Search Results

Search found 19603 results on 785 pages for 'variable length'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 397/785 | < Previous Page | 393 394 395 396 397 398 399 400 401 402 403 404  | Next Page >

  • Adding folder to Eclipse classpath

    - by Paul
    Hello, When i develop a project i create a folder in my project called libs. And in this folder i place all the library jars that i use. Is there a way to add just the libs folder to the class path so that i do not have to add each individual jar? I was thinking something along the lines of a variable or creating a user library. Many thanks.

    Read the article

  • Data types for validation

    - by nevalu
    How to create a new data type which to can check/validate its schema when is created a new variable (of that type)? By example, to validate if a string has 20 characters, I tried: {{{ // Format: 2006-01-12T06:06:06Z func date(str string) { if len(str) != 20 { fmt.Println("error") } } var Date = date() type Account struct { domain string username string created Date } }}} but it faills because Date is not a type.

    Read the article

  • Get the layout mode (landscape or portrait) of a pdf from php/linux

    - by Jonathan Hendler
    Given a PDF, how can one get the layout mode of a PDF (or relative width/height) using a PHP lib or linux command line tool? Using http://www.tecnick.com/public/code/cp%5Fdpage.php?aiocp%5Fdp=tcpdf which can set this variable on new PDFs, but for existing pdfs from adobe. Thought of converting pdfs to ps, or using gs in some other way - like converting it to an image first, and getting the width and height of that. Is this the best way?

    Read the article

  • How to get the textbox value in php?

    - by Nitz
    On my page. i have one textbox and one button. -- on the button click event. -- one function will be called. Now, How to get that value of textbox and store in php variable? this should be done in that function which we will call on button click.

    Read the article

  • Incompatible pointer type

    - by Boffin
    Hello. I have the function with following signature: void box_sort(int**, int, int) and variable of following type: int boxes[MAX_BOXES][MAX_DIMENSIONALITY+1] When I am calling the function box_sort(boxes, a, b) GCC gives me two warnings: 103.c:79: warning: passing argument 1 of ‘box_sort’ from incompatible pointer type (string where i am calling the function) 103.c:42: note: expected ‘int **’ but argument is of type ‘int (*)[11] (string where the function is defined) The question is why? Whether int x[][] and int** x (and actually int* x[]) are not the same types in C?

    Read the article

  • sed or greo or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn drfr4fdr4fmedmifmitfmifrtfrfrfrfnurfnurnfrunfrufnrufnrufnrufnruf"** # need to match the content of param1 as sed -n "/$param1/p" file but because the line length (very long line) I cant match the line what’s the best way to match very long lines?

    Read the article

  • Ruby hash value truthiness and symbols

    - by John Topley
    Could somebody please explain why the variable named foo remains true in the code below, even though it's set to false when the method is called? And why the symbol version behaves as expected? def test(options = {}) foo = options[:foo] || true bar = options[:bar] || :true puts "foo is #{foo}, bar is #{bar}" end >> test(:foo => false, :bar => :false) foo is true, bar is false I've only tried this using Ruby 1.8.7.

    Read the article

  • Building a decision-making game in jQuery? Where would I store data....

    - by redconservatory
    I built a slideshow/decision-making game in Flash but would like to try to redo it using jQuery. The slideshow part seems simple enough, however I have a series of user decisions that I'm not sure how to approach. In flash, if the user makes a decision, I would just store this in a variable or shared local objects, is this the same for jQuery? i.e. mix regular javascript variables with the jQuery?

