logger,{{2010,5,28},{23,52,25}},supervisor_report,[{supervisor,{local,net_sup}},{errorContext,start_error},{reason,{'EXIT',nodistribution}},{offender,[{pid,undefined},{name,net_kernel},{mfa,{net_kernel,start_link,[['ejabberd@domU-12-31-39-0F-7D-14',shortnames]]}},{restart_type,permanent},{shutdown,2000},{child_type,worker}]}]} {error_logger,{{2010,5,28},{23,52,25}},supervisor_report,[{supervisor,{local,kernel_sup}},{errorContext,start_error},{reason,shutdown},{offender,[{pid,undefined},{name,net_sup},{mfa,{erl_distribution,start_link,[]}},{restart_type,permanent},{shutdown,infinity},{child_type,supervisor}]}]} {error_logger,{{2010,5,28},{23,52,25}},crash_report,[[{pid,<0.7.0},{registered_name,[]},{error_info,{exit,{shutdown,{kernel,start,[normal,[]]}},[{application_master,init,4},{proc_lib,init_p_do_apply,3}]}},{initial_call,{application_master,init,['Argument_1','Argument_2','Argument_3','Argument_4']}},{ancestors,[<0.6.0]},{messages,[{'EXIT',<0.8.0,normal}]},{links,[<0.6.0,<0.5.0]},{dictionary,[]},{trap_exit,true},{status,running},{heap_size,233},{stack_size,23},{reductions,123}],[]]} {error_logger,{{2010,5,28},{23,52,25}},std_info,[{application,kernel},{exited,{shutdown,{kernel,start,[normal,[]]}}},{type,permanent}]} {"Kernel pid terminated",application_controller,"{application_start_failure,kernel,{shutdown,{kernel,start,[normal,[]]}}}"} Crash dump was written to: erl_crash.dump Kernel pid terminated (application_controller) ({application_start_failure,kernel,{shutdown,{kernel,start,[normal,[]]}}}) root@domU-12-31-39-0F-7D-14:/var/lib/ejabberd# any idea what going on? I am not really sure how to solve this problem :S how to let ejabberd only access register from one special server? › Is that the right way of copying .erlang.cookie file? Submitted by privateson on Sat, 2010-05-29 00:11. before this I was getting this error (see below), I solved it by running this command: chmod 400 .erlang.cookie Also to copy the cookie I simply created a file using vi on the second server and copied the secret code from server one to the second server. Is that the right way of copying .erlang.cookie file? ERROR ~~~~~~~~~~ root@domU-12-31-39-0F-7D-14:/etc/ejabberd# erl -sname ejabberd@domU-12-31-39-0F-7D-14 -mnesia dir '"/var/lib/ejabberd/"' -mnesia extra_db_nodes "['ejabberd@domU-12-31-39-02-C8-36']" -s mnesia {error_logger,{{2010,5,28},{23,28,56}},"Cookie file /root/.erlang.cookie must be accessible by owner only",[]} {error_logger,{{2010,5,28},{23,28,56}},crash_report,[[{pid,<0.20.0},{registered_name,auth},{error_info,{exit,{"Cookie file /root/.erlang.cookie must be accessible by owner only",[{auth,init_cookie,0},{auth,init,1},{gen_server,init_it,6},{proc_lib,init_p_do_apply,3}]},[{gen_server,init_it,6},{proc_lib,init_p_do_apply,3}]}},{initial_call,{auth,init,['Argument__1']}},{ancestors,[net_sup,kernel_sup,<0.8.0]},{messages,[]},{links,[<0.18.0]},{dictionary,[]},{trap_exit,true},{status,running},{heap_size,987},{stack_size,23},{reductions,439}],[]]} {error_logger,{{2010,5,28},{23,28,56}},supervisor_report,[{supervisor,{local,net_sup}},{errorContext,start_error},{reason,{"Cookie file /root/.erlang.cookie must be accessible by owner only",[{auth,init_cookie,0},{auth,init,1},{gen_server,init_it,6},{proc_lib,init_p_do_apply,3}]}},{offender,[{pid,undefined},{name,auth},{mfa,{auth,start_link,[]}},{restart_type,permanent},{shutdown,2000},{child_type,worker}]}]} {error_logger,{{2010,5,28},{23,28,56}},supervisor_report,[{supervisor,{local,kernel_sup}},{errorContext,start_error},{reason,shutdown},{offender,[{pid,undefined},{name,net_sup},{mfa,{erl_distribution,start_link,[]}},{restart_type,permanent},{shutdown,infinity},{child_type,supervisor}]}]} {error_logger,{{2010,5,28},{23,28,56}},crash_report,[[{pid,<0.7.0},{registered_name,[]},{error_info,{exit,{shutdown,{kernel,start,[normal,[]]}},[{application_master,init,4},{proc_lib,init_p_do_apply,3}]}},{initial_call,{application_master,init,['Argument_1','Argument_2','Argument_3','Argument_4']}},{ancestors,[<0.6.0]},{messages,[{'EXIT',<0.8.0,normal}]},{links,[<0.6.0,<0.5.0]},{dictionary,[]},{trap_exit,true},{status,running},{heap_size,233},{stack_size,23},{reductions,123}],[]]} {error_logger,{{2010,5,28},{23,28,56}},std_info,[{application,kernel},{exited,{shutdown,{kernel,start,[normal,[]]}}},{type,permanent}]} {"Kernel pid terminated",application_controller,"{application_start_failure,kernel,{shutdown,{kernel,start,[normal,[]]}}}"} Crash dump was written to: erl_crash.dump Kernel pid terminated (application_controller) ({application_start_failure,kernel,{shutdown,{kernel,start,[normal,[]]}}}) root@domU-12-31-39-0F-7D-14:/var/lib/ejabberd# cat /var/log/ejabberd/ejabberd.log =INFO REPORT==== 2010-05-28 22:48:53 === I(<0.321.0:mod_pubsub:154) : pubsub init "localhost" [{access_createnode, pubsub_createnode}, {plugins, ["default","pep"]}] =INFO REPORT==== 2010-05-28 22:48:53 === I(<0.321.0:mod_pubsub:210) : ** tree plugin is nodetree_default =INFO REPORT==== 2010-05-28 22:48:53 === I(<0.321.0:mod_pubsub:214) : ** init default plugin =INFO REPORT==== 2010-05-28 22:48:53 === I(<0.321.0:mod_pubsub:214) : ** init pep plugin =ERROR REPORT==== 2010-05-28 23:40:08 === ** Connection attempt from disallowed node 'ejabberdctl1275090008486951000@domU-12-31-39-0F-7D-14' ** =ERROR REPORT==== 2010-05-28 23:41:10 === ** Connection attempt from disallowed node 'ejabberdctl1275090070163253000@domU-12-31-39-0F-7D-14' **

    Read the article

  • Build Environment setup - Using .net, java, hudson, and ruby - Could really use a critique

