Search Results

Search found 14644 results on 586 pages for 'auto generate'.

Page 396/586 | < Previous Page | 392 393 394 395 396 397 398 399 400 401 402 403  | Next Page >

• Generating unobtrusive JS

  - by nico

  I have read quite a bit about unobtrusive JS and how to generate it and all that jazz... My problem is this: I have a website that heavily relies on mod_rewrite, so essentially all the pages requests are sent to index.php that generates the main structure of the page and then includes the appropriate page. Now, there are different sections in the site and each section uses different Javascript functions (e.g. for different AJAX requests). Now, if I just were to attach a function to the onload of the page obviously the thing would not work, as I do not have to initialise the same things for each page... so what is the best way to handle this situation? I hope the situation is clear, I'll be happy to clarify if needed

  Read the article

• Rails route, show all elements on the same page

  - by Igor Oliveira Antonio

  I need to show all my elements on the same page. In routes: namespace :nourishment do resources :diets do resources :nourishment_meals, :controller => 'meals' get 'nourishment_meals/show_all_meals' => 'meals#show_all_meals', as: "show_all_meals" end end which will generate: nourishment_diet_nourishment_meals_path GET /nourishment/diets/:diet_id/nourishment_meals(.:format) nourishment/meals#index POST /nourishment/diets/:diet_id/nourishment_meals(.:format) nourishment/meals#create new_nourishment_diet_nourishment_meal_path GET /nourishment/diets/:diet_id/nourishment_meals/new(.:format) nourishment/meals#new edit_nourishment_diet_nourishment_meal_path GET /nourishment/diets/:diet_id/nourishment_meals/:id/edit(.:format) nourishment/meals#edit nourishment_diet_nourishment_meal_path GET /nourishment/diets/:diet_id/nourishment_meals/:id(.:format) nourishment/meals#show PATCH /nourishment/diets/:diet_id/nourishment_meals/:id(.:format) nourishment/meals#update PUT /nourishment/diets/:diet_id/nourishment_meals/:id(.:format) nourishment/meals#update DELETE /nourishment/diets/:diet_id/nourishment_meals/:id(.:format) nourishment/meals#destroy [**THIS**] nourishment_diet_show_all_meals_path GET /nourishment/diets/:diet_id/nourishment_meals/show_all_meals(.:format) nourishment/meals#show_all_meals The problem, when I do this: <%= link_to "Show all meals", nourishment_diet_show_all_meals_path, :class=>"button green" %> This error raise: Problem: Document(s) not found for class NourishmentMeal with id(s) show_all. Summary: When calling NourishmentMeal.find with an id or array of ids, each parameter must match a document Can someone help me?

  Read the article

• Is there a standard practice for synchronizing SQL Server tables?

  - by EngineeringAutomation

  I've written an application that retrieves pricing and part options from a SQL database to generate a 3D Model of the product and create a sales proposal. My client likes it so much they want to be able to use it on laptops in the field now. The catch is, they won't have an internet connection. I'm considering setting up a SQLite database as part of the standard installation. The SQLite database on each laptop will synchronize with the main database when the internet connection is re-established. Are there best practices regarding synchronizing SQL tables like this? Are there any pitfalls I should consider? I'm open to all options. Thank you.

  Read the article

• How do I get the PreviewDialog of Apache FOP to actually display my document?