    Read the article

  • Array structure returned by Yii's model

    - by user1104955
    I am a Yii beginner and am running into a bit of a wall and hope someone will be able to help me get back onto track. I think this might be a fairly straight forward question to the seasoned Yii user. So here goes... In the controller, let's say I run the following call to the model- $variable = Post::model()->findAll(); All works fine and I pass the variable into the view. Here's where I get pretty stuck. The array that is returned in the above query is far more complex than I anticipated and I'm struggling to make sense of it. Here's a sample- print_r($variable); gives- Array ( [0] => Post Object ( [_md:CActiveRecord:private] => CActiveRecordMetaData Object ( [tableSchema] => CMysqlTableSchema Object ( [schemaName] => [name] => tbl_post [rawName] => `tbl_post` [primaryKey] => id [sequenceName] => [foreignKeys] => Array ( ) [columns] => Array ( [id] => CMysqlColumnSchema Object ( [name] => id [rawName] => `id` [allowNull] => [dbType] => int(11) [type] => integer [defaultValue] => [size] => 11 [precision] => 11 [scale] => [isPrimaryKey] => 1 [isForeignKey] => [autoIncrement] => 1 [_e:CComponent:private] => [_m:CComponent:private] => ) [post] => CMysqlColumnSchema Object ( [name] => post [rawName] => `post` [allowNull] => [dbType] => text [type] => string [defaultValue] => [size] => [precision] => [scale] => [isPrimaryKey] => [isForeignKey] => [autoIncrement] => [_e:CComponent:private] => [_m:CComponent:private] => ) ) [_e:CComponent:private] => [_m:CComponent:private] => ) [columns] => Array ( [id] => CMysqlColumnSchema Object ( [name] => id [rawName] => `id` [allowNull] => [dbType] => int(11) [type] => integer [defaultValue] => [size] => 11 [precision] => 11 [scale] => [isPrimaryKey] => 1 [isForeignKey] => [autoIncrement] => 1 [_e:CComponent:private] => [_m:CComponent:private] => ) [post] => CMysqlColumnSchema Object ( [name] => post [rawName] => `post` [allowNull] => [dbType] => text [type] => string [defaultValue] => [size] => [precision] => [scale] => [isPrimaryKey] => [isForeignKey] => [autoIncrement] => [_e:CComponent:private] => [_m:CComponent:private] => ) ) [relations] => Array ( [responses] => CHasManyRelation Object ( [limit] => -1 [offset] => -1 [index] => [through] => [joinType] => LEFT OUTER JOIN [on] => [alias] => [with] => Array ( ) [together] => [scopes] => [name] => responses [className] => Response [foreignKey] => post_id [select] => * [condition] => [params] => Array ( ) [group] => [join] => [having] => [order] => [_e:CComponent:private] => [_m:CComponent:private] => ) ) [attributeDefaults] => Array ( ) [_model:CActiveRecordMetaData:private] => Post Object ( [_md:CActiveRecord:private] => CActiveRecordMetaData Object *RECURSION* [_new:CActiveRecord:private] => [_attributes:CActiveRecord:private] => Array ( ) [_related:CActiveRecord:private] => Array ( ) [_c:CActiveRecord:private] => [_pk:CActiveRecord:private] => [_alias:CActiveRecord:private] => t [_errors:CModel:private] => Array ( ) [_validators:CModel:private] => [_scenario:CModel:private] => [_e:CComponent:private] => [_m:CComponent:private] => ) ) [_new:CActiveRecord:private] => [_attributes:CActiveRecord:private] => Array ( [id] => 1 [post] => User Post ) [_related:CActiveRecord:private] => Array ( ) [_c:CActiveRecord:private] => [_pk:CActiveRecord:private] => 1 [_alias:CActiveRecord:private] => t [_errors:CModel:private] => Array ( ) [_validators:CModel:private] => [_scenario:CModel:private] => update [_e:CComponent:private] => [_m:CComponent:private] => ) ) [sorry if there's an easier way to show this array, I'm not aware of it] Can anyone explain to me why the model returns such a complex array? It doesn't seem to matter what tables or columns or relations are used in your application, they all seem to me to return this format. Also, can someone explain the structure to me so that I can isolate the variables that I want to recover? Many thanks in advance, Nick

    Read the article

  • Parameterizing a SQL IN clause?

    - by Jeff Atwood
    How do I parameterize a query containing an IN clause with a variable number of arguments, like this one? select * from Tags where Name in ('ruby','rails','scruffy','rubyonrails') order by Count desc In this query, the number of arguments could be anywhere from 1 to 5. I would prefer not to use a dedicated stored procedure for this (or XML), but if there is some fancy SQL Server 2008 specific way of doing it elegantly, I am open to that.

    Read the article

  • C#: check if a string start with any character in a list

    - by JoesyXHN
    Hi, I want to check whether a string starts with any character in a list. My current implementation in C# is as follows: char[] columnChars = new char[] { 'A', 'B', 'C', 'D', 'E' }; private bool startWithColumn(string toCheck) { for(int i=0; i<columnChars.Length; i++) if (toCheck.StartsWith(columnChars[i]+"")) { return true; } return false; } I would like to know if any solution is better?

    Read the article

  • accessing variables declared outside the asp code

    - by sushant
    <script ID="clientEventHandlersVBS" LANGUAGE="vbscript"> s=pass() y=s </script> <% session("password")=y Response.write(session("password")) Response.write(y) %> i have this code. but nothing is getting stored inside the session variable neither anything is getting printed. cant i access the variables declared outside the asp code or is their any syntax mistake. any help is really appreciated

    Read the article

  • Push SVG String into Dom?

    - by Colin
    I have a javascript variable that basically looks like this: my_svg_image = '<circle cx="227.58331298828125" cy="102" r="3" style="fill:black;stroke-width:0" />'; It was loaded from my database. Is there a way I can parse that string and add it to the DOM with Javascript? I have svgweb set up, but don't see how I can get it to parse this string. Are there other libraries that might help?

    Read the article

  • When not to use a private field

    - by coffeeaddict
    When should it be considered dangerous to use a private field all over the place in the methods of your class? I mostly just create the variable and set it to a default value like null. Then in my methods reference it and set it to an instance of that object type from the methods. I don't know if my question makes sense but let me know if it doesn't and I'll clarify.

    Read the article

  • Can I write this javascript more efficiently with jquery?

    - by Haluk
    Hi, Do you think jquery could help me get the following script work faster? Thanks! window.onload=function colorizeCheckedRadios(){ var inputs = document.getElementsByTagName("input"); if (inputs) { for (var i = 0; i < inputs.length; ++i) { if(inputs[i].checked&&inputs[i].type=="radio"){ inputs[i].parentNode.parentNode.style.backgroundColor='#FCE6F4'; } } } }

    Read the article

  • Getting a substring in Ruby by x number of chars

    - by wotaskd
    I'm trying to produce some Ruby code that will take a string and return a new one, with a number x number of characters removed from its end - these can be actual letters, numbers, spaces etc. Ex: given the following string a_string = "a1wer4zx" I need a simple way to get the same string, minus - say - the 3 last digits. In the case above, that would be "a1wer". The way I'm doing it right now seems very convoluted: an_array = a_string.split(//,(a_string.length-2)) an_array.pop new_string = an_array.join Any ideas?

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 393 394 395 396 397 398 399 400 401 402 403 404  | Next Page >