    - by Jeff D
    I'm trying to figure out the best way to stitch together a fast, repeatable, unbreakable build process for the following environment. I've got a plan for how to do it, but I'd really appreciate a critique. (I'd also appreciate some sample code, but more on that later) Ecosystem - Logical: Website - asp.net MVC 2, .net 3.5, Visual Studio 2010. IIS 6, Facebook iframe application application. This website/facebook app uses a few services. An internal search api, an internal read/write api, facebook, and an IP geolocation service. More details on these below Internal search api - .net, restful, built using old school .ashx handlers. The api uses lucene, and a sql server database behind the scenes. My project won't touch the lucene code, but does potentially touch the database and the web services. internal read/write api - java, restful, running on Tomcat Facebook web services A mocking site that emulates the internal read/write api, and parts of the facebook api Hudson - Runs unit tests on checkin, and creates some installers that behave inconsistently. Ecosystem - Physical: All of these machines can talk to one another, except for Hudson. Hudson can't see any of the target machines. So code must be pulled, rather than pushed. (Security thing) 1. Web Server - Holds the website, and the read/write api. (The api itself writes to a replicated sql server environment). 2. Search Server - Houses the search api. 3. Hudson Server - Does not have permissions to push to any environment. They have to pull. 4. Lucene Server 5. Database Server Problem I've been trying to set this site up to run in a stress environment, but the number of setup steps, the amount of time it takes to update a component, the black-box nature of the current installers, and the time it takes to generate data into the test system is absolutely destroying my productivity. I tweak one setting, have to redeploy, restart in a certain order, resetup some of the settings, and rebuild test data. Errors result in headscratching, and then basically starting over. Very bad. This problem is complicated further by my stress testing. I need to be able to turn on and off different external components, so that I can effectively determine the scalability of each piece. I've got strategies in place for how to do that for each dependency, but it further complicates my setup strategy, because now each component has 2 options. A mock version, or a real version. Configurations everywhere must be updated accordingly. Goals Fast - I want to drop this from a 20 minute exercise when things go perfectly, to a 3 minute one Stupid simple - I want to tell the environment what to do with as few commands as possible, and not have to remember how to stitch the environments together Repeatable - I want the script to be idempotent. Kind of a corollary to the Stupid Simple thing. The Plan So Far Here's what I've come up with so far, and what I've come looking for feedback on: Use VisualStudio's new web.config transformations to permit easily altering configs based on envrionment. This solution isn't really sufficient though. I will leave web.config set up to let the site run locally, but when deploying elsewhere, I have as many as 6 different possible outputs for the stress environment alone (because of the mocks of the various dependencies), let alone the settings for prod, QA, and dev. Each of these would then require it's own setup, or a setup that would then post-process the configs. So I'm currently leaning toward just having the dev version, and a version that converts key configuration values into a ruby string interpolation syntax. ({#VAR_NAME} kinda thing) Create a ruby script for each server that is essentially a bootstrapping script. That is to say, it will do nothing but load the ruby code that does the 'real' work from hudson/subversion, so that the script's functionality can evolve with the application, making it easy to build the site at any point in time by reference the appropriate version of the script. So in a nutshell, this script loads another script, and runs it. The 'real' ruby script will then accept commandline parameters that describe how the environment should look. From there, 1 configuration file can be used, and ruby will download the current installers, run them, post-process the configs, restart IIS/Tomcat, and kick off any data setup code that is needed. So that's it. I'm in a real time crunch to get this site stress-tested, so any feedback that you think could abbreviate the time this might take would be appreciated. That includes a shameless request for sample ruby code. I've not gotten too much further than puts "Hello World". :-) Just guidance would be helpful. Is this something that Rake would be useful for? How would you recommend I write tests for this animal? (I use interfaces and automocking frameworks to mock out things like http requests in .net. With ducktyping, it seems that this might be easier, but I don't know how to tell my code to use a fake duck in test, but a real one in practice) Thanks all. Sorry for such such a long-winded, open-ended question.

    Read the article

  • What add-in/workbench framework is the best .NET alternative to Eclipse RCP?

    - by Winston Fassett
    I'm looking for a plugin-based application framework that is comparable to the Eclipse Plugin Framework, which to my simple mind consists of: a core plugin management framework (Equinox / OSGI), which provides the ability to declare extension endpoints and then discover and load plugins that service those endpoints. (this is different than Dependency Injection, but admittedly the difference is subtle - configuration is highly de-centralized, there are versioning concerns, it might involve an online plugin repository, and most importantly to me, it should be easy for the user to add plugins without needing to know anything about the underlying architecture / config files) many layers of plugins that provide a basic workbench shell with concurrency support, commands, preference sheets, menus, toolbars, key bindings, etc. That is just scratching the surface of the RCP, which itself is meant to serve as the foundation of your application, which you build by writing / assembling even more plugins. Here's what I've gleaned from the internet in the past couple of days... As far as I can tell, there is nothing in the .NET world that remotely approaches the robustness and maturity of the Eclipse RCP for Java but there are several contenders that do either #1 or #2 pretty well. (I should also mention that I have not made a final decision on WinForms vs WPF, so I'm also trying to understand the level of UI coupling in any candidate framework. I'm also wondering about platform coupling and source code licensing) I must say that the open-source stuff is generally less-documented but easier to understand, while the MS stuff typically has more documentation but is less accessible, so that with many of the MS technologies, I'm left wondering what they actually do, in a practical sense. These are the libraries I have found: SharpDevelop The first thing I looked at was SharpDevelop, which does both #1 and also #2 in a basic way (no insult to SharpDevelop, which is admirable - I just mean more basic than Eclipse RCP). However, SharpDevelop is an application more than a framework, and there are basic assumptions and limitations there (i.e. being somewhat coupled to WinForms). Still, there are some articles on CodeProject explaining how to use it as the foundation for an application. System.Addins It appears that System.Addins is meant to provide a robust add-in loading framework, with some sophisticated options for loading assemblies with varying levels of trusts and even running the out of process. It appears to be primarily code-based, and pretty code-heavy, with lots of assemblies that serve to insulate against versioning issues., using Guidance Automation to generate a good deal of code. So far I haven't found many System.AddIns articles that illustrate how it could be used to build something like an Eclipse RCP, and many people seem to be wringing their hands about its complexity. Mono.Addins It appears that Mono.Addins was influenced by System.Addins, SharpDevelop, and MonoDevelop. It seems to provide the basics from System.Addins, with less sophisticated options for plugin loading, but more simplicity, with attribute-based registration, XML manifests, and the infrastructure for online plugin repositories. It has a pretty good FAQ and documentation, as well as a fairly robust set of examples that really help paint a picture of how to develop an architecture like that of SharpDevelop or Eclipse. The examples use GTK for UI, but the framework itself is not coupled to GTK. So it appears to do #1 (add-in loading) pretty well and points the way to #2 (workbench framework). It appears that Mono.Addins was derived from MonoDevelop, but I haven't actually looked at whether MonoDevelop provides a good core workbench framework. Managed Extensibility Framework This is what everyone's talking about at the moment, and it's slowly getting clearer what it does, but I'm still pretty fuzzy, even after reading several posts on SO. The official word is that it "can live side-by-side" with System.Addins. However, it doesn't reference it and it appears to reproduce some of its functionality. It seems to me, then, that it is a simpler, more accessible alternative to System.Addins. It appears to be more like Mono.Addins in that it provides attribute-based wiring. It provides "catalogs" that can be attribute-based or directory-based. It does not seem to provide any XML or manifest-based wiring. So far I haven't found much documentation and the examples seem to be kind of "magical" and more reminiscent of attribute-based DI, despite the clarifications that MEF is not a DI container. Its license just got opened up, but it does reference WindowsBase -- not sure if that means it's coupled to Windows. Acropolis I'm not sure what this is. Is it MEF, or something that is still coming? Composite Application Blocks There are WPF and Winforms Composite Application blocks that seem to provide much more of a workbench framework. I have very little experience with these but they appear to rely on Guidance Automation quite a bit are obviously coupled with the UI layers. There are a few examples of combining MEF with these application blocks. I've done the best I could to answer my own question here, but I'm really only scratching the surface, and I don't have experience with any of these frameworks. Hopefully some of you can add more detail about the frameworks you have experience with. It would be great if we could end up with some sort of comparison matrix.