  - by JRSofty

  Search as I may I have not found a solution to my problem here and I'm hoping the combined minds of StackOverflow will push me in the right direction. My problem is as follows, I'm developing a print and print preview portion of a messaging system's user agent. I was given specific XSLT templates that after transforming XML will produce a Formatting Objects document. With Apache FOP I've been able to render the FO document into PDF which is all fine and good, but I would also like to display it in a print preview dialog. Apache FOP contains such a class called PreviewDialog which requires in its constructor a FOUserAgent, which I can generate, and an object implementing the Renderable Interface. The Renderable Interface has one implementing class in the FOP package which is called InputHandler which takes in its constructor a standard io File object. Now here is where the trouble begins. I'm currently storing the FO document as a temp file and pass this as a File object to an InputHandler instance which is then passed to the PreviewDialog. I see the dialog appear on my screen and along the bottom in a status bar it says that it is generating the document, and that is all it does. Here is the code I'm trying to use. It isn't production code so it's not pretty: import java.io.BufferedOutputStream; import java.io.File; import java.io.FileNotFoundException; import java.io.FileOutputStream; import java.io.IOException; import java.io.OutputStream; import java.util.Random; import javax.xml.transform.Result; import javax.xml.transform.Source; import javax.xml.transform.Transformer; import javax.xml.transform.TransformerConfigurationException; import javax.xml.transform.TransformerException; import javax.xml.transform.TransformerFactory; import javax.xml.transform.sax.SAXResult; import javax.xml.transform.stream.StreamResult; import javax.xml.transform.stream.StreamSource; import org.apache.fop.apps.FOPException; import org.apache.fop.apps.FOUserAgent; import org.apache.fop.apps.Fop; import org.apache.fop.apps.FopFactory; import org.apache.fop.cli.InputHandler; import org.apache.fop.render.awt.viewer.PreviewDialog; public class PrintPreview { public void showPreview(final File xslt, final File xmlSource) { boolean err = false; OutputStream out = null; Transformer transformer = null; final String tempFileName = this.getTempDir() + this.generateTempFileName(); final String tempFoFile = tempFileName + ".fo"; final String tempPdfFile = tempFileName + ".pdf"; System.out.println(tempFileName); final TransformerFactory transformFactory = TransformerFactory .newInstance(); final FopFactory fopFactory = FopFactory.newInstance(); try { transformer = transformFactory .newTransformer(new StreamSource(xslt)); final Source src = new StreamSource(xmlSource); out = new FileOutputStream(tempFoFile); final Result res = new StreamResult(out); transformer.transform(src, res); System.out.println("XSLT Transform Completed"); } catch (final TransformerConfigurationException e) { err = true; e.printStackTrace(); } catch (final FileNotFoundException e) { err = true; e.printStackTrace(); } catch (final TransformerException e) { err = true; e.printStackTrace(); } finally { if (out != null) { try { out.close(); } catch (final IOException e) { // TODO Auto-generated catch block e.printStackTrace(); } } } System.out.println("Initializing Preview"); transformer = null; out = null; final File fo = new File(tempFoFile); final File pdf = new File(tempPdfFile); if (!err) { final FOUserAgent ua = fopFactory.newFOUserAgent(); try { transformer = transformFactory.newTransformer(); out = new FileOutputStream(pdf); out = new BufferedOutputStream(out); final Fop fop = fopFactory.newFop( MimeConstants.MIME_PDF, ua, out); final Source foSrc = new StreamSource(fo); final Result foRes = new SAXResult(fop.getDefaultHandler()); transformer.transform(foSrc, foRes); System.out.println("Transformation Complete"); } catch (final FOPException e) { err = true; e.printStackTrace(); } catch (final FileNotFoundException e) { err = true; e.printStackTrace(); } catch (final TransformerException e) { err = true; e.printStackTrace(); } finally { if (out != null) { try { out.close(); } catch (final IOException e) { // TODO Auto-generated catch block e.printStackTrace(); } } } if (!err) { System.out.println("Attempting to Preview"); final InputHandler inputHandler = new InputHandler(fo); PreviewDialog.createPreviewDialog(ua, inputHandler, true); } } // perform the clean up // f.delete(); } private String getTempDir() { final String p = "java.io.tmpdir"; return System.getProperty(p); } private String generateTempFileName() { final String charset = "abcdefghijklmnopqrstuvwxyz1234567890abcdefghijklmnopqrstuvwxyz1234567890"; final StringBuffer sb = new StringBuffer(); Random r = new Random(); int seed = r.nextInt(); r = new Random(seed); for (int i = 0; i < 8; i++) { final int n = r.nextInt(71); seed = r.nextInt(); sb.append(charset.charAt(n)); r = new Random(seed); } return sb.toString(); } } Any help on this would be appreciated.