    Read the article

  • Accessing py2exe program over network in Windows 98 throws ImportErrors

    - by darvids0n
    I'm running a py2exe-compiled python program from one server machine on a number of client machines (mapped to a network drive on every machine, say W:). For Windows XP and later machines, have so far had zero problems with Python picking up W:\python23.dll (yes, I'm using Python 2.3.5 for W98 compatibility and all that). It will then use W:\zlib.pyd to decompress W:\library.zip containing all the .pyc files like os and such, which are then imported and the program runs no problems. The issue I'm getting is on some Windows 98 SE machines (note: SOME Windows 98 SE machines, others seem to work with no apparent issues). What happens is, the program runs from W:, the W:\python23.dll is, I assume, found (since I'm getting Python ImportErrors, we'd need to be able to execute a Python import statement), but a couple of things don't work: 1) If W:\library.zip contains the only copy of the .pyc files, I get ZipImportError: can't decompress data; zlib not available (nonsense, considering W:\zlib.pyd IS available and works fine with the XP and higher machines on the same network). 2) If the .pyc files are actually bundled INSIDE the python exe by py2exe, OR put in the same directory as the .exe, OR put into a named subdirectory which is then set as part of the PYTHONPATH variable (e.g W:\pylib), I get ImportError: no module named os (os is the first module imported, before sys and anything else). Come to think of it, sys.path wouldn't be available to search if os was imported before it maybe? I'll try switching the order of those imports but my question still stands: Why is this a sporadic issue, working on some networks but not on others? And how would I force Python to find the files that are bundled inside the very executable I run? I have immediate access to the working Windows 98 SE machine, but I only get access to the non-working one (a customer of mine) every morning before their store opens. Thanks in advance! EDIT: Okay, big step forward. After debugging with PY2EXE_VERBOSE, the problem occurring on the specific W98SE machine is that it's not using the right path syntax when looking for imports. Firstly, it doesn't seem to read the PYTHONPATH environment variable (there may be a py2exe-specific one I'm not aware of, like PY2EXE_VERBOSE). Secondly, it only looks in one place before giving up (if the files are bundled inside the EXE, it looks there. If not, it looks in library.zip). EDIT 2: In fact, according to this, there is a difference between the sys.path in the Python interpreter and that of Py2exe executables. Specifically, sys.path contains only a single entry: the full pathname of the shared code archive. Blah. No fallbacks? Not even the current working directory? I'd try adding W:\ to PATH, but py2exe doesn't conform to any sort of standards for locating system libraries, so it won't work. Now for the interesting bit. The path it tries to load atexit, os, etc. from is: W:\\library.zip\<module>.<ext> Note the single slash after library.zip, but the double slash after the drive letter (someone correct me if this is intended and should work). It looks like if this is a string literal, then since the slash isn't doubled, it's read as an (invalid) escape sequence and the raw character is printed (giving W:\library.zipos.pyd, W:\library.zipos.dll, ... instead of with a slash); if it is NOT a string literal, the double slash might not be normpath'd automatically (as it should be) and so the double slash confuses the module loader. Like I said, I can't just set PYTHONPATH=W:\\library.zip\\ because it ignores that variable. It may be worth using sys.path.append at the start of my program but hard-coding module paths is an absolute LAST resort, especially since the problem occurs in ONE configuration of an outdated OS. Any ideas? I have one, which is to normpath the sys.path.. pity I need os for that. Another is to just append os.getenv('PATH') or os.getenv('PYTHONPATH') to sys.path... again, needing the os module. The site module also fails to initialise, so I can't use a .pth file. I also recently tried the following code at the start of the program: for pth in sys.path: fErr.write(pth) fErr.write(' to ') pth.replace('\\\\','\\') # Fix Windows 98 pathing issues fErr.write(pth) fErr.write('\n') But it can't load linecache.pyc, or anything else for that matter; it can't actually execute those commands from the looks of things. Is there any way to use built-in functionality which doesn't need linecache to modify the sys.path dynamically? Or am I reduced to hard-coding the correct sys.path?

    Read the article

  • MVVM - implementing 'IsDirty' functionality to a ModelView in order to save data

    - by Brendan
    Hi, Being new to WPF & MVVM I struggling with some basic functionality. Let me first explain what I am after, and then attach some example code... I have a screen showing a list of users, and I display the details of the selected user on the right-hand side with editable textboxes. I then have a Save button which is DataBound, but I would only like this button to display when data has actually changed. ie - I need to check for "dirty data". I have a fully MVVM example in which I have a Model called User: namespace Test.Model { class User { public string UserName { get; set; } public string Surname { get; set; } public string Firstname { get; set; } } } Then, the ViewModel looks like this: using System.Collections.ObjectModel; using System.Collections.Specialized; using System.Windows.Input; using Test.Model; namespace Test.ViewModel { class UserViewModel : ViewModelBase { //Private variables private ObservableCollection<User> _users; RelayCommand _userSave; //Properties public ObservableCollection<User> User { get { if (_users == null) { _users = new ObservableCollection<User>(); //I assume I need this Handler, but I am stuggling to implement it successfully //_users.CollectionChanged += HandleChange; //Populate with users _users.Add(new User {UserName = "Bob", Firstname="Bob", Surname="Smith"}); _users.Add(new User {UserName = "Smob", Firstname="John", Surname="Davy"}); } return _users; } } //Not sure what to do with this?!?! //private void HandleChange(object sender, NotifyCollectionChangedEventArgs e) //{ // if (e.Action == NotifyCollectionChangedAction.Remove) // { // foreach (TestViewModel item in e.NewItems) // { // //Removed items // } // } // else if (e.Action == NotifyCollectionChangedAction.Add) // { // foreach (TestViewModel item in e.NewItems) // { // //Added items // } // } //} //Commands public ICommand UserSave { get { if (_userSave == null) { _userSave = new RelayCommand(param => this.UserSaveExecute(), param => this.UserSaveCanExecute); } return _userSave; } } void UserSaveExecute() { //Here I will call my DataAccess to actually save the data } bool UserSaveCanExecute { get { //This is where I would like to know whether the currently selected item has been edited and is thus "dirty" return false; } } //constructor public UserViewModel() { } } } The "RelayCommand" is just a simple wrapper class, as is the "ViewModelBase". (I'll attach the latter though just for clarity) using System; using System.ComponentModel; namespace Test.ViewModel { public abstract class ViewModelBase : INotifyPropertyChanged, IDisposable { protected ViewModelBase() { } public event PropertyChangedEventHandler PropertyChanged; protected virtual void OnPropertyChanged(string propertyName) { PropertyChangedEventHandler handler = this.PropertyChanged; if (handler != null) { var e = new PropertyChangedEventArgs(propertyName); handler(this, e); } } public void Dispose() { this.OnDispose(); } protected virtual void OnDispose() { } } } Finally - the XAML <Window x:Class="Test.MainWindow" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" xmlns:vm="clr-namespace:Test.ViewModel" Title="MainWindow" Height="350" Width="525"> <Window.DataContext> <vm:UserViewModel/> </Window.DataContext> <Grid> <ListBox Height="238" HorizontalAlignment="Left" Margin="12,12,0,0" Name="listBox1" VerticalAlignment="Top" Width="197" ItemsSource="{Binding Path=User}" IsSynchronizedWithCurrentItem="True"> <ListBox.ItemTemplate> <DataTemplate> <StackPanel> <TextBlock Text="{Binding Path=Firstname}"/> <TextBlock Text="{Binding Path=Surname}"/> </StackPanel> </DataTemplate> </ListBox.ItemTemplate> </ListBox> <Label Content="Username" Height="28" HorizontalAlignment="Left" Margin="232,16,0,0" Name="label1" VerticalAlignment="Top" /> <TextBox Height="23" HorizontalAlignment="Left" Margin="323,21,0,0" Name="textBox1" VerticalAlignment="Top" Width="120" Text="{Binding Path=User/UserName}" /> <Label Content="Surname" Height="28" HorizontalAlignment="Left" Margin="232,50,0,0" Name="label2" VerticalAlignment="Top" /> <TextBox Height="23" HorizontalAlignment="Left" Margin="323,52,0,0" Name="textBox2" VerticalAlignment="Top" Width="120" Text="{Binding Path=User/Surname}" /> <Label Content="Firstname" Height="28" HorizontalAlignment="Left" Margin="232,84,0,0" Name="label3" VerticalAlignment="Top" /> <TextBox Height="23" HorizontalAlignment="Left" Margin="323,86,0,0" Name="textBox3" VerticalAlignment="Top" Width="120" Text="{Binding Path=User/Firstname}" /> <Button Content="Button" Height="23" HorizontalAlignment="Left" Margin="368,159,0,0" Name="button1" VerticalAlignment="Top" Width="75" Command="{Binding Path=UserSave}" /> </Grid> </Window> So basically, when I edit a surname, the Save button should be enabled; and if I undo my edit - well then it should be Disabled again as nothing has changed. I have seen this in many examples, but have not yet found out how to do it. Any help would be much appreciated! Brendan

    Read the article

  • Can't get my head arround background workers in c#

    - by Connel
    I have wrote an application that syncs two folders together. The problem with the program is that it stops responding whilst copying files. A quick search of stack-overflow told me I need to use something called a background worker. I have read a few pages on the net about this but find it really hard to understand as I'm pretty new to programming. Below is the code for my application - how can I simply put all of the File.Copy(....) commands into their own background worker (if that's even how it works)? Below is the code for the button click event that runs the sub procedure and the sub procedure I wish to use a background worker on all the File.Copy lines. Button event: protected virtual void OnBtnSyncClicked (object sender, System.EventArgs e) { //sets running boolean to true booRunning=true; //sets progress bar to 0 prgProgressBar.Fraction = 0; //resets values used by progressbar dblCurrentStatus = 0; dblFolderSize = 0; //tests if user has entered the same folder for both target and destination if (fchDestination.CurrentFolder == fchTarget.CurrentFolder) { //creates message box MessageDialog msdSame = new MessageDialog(this, DialogFlags.Modal, MessageType.Error, ButtonsType.Close, "You cannot sync two folders that are the same"); //sets message box title msdSame.Title="Error"; //sets respone type ResponseType response = (ResponseType) msdSame.Run(); //if user clicks on close button or closes window then close message box if (response == ResponseType.Close || response == ResponseType.DeleteEvent) { msdSame.Destroy(); } return; } //tests if user has entered a target folder that is an extension of the destination folder // or if user has entered a desatination folder that is an extension of the target folder if (fchTarget.CurrentFolder.StartsWith(fchDestination.CurrentFolder) || fchDestination.CurrentFolder.StartsWith(fchTarget.CurrentFolder)) { //creates message box MessageDialog msdContains = new MessageDialog(this, DialogFlags.Modal, MessageType.Error, ButtonsType.Close, "You cannot sync a folder with one of its parent folders"); //sets message box title msdContains.Title="Error"; //sets respone type and runs message box ResponseType response = (ResponseType) msdContains.Run(); //if user clicks on close button or closes window then close message box if (response == ResponseType.Close || response == ResponseType.DeleteEvent) { msdContains.Destroy(); } return; } //gets folder size of target folder FileSizeOfTarget(fchTarget.CurrentFolder); //gets folder size of destination folder FileSizeOfDestination(fchDestination.CurrentFolder); //runs SyncTarget procedure SyncTarget(fchTarget.CurrentFolder); //runs SyncDestination procedure SyncDestination(fchDestination.CurrentFolder); //informs user process is complete prgProgressBar.Text = "Finished"; //sets running bool to false booRunning = false; } Sync sub-procedure: protected void SyncTarget (string strCurrentDirectory) { //string array of all the directories in directory string[] staAllDirectories = Directory.GetDirectories(strCurrentDirectory); //string array of all the files in directory string[] staAllFiles = Directory.GetFiles(strCurrentDirectory); //loop over each file in directory foreach (string strFile in staAllFiles) { //string of just the file's name and not its path string strFileName = System.IO.Path.GetFileName(strFile); //string containing directory in target folder string strDirectoryInsideTarget = System.IO.Path.GetDirectoryName(strFile).Substring(fchTarget.CurrentFolder.Length); //inform user as to what file is being copied prgProgressBar.Text="Syncing " + strFile; //tests if file does not exist in destination folder if (!File.Exists(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName)) { //if file does not exist copy it to destination folder, the true below means overwrite if file already exists File.Copy (strFile, fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName, true); } //tests if file does exist in destination folder if (File.Exists(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName)) { //long (number) that contains date of last write time of target file long lngTargetFileDate = File.GetLastWriteTime(strFile).ToFileTime(); //long (number) that contains date of last write time of destination file long lngDestinationFileDate = File.GetLastWriteTime(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName).ToFileTime(); //tests if target file is newer than destination file if (lngTargetFileDate > lngDestinationFileDate) { //if it is newer then copy file from target folder to destination folder File.Copy (strFile, fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName, true); } } //gets current file size FileInfo FileSize = new FileInfo(strFile); //sets file's filesize to dblCurrentStatus and adds it to current total of files dblCurrentStatus = dblCurrentStatus + FileSize.Length; double dblPercentage = dblCurrentStatus/dblFolderSize; prgProgressBar.Fraction = dblPercentage; } //loop over each folder in target folder foreach (string strDirectory in staAllDirectories) { //string containing directories inside target folder but not any higher directories string strDirectoryInsideTarget = strDirectory.Substring(fchTarget.CurrentFolder.Length); //tests if directory does not exist inside destination folder if (!Directory.Exists(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget)) { //it directory does not exisit create it Directory.CreateDirectory(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget); } //run sync on all files in directory SyncTarget(strDirectory); } } Any help will be greatly appreciated as after this the program will pretty much be finished :D

    Read the article

  • Making swap faster, easier to use and exception-safe

    - by FredOverflow
    I could not sleep last night and started thinking about std::swap. Here is the familiar C++98 version: template <typename T> void swap(T& a, T& b) { T c(a); a = b; b = c; } If a user-defined class Foo uses external ressources, this is inefficient. The common idiom is to provide a method void Foo::swap(Foo& other) and a specialization of std::swap<Foo>. Note that this does not work with class templates since you cannot partially specialize a function template, and overloading names in the std namespace is illegal. The solution is to write a template function in one's own namespace and rely on argument dependent lookup to find it. This depends critically on the client to follow the "using std::swap idiom" instead of calling std::swap directly. Very brittle. In C++0x, if Foo has a user-defined move constructor and a move assignment operator, providing a custom swap method and a std::swap<Foo> specialization has little to no performance benefit, because the C++0x version of std::swap uses efficient moves instead of copies: #include <utility> template <typename T> void swap(T& a, T& b) { T c(std::move(a)); a = std::move(b); b = std::move(c); } Not having to fiddle with swap anymore already takes a lot of burden away from the programmer. Current compilers do not generate move constructors and move assignment operators automatically yet, but as far as I know, this will change. The only problem left then is exception-safety, because in general, move operations are allowed to throw, and this opens up a whole can of worms. The question "What exactly is the state of a moved-from object?" complicates things further. Then I was thinking, what exactly are the semantics of std::swap in C++0x if everything goes fine? What is the state of the objects before and after the swap? Typically, swapping via move operations does not touch external resources, only the "flat" object representations themselves. So why not simply write a swap template that does exactly that: swap the object representations? #include <cstring> template <typename T> void swap(T& a, T& b) { unsigned char c[sizeof(T)]; memcpy( c, &a, sizeof(T)); memcpy(&a, &b, sizeof(T)); memcpy(&b, c, sizeof(T)); } This is as efficient as it gets: it simply blasts through raw memory. It does not require any intervention from the user: no special swap methods or move operations have to be defined. This means that it even works in C++98 (which does not have rvalue references, mind you). But even more importantly, we can now forget about the exception-safety issues, because memcpy never throws. I can see two potential problems with this approach: First, not all objects are meant to be swapped. If a class designer hides the copy constructor or the copy assignment operator, trying to swap objects of the class should fail at compile-time. We can simply introduce some dead code that checks whether copying and assignment are legal on the type: template <typename T> void swap(T& a, T& b) { if (false) // dead code, never executed { T c(a); // copy-constructible? a = b; // assignable? } unsigned char c[sizeof(T)]; std::memcpy( c, &a, sizeof(T)); std::memcpy(&a, &b, sizeof(T)); std::memcpy(&b, c, sizeof(T)); } Any decent compiler can trivially get rid of the dead code. (There are probably better ways to check the "swap conformance", but that is not the point. What matters is that it's possible). Second, some types might perform "unusual" actions in the copy constructor and copy assignment operator. For example, they might notify observers of their change. I deem this a minor issue, because such kinds of objects probably should not have provided copy operations in the first place. Please let me know what you think of this approach to swapping. Would it work in practice? Would you use it? Can you identify library types where this would break? Do you see additional problems? Discuss!

    Read the article

  • C#: Inheritance, Overriding, and Hiding

    - by Rosarch
    I'm having difficulty with an architectural decision for my C# XNA game. The basic entity in the world, such as a tree, zombie, or the player, is represented as a GameObject. Each GameObject is composed of at least a GameObjectController, GameObjectModel, and GameObjectView. These three are enough for simple entities, like inanimate trees or rocks. However, as I try to keep the functionality as factored out as possible, the inheritance begins to feel unwieldy. Syntactically, I'm not even sure how best to accomplish my goals. Here is the GameObjectController: public class GameObjectController { protected GameObjectModel model; protected GameObjectView view; public GameObjectController(GameObjectManager gameObjectManager) { this.gameObjectManager = gameObjectManager; model = new GameObjectModel(this); view = new GameObjectView(this); } public GameObjectManager GameObjectManager { get { return gameObjectManager; } } public virtual GameObjectView View { get { return view; } } public virtual GameObjectModel Model { get { return model; } } public virtual void Update(long tick) { } } I want to specify that each subclass of GameObjectController will have accessible at least a GameObjectView and GameObjectModel. If subclasses are fine using those classes, but perhaps are overriding for a more sophisticated Update() method, I don't want them to have to duplicate the code to produce those dependencies. So, the GameObjectController constructor sets those objects up. However, some objects do want to override the model and view. This is where the trouble comes in. Some objects need to fight, so they are CombatantGameObjects: public class CombatantGameObject : GameObjectController { protected new readonly CombatantGameModel model; public new virtual CombatantGameModel Model { get { return model; } } protected readonly CombatEngine combatEngine; public CombatantGameObject(GameObjectManager gameObjectManager, CombatEngine combatEngine) : base(gameObjectManager) { model = new CombatantGameModel(this); this.combatEngine = combatEngine; } public override void Update(long tick) { if (model.Health <= 0) { gameObjectManager.RemoveFromWorld(this); } base.Update(tick); } } Still pretty simple. Is my use of new to hide instance variables correct? Note that I'm assigning CombatantObjectController.model here, even though GameObjectController.Model was already set. And, combatants don't need any special view functionality, so they leave GameObjectController.View alone. Then I get down to the PlayerController, at which a bug is found. public class PlayerController : CombatantGameObject { private readonly IInputReader inputReader; private new readonly PlayerModel model; public new PlayerModel Model { get { return model; } } private float lastInventoryIndexAt; private float lastThrowAt; public PlayerController(GameObjectManager gameObjectManager, IInputReader inputReader, CombatEngine combatEngine) : base(gameObjectManager, combatEngine) { this.inputReader = inputReader; model = new PlayerModel(this); Model.Health = Constants.PLAYER_HEALTH; } public override void Update(long tick) { if (Model.Health <= 0) { gameObjectManager.RemoveFromWorld(this); for (int i = 0; i < 10; i++) { Debug.WriteLine("YOU DEAD SON!!!"); } return; } UpdateFromInput(tick); // .... } } The first time that this line is executed, I get a null reference exception: model.Body.ApplyImpulse(movementImpulse, model.Position); model.Position looks at model.Body, which is null. This is a function that initializes GameObjects before they are deployed into the world: public void Initialize(GameObjectController controller, IDictionary<string, string> data, WorldState worldState) { controller.View.read(data); controller.View.createSpriteAnimations(data, _assets); controller.Model.read(data); SetUpPhysics(controller, worldState, controller.Model.BoundingCircleRadius, Single.Parse(data["x"]), Single.Parse(data["y"]), bool.Parse(data["isBullet"])); } Every object is passed as a GameObjectController. Does that mean that if the object is really a PlayerController, controller.Model will refer to the base's GameObjectModel and not the PlayerController's overriden PlayerObjectModel? In response to rh: This means that now for a PlayerModel p, p.Model is not equivalent to ((CombatantGameObject)p).Model, and also not equivalent to ((GameObjectController)p).Model. That is exactly what I do not want. I want: PlayerController p; p.Model == ((CombatantGameObject)p).Model p.Model == ((GameObjectController)p).Model How can I do this? override?