  Read the article

• Entity Framework: Data Centric vs. Object Centric

  - by Eric J.

  I'm having a look at Entity Framework and everything I'm reading takes a data centric approach to explaining EF. By that I mean that the fundamental relationships of the system are first defined in the database and objects are generated that reflect those relationships. Examples Quickstart (Entity Framework) Using Entity Framework entities as business objects? The EF documentation implies that it's not necessary to start from the database layer, e.g. Developers can work with a consistent application object model that can be mapped to various storage schemas When designing a new system (simplified version), I tend to first create a class model, then generate business objects from the model, code business layer stuff that can't be generated, and then worry about persistence (or rather work with a DBA and let him worry about the most efficient persistence strategy). That object centric approach is well supported by ORM technologies such as (n)Hibernate. Is there a reasonable path to an object centric approach with EF? Will I be swimming upstream going that route? Any good starting points?

  Read the article

• xsl with javascript

  - by Vignesh

  I've a file with xml data. And I want to generate a report out of it. I tried to integrate xsl with java script, but can I get a handle of individual data elements in xsl and pass it on to a java script function. Lets say <value>true</value> is in the xml and I want to pass it on to a javascript function while doing something like this in xsl. <xsl:for-each select="/valgroup"> <xsl:value-of select="value"/> </xsl:for-each> The alternative is to parse the xml in java script and get the values, I've got little idea of how to integrate it with xsl. Are there any java script libraries. I've seen my libraries that run on servers(AJAXSLT), but I need something that runs locally. I'm a new to xslt, so consider this a worthy question.

  Read the article

• how to run javascript from c# code ?

  - by dotnetcoder

  I have a webrequest that returns a html response which has form inside with hidden fields with some javascript that submits the form automatically on pageload ( if this was run in a browser). If I save this file as *.html and run this file in browser , the java script code automatically posts the form and the output is excel file. I want to be able to generate this file from a c# code which is not running in broswer. I tried mocking thr form post but its complicated and has various scenarios based on the original webrequest querystring. any pointers.... i know its not possible to probably run JS code that posts the form - from within c# code but still thought of chekcing if someone has done that.

  Read the article

• How to delete data in DB efficiently using LinQ to NHibernate (one-shot-delete)

  - by kastanf

  Hello, producing software for customers, mostly using MS SQL but some Oracle, a decision was made to plunge into Nhibernate (and C#). The task is to delete efficiently e.g. 10 000 rows from 100 000 and still stay sticked to ORM. I've tried named queries - link already, IQuery sql = s.GetNamedQuery("native-delete-car").SetString(0, "Kirsten"); sql.ExecuteUpdate(); but the best I have ever found seems to be: using (ITransaction tx = _session.BeginTransaction()) { try { string cmd = "delete from Customer where Id < GetSomeId()"; var count = _session.CreateSQLQuery(cmd).ExecuteUpdate(); ... Since it may not get into dB to get all complete rows before deleting them. My questions are: If there is a better way for this kind of delete. If there is a possibility to get the Where condition for Delete like this: Having a select statement (using LinQ to NHibernate) = which will generate appropriate SQL for DB = we get that Where condition and use it for Delete. Thanks :-)

  Read the article

• Consuming an RPC/encoded Web Service in .NET

  - by Timmy O' Tool

  I'm trying to build the proxy class for a web service using the wsdl Executing this command: wsdl [http://WSDL_URL] I'm getting Warning: This web reference does not conform to WS-I Basic Profile v1.1. R2706: A wsdl:binding in a DESCRIPTION MUST use the value of "literal" for the use attribute in all soapbind:body, soapbind:fault, soapbind:header and soapbind:headerfault elements. ... Error: Cannot find definition for http://schemas.xmlsoap.org/wsdl/:BouBinding. Service Description with namespace http://schemas.xmlsoap.org/wsdl/ is missing. Parameter name: name The author of the web service told me that the SOAP protocol is RPC/encoded. Is there is any way to generate a proxy class for this?