    Read the article

  • improving conversions to binary and back in C#

    - by Saad Imran.
    I'm trying to write a general purpose socket server for a game I'm working on. I know I could very well use already built servers like SmartFox and Photon, but I wan't to go through the pain of creating one myself for learning purposes. I've come up with a BSON inspired protocol to convert the the basic data types, their arrays, and a special GSObject to binary and arrange them in a way so that it can be put back together into object form on the client end. At the core, the conversion methods utilize the .Net BitConverter class to convert the basic data types to binary. Anyways, the problem is performance, if I loop 50,000 times and convert my GSObject to binary each time it takes about 5500ms (the resulting byte[] is just 192 bytes per conversion). I think think this would be way too slow for an MMO that sends 5-10 position updates per second with a 1000 concurrent users. Yes, I know it's unlikely that a game will have a 1000 users on at the same time, but like I said earlier this is supposed to be a learning process for me, I want to go out of my way and build something that scales well and can handle at least a few thousand users. So yea, if anyone's aware of other conversion techniques or sees where I'm loosing performance I would appreciate the help. GSBitConverter.cs This is the main conversion class, it adds extension methods to main datatypes to convert to the binary format. It uses the BitConverter class to convert the base types. I've shown only the code to convert integer and integer arrays, but the rest of the method are pretty much replicas of those two, they just overload the type. public static class GSBitConverter { public static byte[] ToGSBinary(this short value) { return BitConverter.GetBytes(value); } public static byte[] ToGSBinary(this IEnumerable<short> value) { List<byte> bytes = new List<byte>(); short length = (short)value.Count(); bytes.AddRange(length.ToGSBinary()); for (int i = 0; i < length; i++) bytes.AddRange(value.ElementAt(i).ToGSBinary()); return bytes.ToArray(); } public static byte[] ToGSBinary(this bool value); public static byte[] ToGSBinary(this IEnumerable<bool> value); public static byte[] ToGSBinary(this IEnumerable<byte> value); public static byte[] ToGSBinary(this int value); public static byte[] ToGSBinary(this IEnumerable<int> value); public static byte[] ToGSBinary(this long value); public static byte[] ToGSBinary(this IEnumerable<long> value); public static byte[] ToGSBinary(this float value); public static byte[] ToGSBinary(this IEnumerable<float> value); public static byte[] ToGSBinary(this double value); public static byte[] ToGSBinary(this IEnumerable<double> value); public static byte[] ToGSBinary(this string value); public static byte[] ToGSBinary(this IEnumerable<string> value); public static string GetHexDump(this IEnumerable<byte> value); } Program.cs Here's the the object that I'm converting to binary in a loop. class Program { static void Main(string[] args) { GSObject obj = new GSObject(); obj.AttachShort("smallInt", 15); obj.AttachInt("medInt", 120700); obj.AttachLong("bigInt", 10900800700); obj.AttachDouble("doubleVal", Math.PI); obj.AttachStringArray("muppetNames", new string[] { "Kermit", "Fozzy", "Piggy", "Animal", "Gonzo" }); GSObject apple = new GSObject(); apple.AttachString("name", "Apple"); apple.AttachString("color", "red"); apple.AttachBool("inStock", true); apple.AttachFloat("price", (float)1.5); GSObject lemon = new GSObject(); apple.AttachString("name", "Lemon"); apple.AttachString("color", "yellow"); apple.AttachBool("inStock", false); apple.AttachFloat("price", (float)0.8); GSObject apricoat = new GSObject(); apple.AttachString("name", "Apricoat"); apple.AttachString("color", "orange"); apple.AttachBool("inStock", true); apple.AttachFloat("price", (float)1.9); GSObject kiwi = new GSObject(); apple.AttachString("name", "Kiwi"); apple.AttachString("color", "green"); apple.AttachBool("inStock", true); apple.AttachFloat("price", (float)2.3); GSArray fruits = new GSArray(); fruits.AddGSObject(apple); fruits.AddGSObject(lemon); fruits.AddGSObject(apricoat); fruits.AddGSObject(kiwi); obj.AttachGSArray("fruits", fruits); Stopwatch w1 = Stopwatch.StartNew(); for (int i = 0; i < 50000; i++) { byte[] b = obj.ToGSBinary(); } w1.Stop(); Console.WriteLine(BitConverter.IsLittleEndian ? "Little Endian" : "Big Endian"); Console.WriteLine(w1.ElapsedMilliseconds + "ms"); } Here's the code for some of my other classes that are used in the code above. Most of it is repetitive. GSObject GSArray GSWrappedObject

    Read the article

  • Ignoring focusLost(), SWT.Verify, or other SWT listeners in Java code.