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• How to get the original variable name of variable passed to a function

  - by Acorn

  Is it possible to get the original variable name of a variable passed to a function? E.g. foobar = "foo" def func(var): print var.origname So that: func(foobar) Returns: >>foobar EDIT: All I was trying to do was make a function like: def log(soup): f = open(varname+'.html', 'w') print >>f, soup.prettify() f.close() .. and have the function generate the filename from the name of the variable passed to it. I suppose if it's not possible I'll just have to pass the variable and the variable's name as a string each time.

  Read the article

• Adding file of the same name into the same list and unable to update name of the SPFile

  - by BeraCim

  Hi all: I'm having difficulties adding file of the same name in the same list and subsequently updating/changing/modifying the name of a SPFile. Basically, this is what I'm trying to do: string fileName = "something"; // obtained from a loop -- loop omitted here. SPFile file = folder.Files.Add(fileName, otherFile.OpenBinary()); The Add method will generate a runtime exception when it finds another file of the same name in the same list/folder. So I thought of changing the file name later in the process: string newGuid = Guid.NewGuid().ToString(); SPFile file = folder.Files.Add(newGuid, otherFile.OpenBinary()); // some other processing... afterwards, rename the file file.name = fileName; file.Item.Update(); A few minute of googling indicated I need to either move the file around, or update the name field by using ["Name"] instead. I was wondering are there any other better ways to get around this problem? Thanks.

  Read the article

• Why doesn't GCC produce a warning when assigning a signed literal to an unsigned type?

  - by maerics

  Several questions on this website reveal pitfalls when mixing signed and unsigned types and most compilers seem to do a good job about generating warnings of this type. However, GCC doesn't seem to care when assigning a signed constant to an unsigned type! Consider the following program: /* foo.c */ #include <stdio.h> int main(void) { unsigned int x=20, y=-30; if (x > y) { printf("%d > %d\n", x, y); } else { printf("%d <= %d\n", x, y); } return 0; } Compilation with GCC 4.2.1 as below produces no output on the console: gcc -Werror -Wall -Wextra -pedantic foo.c -o foo The resulting executable generates the following output: $ ./foo 20 <= -30 Is there some reason that GCC doesn't generate any warning or error message when assigning the signed value -30 to the unsigned integer variable y?

  Read the article

• Ampersand in link description text?

  - by kitenski

  I am validating my site using validator.w3.org and have an issue where there is a & in my link description text. ie this is taken from the source <a class='tag' href='/php/iphone software.php?function=developer&amp;dev=witch%26wizards+inc.&amp;store=143441'>witch&wizards inc.</a> Which gives me this error in the validator Line 188, Column 540: cannot generate system identifier for general entity "wizards" …6wizards+inc.&store=143441'witch&wizards inc. If I urlencode the description then the validation passes, but the user then sees the text displayed urlencoded, ie Developer witch%26wizards+inc. However I believe it's much more user friendly if this was displayed unencoded, ie Developer witch&wizards inc. Is there a way to pass validation but still have user friendly text displayed? Thanks, Greg

  Read the article

• is there a such thing as a randomly accessible pseudo-random number generator? (preferably open-sour

  - by lucid

  first off, is there a such thing as a random access random number generator, where you could not only sequentially generate random numbers as we're all used to, assuming rand100() always generates a value from 0-100: for (int i=0;i<5;i++) print rand100() output: 14 75 36 22 67 but also randomly access any random value like: rand100(0) would output 14 as long as you didn't change the seed rand100(3) would always output 22 rand100(4) would always output 67 and so on... I've actually found an open-source generator algorithm that does this, but you cannot change the seed. I know that pseudorandomness is a complex field; I wouldn't know how to alter it to add that functionality. Is there a seedable random access random number generator, preferably open source? or is there a better term for this I can google for more information? if not, part 2 of my question would be, is there any reliably random open source conventional seedable pseudorandom number generator so I could port it to multiple platforms/languages while retaining a consistent sequence of values for each platform for any given seed?

  Read the article

• DTO and mapper generation from Domain Objects

  - by Nicolas

  I have plenty of java domain objects that I need to transform to DTOs. Please, don't start with the anti-pattern thing, the Domain Objects are what they are because of a long history, and I can't modify them (or not too much, see below). So, of course, we've passed the age of doing all that manually. I've looked around, and dozer seems the framework of choice for DTO mapping. But... what I'd really like is this: annotate classes and fields that I want in DTO, and run a tool that would generate the DTOs and the mappers. Does that sound too unreasonable? Does such a tool already exist?

  Read the article

• libnet that properly calculates checksum on IPV6

  - by VeaEm

  I have recently started playing around with libnet and using it to generate IPV6 packets. I am very new at programming, however, I am quite happy with the library. I have one problem with it though. It seems that libnet currently does not have the ability to properly calculate checksums on IPV6 packets. Being so new to programming, I am not yet capable of fixing this problem (although I am learning, so that one day I can). I am curious, has anyone run across a version of the library that can do this properly? Thanks!

  Read the article

• Using Thrift to connect to Cassandra from .NET

  - by vtortola

  Hi, I'm interested in Cassandra and I'd like to test it at home in my Windows XP computer. I've found instructions for install an run Cassandra in Windows, and it's already up and running; I've also found the thrift executable for Windows and generate the C# interfaces, but... when I try to compile that generated code in Visual Studio I got : "The type or namespace name 'Thrift' could not be found (are you missing a using directive or an assembly reference?)", so I'm missing something else, but I cannot find what... What is it? Is it a dll? I've looked in the thrift code and I cannot find anything related to .net , so what am I missing? Thanks in advance. Regards.

  Read the article

• Generating C++ BackTraces in OS/X (10.5.7)

  - by phillipwei

  I've been utilizing backtrace and backtrace_symbols to generate programmatic stack traces for the purposes of logging/diagnosis. It seems to roughly work, however, I'm getting a little bit of mangling and there are no accompanying file/line numbers associated with each function invocation (as I'd expect within a gdb bt call or something). Here's an example: 1 leonardo 0x00006989 _ZN9ExceptionC2E13ExceptionType + 111 2 leonardo 0x00006a20 _ZN9ExceptionC1E13ExceptionType + 24 3 leonardo 0x0000ab64 _ZN5Rules11ApplyActionER16ApplicableActionR9GameState + 1060 4 leonardo 0x0000ed15 _ZN9Simulator8SimulateEv + 2179 5 leonardo 0x0000eec9 _ZN9Simulator8SimulateEi + 37 6 leonardo 0x00009729 main + 45 7 leonardo 0x000025c6 start + 54 Anything I'm missing something, doing something silly, or is this all I can expect out of backtrace on OS/X? Some other tidbits: I don't see a rdynamic link option for the g++ version (4.0.1) I'm using. -g/-g3 doesn't make any difference. abi::__cxa__demangle doesn't seem to do anything

  Read the article

• iui transition moving in wrong direction

  - by Toddeman

  i am using iUI to build a native looking web app for iDevices. whenever i click a link with an href of #something that leads to another div on my page, the transition effect moves (correctly) as if the page were sliding in from the right like it does on any other iDevice app. a portion of my app requires an indefinite number of sub pages though, so i generate them on the fly, assign them and id, and set the window location to something like myip/mobile/#_newdiv. this causes the transition effect to move in the wrong direction though (as if the page were sliding in from the LEFT, opposite native iDevices). is there any way to fix this?