    - by Zoot
    Outside of the actual SWT listener, is there any way to ignore a listener via code? For example, I have a java program that implements SWT Text Widgets, and the widgets have: SWT.Verify listeners to filter out unwanted text input. ModifyListeners to wait for the correct number of valid input characters and automatically set focus (using setFocus())to the next valid field, skipping the other text widgets in the tab order. focusLost(FocusEvent) FocusListeners that wait for the loss of focus from the text widget to perform additional input verification and execute an SQL query based on the user input. The issue I run into is clearing the text widgets. One of the widgets has the format "####-##" (Four Numbers, a hyphen, then two numbers) and I have implemented this listener, which is a modified version of SWT Snippet Snippet179. The initial text for this text widget is " - " to provide visual feedback to the user as to the expected format. Only numbers are acceptable input, and the program automatically skips past the hyphen at the appropriate point. /* * This listener was adapted from the "verify input in a template (YYYY/MM/DD)" SWT Code * Snippet (also known as Snippet179), from the Snippets page of the SWT Project. * SWT Code Snippets can be found at: * http://www.eclipse.org/swt/snippets/ */ textBox.addListener(SWT.Verify, new Listener() { boolean ignore; public void handleEvent(Event e) { if (ignore) return; e.doit = false; StringBuffer buffer = new StringBuffer(e.text); char[] chars = new char[buffer.length()]; buffer.getChars(0, chars.length, chars, 0); if (e.character == '\b') { for (int i = e.start; i < e.end; i++) { switch (i) { case 0: /* [x]xxx-xx */ case 1: /* x[x]xx-xx */ case 2: /* xx[x]x-xx */ case 3: /* xxx[x]-xx */ case 5: /* xxxx-[x]x */ case 6: /* xxxx-x[x] */ { buffer.append(' '); break; } case 4: /* xxxx[-]xx */ { buffer.append('-'); break; } default: return; } } textBox.setSelection(e.start, e.start + buffer.length()); ignore = true; textBox.insert(buffer.toString()); ignore = false; textBox.setSelection(e.start, e.start); return; } int start = e.start; if (start > 6) return; int index = 0; for (int i = 0; i < chars.length; i++) { if (start + index == 4) { if (chars[i] == '-') { index++; continue; } buffer.insert(index++, '-'); } if (chars[i] < '0' || '9' < chars[i]) return; index++; } String newText = buffer.toString(); int length = newText.length(); textBox.setSelection(e.start, e.start + length); ignore = true; textBox.insert(newText); ignore = false; /* * After a valid key press, verifying if the input is completed * and passing the cursor to the next text box. */ if (7 == textBox.getCaretPosition()) { /* * Attempting to change the text after receiving a known valid input that has no results (0000-00). */ if ("0000-00".equals(textBox.getText())) { // "0000-00" is the special "Erase Me" code for these text boxes. ignore = true; textBox.setText(" - "); ignore = false; } // Changing focus to a different textBox by using "setFocus()" method. differentTextBox.setFocus(); } } } ); As you can see, the only method I've figured out to clear this text widget from a different point in the code is by assigning "0000-00" textBox.setText("000000") and checking for that input in the listener. When that input is received, the listener changes the text back to " - " (four spaces, a hyphen, then two spaces). There is also a focusLost Listener that parses this text widget for spaces, then in order to avoid unnecessary SQL queries, it clears/resets all fields if the input is invalid (i.e contains spaces). // Adding focus listener to textBox to wait for loss of focus to perform SQL statement. textBox.addFocusListener(new FocusAdapter() { @Override public void focusLost(FocusEvent evt) { // Get the contents of otherTextBox and textBox. (otherTextBox must be <= textBox) String boxFour = otherTextBox.getText(); String boxFive = textBox.getText(); // If either text box has spaces in it, don't perform the search. if (boxFour.contains(" ") || boxFive.contains(" ")) { // Don't perform SQL statements. Debug statement. System.out.println("Tray Position input contains spaces. Ignoring."); //Make all previous results invisible, if any. labels.setVisible(false); differentTextBox.setText(""); labelResults.setVisible(false); } else { //... Perform SQL statement ... } } } ); OK. Often, I use SWT MessageBox widgets in this code to communicate to the user, or wish to change the text widgets back to an empty state after verifying the input. The problem is that messageboxes seem to create a focusLost event, and using the .setText(string) method is subject to SWT.Verify listeners that are present on the text widget. Any suggestions as to selectively ignoring these listeners in code, but keeping them present for all other user input? Thank you in advance for your assistance.

    Read the article

  • Can't get my head around background workers in .NET

    - by Connel
    I have wrote an application that syncs two folders together. The problem with the program is that it stops responding whilst copying files. A quick search of stack-overflow told me I need to use something called a background worker. I have read a few pages on the net about this but find it really hard to understand as I'm pretty new to programming. Below is the code for my application - how can I simply put all of the File.Copy(....) commands into their own background worker (if that's even how it works)? Below is the code for the button click event that runs the sub procedure and the sub procedure I wish to use a background worker on all the File.Copy lines. Button event: protected virtual void OnBtnSyncClicked (object sender, System.EventArgs e) { //sets running boolean to true booRunning=true; //sets progress bar to 0 prgProgressBar.Fraction = 0; //resets values used by progressbar dblCurrentStatus = 0; dblFolderSize = 0; //tests if user has entered the same folder for both target and destination if (fchDestination.CurrentFolder == fchTarget.CurrentFolder) { //creates message box MessageDialog msdSame = new MessageDialog(this, DialogFlags.Modal, MessageType.Error, ButtonsType.Close, "You cannot sync two folders that are the same"); //sets message box title msdSame.Title="Error"; //sets respone type ResponseType response = (ResponseType) msdSame.Run(); //if user clicks on close button or closes window then close message box if (response == ResponseType.Close || response == ResponseType.DeleteEvent) { msdSame.Destroy(); } return; } //tests if user has entered a target folder that is an extension of the destination folder // or if user has entered a desatination folder that is an extension of the target folder if (fchTarget.CurrentFolder.StartsWith(fchDestination.CurrentFolder) || fchDestination.CurrentFolder.StartsWith(fchTarget.CurrentFolder)) { //creates message box MessageDialog msdContains = new MessageDialog(this, DialogFlags.Modal, MessageType.Error, ButtonsType.Close, "You cannot sync a folder with one of its parent folders"); //sets message box title msdContains.Title="Error"; //sets respone type and runs message box ResponseType response = (ResponseType) msdContains.Run(); //if user clicks on close button or closes window then close message box if (response == ResponseType.Close || response == ResponseType.DeleteEvent) { msdContains.Destroy(); } return; } //gets folder size of target folder FileSizeOfTarget(fchTarget.CurrentFolder); //gets folder size of destination folder FileSizeOfDestination(fchDestination.CurrentFolder); //runs SyncTarget procedure SyncTarget(fchTarget.CurrentFolder); //runs SyncDestination procedure SyncDestination(fchDestination.CurrentFolder); //informs user process is complete prgProgressBar.Text = "Finished"; //sets running bool to false booRunning = false; } Sync sub-procedure: protected void SyncTarget (string strCurrentDirectory) { //string array of all the directories in directory string[] staAllDirectories = Directory.GetDirectories(strCurrentDirectory); //string array of all the files in directory string[] staAllFiles = Directory.GetFiles(strCurrentDirectory); //loop over each file in directory foreach (string strFile in staAllFiles) { //string of just the file's name and not its path string strFileName = System.IO.Path.GetFileName(strFile); //string containing directory in target folder string strDirectoryInsideTarget = System.IO.Path.GetDirectoryName(strFile).Substring(fchTarget.CurrentFolder.Length); //inform user as to what file is being copied prgProgressBar.Text="Syncing " + strFile; //tests if file does not exist in destination folder if (!File.Exists(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName)) { //if file does not exist copy it to destination folder, the true below means overwrite if file already exists File.Copy (strFile, fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName, true); } //tests if file does exist in destination folder if (File.Exists(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName)) { //long (number) that contains date of last write time of target file long lngTargetFileDate = File.GetLastWriteTime(strFile).ToFileTime(); //long (number) that contains date of last write time of destination file long lngDestinationFileDate = File.GetLastWriteTime(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName).ToFileTime(); //tests if target file is newer than destination file if (lngTargetFileDate > lngDestinationFileDate) { //if it is newer then copy file from target folder to destination folder File.Copy (strFile, fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName, true); } } //gets current file size FileInfo FileSize = new FileInfo(strFile); //sets file's filesize to dblCurrentStatus and adds it to current total of files dblCurrentStatus = dblCurrentStatus + FileSize.Length; double dblPercentage = dblCurrentStatus/dblFolderSize; prgProgressBar.Fraction = dblPercentage; } //loop over each folder in target folder foreach (string strDirectory in staAllDirectories) { //string containing directories inside target folder but not any higher directories string strDirectoryInsideTarget = strDirectory.Substring(fchTarget.CurrentFolder.Length); //tests if directory does not exist inside destination folder if (!Directory.Exists(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget)) { //it directory does not exisit create it Directory.CreateDirectory(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget); } //run sync on all files in directory SyncTarget(strDirectory); } } Any help will be greatly appreciated as after this the program will pretty much be finished :D

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Completing install of ruby 1.9.3 with Ruby for for Mac OS X 10.7.5 Leopard, Xcode 4.5.2 -- problems with rvm pkg install openssl