  Read the article

• C# SHA-1 vs. PHP SHA-1...Different Results?

  - by Arcdigital

  Hey, I am trying to calculate a SHA-1 Hash from a string, but when I calculate the string using php's sha1 function I get something different than when I try it in C#. I need C# to calculate the same string as PHP (since the string from php is calculated by a 3rd party that I cannot modify). How can I get C# to generate the same hash as PHP? Thanks!!! String = [email protected] C# Code (Generates d32954053ee93985f5c3ca2583145668bb7ade86) string encode = secretkey + email; UnicodeEncoding UE = new UnicodeEncoding(); byte[] HashValue, MessageBytes = UE.GetBytes(encode); SHA1Managed SHhash = new SHA1Managed(); string strHex = ""; HashValue = SHhash.ComputeHash(MessageBytes); foreach(byte b in HashValue) { strHex += String.Format("{0:x2}", b); } PHP Code (Generates a9410edeaf75222d7b576c1b23ca0a9af0dffa98) sha1();

  Read the article

• Encode URL while send ajax

  - by meotimdihia

  I use cakePHP and it generate ajax /animemanga/animes/search/page:1?type%5B0%5D=3&amp;genre%5B0%5D=20&amp;genre%5B1%5D=4&amp;info%5B0%5D=episodes&amp;info%5B1%5D=released&amp;info%5B2%5D=rating&amp;info%5B3%5D=synopsis&amp;info%5B4%5D=completed&amp;info%5B5%5D=rating_count&amp;info%5B6%5D=name&amp;info%5B7%5D=id&amp;info%5B8%5D=name&amp;info%5B9%5D=id cakePHP encoded: & = &apm; will create error while use with Ajax. I use Jquery, browser Opera. how can this solve ?

  Read the article

• Template metaprogram converting type to unique number

  - by daramarak

  I just started playing with metaprogramming and I am working on different tasks just to explore the domain. One of these was to generate a unique integer and map it to type, like below: int myInt = TypeInt<AClass>::value; I want to know if this is at all possible, and in that case how. Because although I have learned much about exploring this subject I still have failed to come up with an answer. (P.S. A yes/no answer is much more gratifying than a c++ solution that doesn't use metaprogramming, as this is the domain that I am exploring)

  Read the article

• How to design a class for managing file path ?

  - by remi bourgarel

  Hi All In my app, I generate some xml file for instance : "/xml/product/123.xml" where 123 is the product's id and 123.xml contains informations about this product. I also have "/xml/customer/123.xml" where 123.xml contains informations about the client ... 123 How can I manage these file paths : 1/ - I create the file path directly in the seralization method ? 2/ I create 2 static class : CustomerSerializationPathManager and ProductSerializationPathManager with 1 method : getPath(int customerID) and getPath(int productID) 3/ I create one static class : SerializationPathManager with 2 method : getCustomerPath(int customerID) and getProductPath(int productID) 4/ something else I'd prefer the solution 3 cause if I think there's only one reason to change this class : I change the root directory. So I'd like to have your thoughts about it... thx

  Read the article

• How to disable secret_token in Rails 3?

  - by Damian Nowak

  I have several separate Rails 2 applications which share the same cookie. I upgraded one the applications to Rails 3.2.15 now. Mandatory secret_token in Rails 3 makes it impossible to share the session with the Rails 2 apps. I am storing the session in Redis. What the visitor only gets in the cookie is a session ID. There's no need to encrypt it. Therefore, how to disable secret_token in Rails 3? A secret is required to generate an integrity hash for cookie session data. Use config.secret_token = "some secret phrase of at least 30 characters"in config/initializers/secret_token.rb

  Read the article

< Previous Page | 392 393 394 395 396 397 398 399 400 401 402 403  | Next Page >