    - by user1848361
    First, many thanks in advance for any help. I'm a complete novice with programming and I'm trying to get started with this Ruby on Rails tutorial (http://ruby.railstutorial.org/ruby-on-rails-tutorial-book?version=3.2) I have been trying figure this out for about 7 hours now and since I don't have any hair left to pull out I'm turning to these hallowed pages. I have searched for solutions here again and again. System: Mac OS X 10.7.5 Leopard, Xcode 4.5.2 I installed homebrew and have updated it multiple times I used homebrew to install rvm and have updated it multiple times I installed git The standard ruby on the system (checking with $ ruby -v) is 1.8.7 My problem is that every time I try to use rvm to install a new version of Ruby ($ rvm install 1.9.3) I get the following error: Ruby (and needed base gems) for your selection will be installed shortly. Before it happens, please read and execute the instructions below. Please use a separate terminal to execute any additional commands. Notes for Mac OS X 10.7.5, Xcode 4.5.2. For JRuby: Install the JDK. See http://developer.apple.com/java/download/ # Current Java version "1.6.0_26" For IronRuby: Install Mono >= 2.6 For Ruby 1.9.3: Install libksba # If using Homebrew, 'brew install libksba' For Opal: Install Nodejs with NPM. See http://nodejs.org/download/ To use an RVM installed Ruby as default, instead of the system ruby: rvm install 1.8.7 # installs patch 357: closest supported version rvm system ; rvm gemset export system.gems ; rvm 1.8.7 ; rvm gemset import system.gems # migrate your gems rvm alias create default 1.8.7 And reopen your terminal windows. Xcode and gcc: : I have performed $ brew install libksba and when I try to do it again it tells me that libksba is installed already. When I type "$ rvm requirements" I get: Notes for Mac OS X 10.7.5, Xcode 4.5.2. For JRuby: Install the JDK. See http://developer.apple.com/java/download/ # Current Java version "1.6.0_26" For IronRuby: Install Mono >= 2.6 For Ruby 1.9.3: Install libksba # If using Homebrew, 'brew install libksba' For Opal: Install Nodejs with NPM. See http://nodejs.org/download/ To use an RVM installed Ruby as default, instead of the system ruby: rvm install 1.8.7 # installs patch 357: closest supported version rvm system ; rvm gemset export system.gems ; rvm 1.8.7 ; rvm gemset import system.gems # migrate your gems rvm alias create default 1.8.7 And reopen your terminal windows. Xcode and gcc: Right now Ruby requires gcc to compile, but Xcode 4.2 and later no longer ship with gcc. Instead they ship with llvm-gcc (to which gcc is a symlink) and clang, neither of which are supported for building Ruby. Xcode 4.1 was the last version to ship gcc, which was /usr/bin/gcc-4.2. Xcode 4.1 and earlier: - Ruby will build fine. Xcode 4.2 and later (including Command Line Tools for Xcode): - If you have gcc-4.2 (and friends) from an earlier Xcode version, Ruby will build fine. - If you don't have gcc-4.2, you have two options to get it: * Install apple-gcc42 from Homebrew * Install osx-gcc-installer Homebrew: If you are using Homebrew, you can install the apple-gcc42 and required libraries from homebrew/dupes: brew update brew tap homebrew/dupes brew install autoconf automake apple-gcc42 rvm pkg install openssl Xcode 4.2+ install or/and Command Line Tools for Xcode is required to provide make and other tools. osx-gcc-installer: If you don't use Homebrew, you can download and install osx-gcc-installer: https://github.com/kennethreitz/osx-gcc-installer. Warning: Installing osx-gcc-installer on top of a recent Xcode is known to cause problems, so you must uninstall Xcode before installing osx-gcc-installer. Afterwards you may install Xcode 4.2+ or Command Line Tools for Xcode if you desire. ** NOTE: Currently, Node.js is having issues building with osx-gcc-installer. The only fix is to install Xcode over osx-gcc-installer. So I assume I have to do something with brew update brew tap homebrew/dupes brew install autoconf automake apple-gcc42 rvm pkg install openssl Everything seemed to work fine until "$ rvm pkg install openssl", which returns: Fetching openssl-1.0.1c.tar.gz to /Users/thierinvestmentservices/.rvm/archives Extracting openssl to /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c Configuring openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Compiling openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Error running 'make', please read /Users/thierinvestmentservices/.rvm/log/openssl/make.log Please note that it's required to reinstall all rubies: rvm reinstall all --force Updating openssl certificates Error running 'update_openssl_certs', please read /Users/thierinvestmentservices/.rvm/log/openssl.certs.log Johns-MacBook-Pro:~ thierinvestmentservices$ rvm pkg install openssl Fetching openssl-1.0.1c.tar.gz to /Users/thierinvestmentservices/.rvm/archives Extracting openssl to /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c Configuring openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Compiling openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Error running 'make', please read /Users/thierinvestmentservices/.rvm/log/openssl/make.log Please note that it's required to reinstall all rubies: rvm reinstall all --force Updating openssl certificates Error running 'update_openssl_certs', please read /Users/thierinvestmentservices/.rvm/log/openssl.certs.log make.log reads "[2012-11-23 13:15:28] make /Users/thierinvestmentservices/.rvm/scripts/functions/utility: line 116: make: command not found" and openssl.certs.log reads "[2012-11-23 14:04:04] update_openssl_certs update_openssl_certs () { ( chpwd_functions="" builtin cd $rvm_usr_path/ssl && command curl -O http://curl.haxx.se/ca/cacert.pem && mv cacert.pem cert.pem ) } current path: /Users/thierinvestmentservices command(1): update_openssl_certs /Users/thierinvestmentservices/.rvm/scripts/functions/pkg: line 205: cd: /Users/thierinvestmentservices/.rvm/usr/ssl: No such file or directory" At this point the letters might as well be wingdings I have no idea what is going on. I have tried to install rvm make with something I saw on one forum post but I got a bunch of warnings. If anyone has any suggestions I would be deeply grateful, I am completely in over my head,

    Read the article

  • C -Segmentation fault !

    - by FILIaS
    It seems at least weird to me... The program runs normally.But after I call the enter() function for the 4th time,there is a segmentation fault!I would appreciate any help. With the following function enter() I wanna add user commands' datas to a list. [Some part of the code is already posted on another question of me, but I think I should post it again...as it's a different problem I'm facing now.] /* struct for all the datas that user enters on file*/ typedef struct catalog { char short_name[50]; char surname[50]; signed int amount; char description[1000]; struct catalog *next; }catalog,*catalogPointer; catalogPointer current; catalogPointer head = NULL; void enter(void) //user command: i <name> <surname> <amount> <description> { int n,j=2,k=0; char temp[1500]; char *short_name,*surname,*description; signed int amount; char* params = strchr(command,' ') + 1; //strchr returns a pointer to the 1st space on the command.U want a pointer to the char right after that space. strcpy(temp, params); //params is saved as temp. char *curToken = strtok(temp," "); //strtok cuts 'temp' into strings between the spaces and saves them to 'curToken' printf("temp is:%s \n",temp); printf("\nWhat you entered for saving:\n"); for (n = 0; curToken; ++n) //until curToken ends: { if (curToken) { short_name = malloc(strlen(curToken) + 1); strncpy(short_name, curToken, sizeof (short_name)); } printf("Short Name: %s \n",short_name); curToken = strtok(NULL," "); if (curToken) { surname = malloc(strlen(curToken) + 1); strncpy(surname, curToken,sizeof (surname)); } printf("SurName: %s \n",surname); curToken = strtok(NULL," "); if (curToken) { //int * amount= malloc(sizeof (signed int *)); char *chk; amount = (int) strtol(curToken, &chk, 10); if (!isspace(*chk) && *chk != 0) fprintf(stderr,"Warning: expected integer value for amount, received %s instead\n",curToken); } printf("Amount: %d \n",amount); curToken = strtok(NULL,"\0"); if (curToken) { description = malloc(strlen(curToken) + 1); strncpy(description, curToken, sizeof (description)); } printf("Description: %s \n",description); break; } if (findEntryExists(head, surname,short_name) != NULL) //call function in order to see if entry exists already on the catalog printf("\nAn entry for <%s %s> is already in the catalog!\nNew entry not entered.\n",short_name,surname); else { printf("\nTry to entry <%s %s %d %s> in the catalog list!\n",short_name,surname,amount,description); newEntry(&head,short_name,surname,amount,description); printf("\n**Entry done!**\n"); } // Maintain the list in alphabetical order by surname. } catalogPointer findEntryExists (catalogPointer head, char num[],char first[]) { catalogPointer p = head; while (p != NULL && strcmp(p->surname, num) != 0 && strcmp(p->short_name,first) != 0) { p = p->next; } return p; } catalogPointer newEntry (catalog** headRef,char short_name[], char surname[], signed int amount, char description[]) { catalogPointer newNode = (catalogPointer)malloc(sizeof(catalog)); catalogPointer first; catalogPointer second; catalogPointer tmp; first=head; second=NULL; strcpy(newNode->short_name, short_name); strcpy(newNode->surname, surname); newNode->amount=amount; strcpy(newNode->description, description); while (first!=NULL) { if (strcmp(surname,first->surname)>0) second=first; else if (strcmp(surname,first->surname)==0) { if (strcmp(short_name,first->short_name)>0) second=first; } first=first->next; } if (second==NULL) { newNode->next=head; head=newNode; } else //SEGMENTATION APPEARS WHEN IT GETS HERE! { tmp=second->next; newNode->next=tmp; first->next=newNode; } } UPDATE: SegFault appears only when it gets on the 'else' loop of InsertSort() function. I observed that segmentation fault appears when i try to put on the list names that are after it. For example, if in the list exists: [Name:b Surname:b Amount:6 Description:b] [Name:c Surname:c Amount:5 Description:c] [Name:d Surname:d Amount:4 Description:d] [Name:e Surname:e Amount:3 Description:e] [Name:g Surname:g Amount:2 Description:g] [Name:x Surname:x Amount:1 Description:x] and i put: " x z 77 gege" there is a segmentation but if i put "x a 77 gege" it continues normally....

    Read the article

  • Why wont this entire word doc file generate from my php script?

    - by CheeseConQueso
    Here's the php script I'm using on a linux environment: <?php include("../_inc/odbcw.php"); //connect string $cat = $_GET["cat"]; if($_GET["st"]){$crs_query = "select crs_no, title, credits, abstr, prereq, coreq, lab_fee from xxx where active = 'Y' and cat = '".$cat."' and spec_top = 'Y' and prog='UNDG' order by crs_no";} else {$crs_query = "select crs_no, title, credits, abstr, prereq, coreq, lab_fee from xxx where active = 'Y' and cat = '".$cat."' and prog='UNDG' order by crs_no";} $crs_result = @mysql_query($crs_query); header("Content-type: application/vnd.ms-word"); header("Content-Disposition: attachment;Filename=cat.doc"); echo "<html>"; echo "<meta http-equiv=\"Content-Type\" content=\"text/html; charset=Windows-1252\">"; echo "<body>"; echo '<table border=0 width = 700>'; if($_GET["st"]){echo '<tr><td><font face=arial size=2><center>CATALOGUE<br>COURSE DESCRIPTIONS - '.$cat.'<br>SPECIAL TOPICS</center></font></td></tr>';} else {echo '<tr><td><font face=arial size=2><center>CATALOGUE<br>COURSE DESCRIPTIONS - '.$cat.'</center></font></td></tr>';} echo '</table>'; echo '<hr width=700>'; while($row = mysql_fetch_array($crs_result)) { $crs_no = $row['crs_no']; $title = $row['title']; $credits = $row['credits']; $abstr = $row['abstr']; $prereq = $row['prereq']; $coreq = $row['coreq']; $lab_fee = $row['lab_fee']; $rowspan = 2; if($prereq) {$rowspan++;} if($coreq) {$rowspan++;} if($lab_fee=="Y") {$rowspan++;} echo "<table border=0 width = 700>"; echo "<tr>"; echo "<td rowspan=".$rowspan." valign=top width=100><font face=arial size=2>".$crs_no."</font></td>"; echo "<td valign=top><font face=arial size=2><u>".$title."</u></font></td> <td valign=top align=right><font face=arial size=2>".$credits."</font></td>"; echo "</tr>"; echo "<tr>"; echo "<td colspan=2 valign=top align=justify><font face=arial size=2>".$abstr."</font></td>"; echo "</tr>"; if($prereq) { echo "<tr>"; echo "<td colspan=2 valign=top><font face=arial size=2>Prerequisite: ".$prereq."</font></td>"; echo "</tr>"; } if($coreq) { echo "<tr>"; echo "<td colspan=2 valign=top><font face=arial size=2>Coerequisite: ".$coreq."</font></td>"; echo "</tr>"; } if($lab_fee=="Y") { echo "<tr>"; echo "<td colspan=2 valign=top><font face=arial size=2>Lab Fee Required</font></td>"; echo "</tr>"; } echo "</table>"; echo "<br>"; } echo "</body>"; echo "</html>"; ?> Everything works fine before the inclusion of: header("Content-type: application/vnd.ms-word"); header("Content-Disposition: attachment;Filename=cat.doc"); echo "<html>"; echo "<meta http-equiv=\"Content-Type\" content=\"text/html; charset=Windows-1252\">"; echo "<body>"; These lines successfully bring up the dialogue box to open or save cat.doc, but after I open it, the only lines printed are: CATALOGUE COURSE DESCRIPTIONS - and the <HR> beneath this echoed text. It seems to go on lunch break for the while loop echoing section. Any ideas?

    Read the article

  • Why is insertion into my tree faster on sorted input than random input?

    - by Juliet
    Now I've always heard binary search trees are faster to build from randomly selected data than ordered data, simply because ordered data requires explicit rebalancing to keep the tree height at a minimum. Recently I implemented an immutable treap, a special kind of binary search tree which uses randomization to keep itself relatively balanced. In contrast to what I expected, I found I can consistently build a treap about 2x faster and generally better balanced from ordered data than unordered data -- and I have no idea why. Here's my treap implementation: http://pastebin.com/VAfSJRwZ And here's a test program: using System; using System.Collections.Generic; using System.Linq; using System.Diagnostics; namespace ConsoleApplication1 { class Program { static Random rnd = new Random(); const int ITERATION_COUNT = 20; static void Main(string[] args) { List<double> rndTimes = new List<double>(); List<double> orderedTimes = new List<double>(); rndTimes.Add(TimeIt(50, RandomInsert)); rndTimes.Add(TimeIt(100, RandomInsert)); rndTimes.Add(TimeIt(200, RandomInsert)); rndTimes.Add(TimeIt(400, RandomInsert)); rndTimes.Add(TimeIt(800, RandomInsert)); rndTimes.Add(TimeIt(1000, RandomInsert)); rndTimes.Add(TimeIt(2000, RandomInsert)); rndTimes.Add(TimeIt(4000, RandomInsert)); rndTimes.Add(TimeIt(8000, RandomInsert)); rndTimes.Add(TimeIt(16000, RandomInsert)); rndTimes.Add(TimeIt(32000, RandomInsert)); rndTimes.Add(TimeIt(64000, RandomInsert)); rndTimes.Add(TimeIt(128000, RandomInsert)); string rndTimesAsString = string.Join("\n", rndTimes.Select(x => x.ToString()).ToArray()); orderedTimes.Add(TimeIt(50, OrderedInsert)); orderedTimes.Add(TimeIt(100, OrderedInsert)); orderedTimes.Add(TimeIt(200, OrderedInsert)); orderedTimes.Add(TimeIt(400, OrderedInsert)); orderedTimes.Add(TimeIt(800, OrderedInsert)); orderedTimes.Add(TimeIt(1000, OrderedInsert)); orderedTimes.Add(TimeIt(2000, OrderedInsert)); orderedTimes.Add(TimeIt(4000, OrderedInsert)); orderedTimes.Add(TimeIt(8000, OrderedInsert)); orderedTimes.Add(TimeIt(16000, OrderedInsert)); orderedTimes.Add(TimeIt(32000, OrderedInsert)); orderedTimes.Add(TimeIt(64000, OrderedInsert)); orderedTimes.Add(TimeIt(128000, OrderedInsert)); string orderedTimesAsString = string.Join("\n", orderedTimes.Select(x => x.ToString()).ToArray()); Console.WriteLine("Done"); } static double TimeIt(int insertCount, Action<int> f) { Console.WriteLine("TimeIt({0}, {1})", insertCount, f.Method.Name); List<double> times = new List<double>(); for (int i = 0; i < ITERATION_COUNT; i++) { Stopwatch sw = Stopwatch.StartNew(); f(insertCount); sw.Stop(); times.Add(sw.Elapsed.TotalMilliseconds); } return times.Average(); } static void RandomInsert(int insertCount) { Treap<double> tree = new Treap<double>((x, y) => x.CompareTo(y)); for (int i = 0; i < insertCount; i++) { tree = tree.Insert(rnd.NextDouble()); } } static void OrderedInsert(int insertCount) { Treap<double> tree = new Treap<double>((x, y) => x.CompareTo(y)); for(int i = 0; i < insertCount; i++) { tree = tree.Insert(i + rnd.NextDouble()); } } } } And here's a chart comparing random and ordered insertion times in milliseconds: Insertions Random Ordered RandomTime / OrderedTime 50 1.031665 0.261585 3.94 100 0.544345 1.377155 0.4 200 1.268320 0.734570 1.73 400 2.765555 1.639150 1.69 800 6.089700 3.558350 1.71 1000 7.855150 4.704190 1.67 2000 17.852000 12.554065 1.42 4000 40.157340 22.474445 1.79 8000 88.375430 48.364265 1.83 16000 197.524000 109.082200 1.81 32000 459.277050 238.154405 1.93 64000 1055.508875 512.020310 2.06 128000 2481.694230 1107.980425 2.24 I don't see anything in the code which makes ordered input asymptotically faster than unordered input, so I'm at a loss to explain the difference. Why is it so much faster to build a treap from ordered input than random input?

    Read the article

< Previous Page | 389 390 391 392 393 394 395 396 397 398 399  | Next Page >