Search Results

Search found 41095 results on 1644 pages for 'empty string'.

Page 408/1644 | < Previous Page | 404 405 406 407 408 409 410 411 412 413 414 415  | Next Page >

  • Boiler plate code replacement - is there anything bad about this code?

    - by Benjol
    I've recently created these two (unrelated) methods to replace lots of boiler-plate code in my winforms application. As far as I can tell, they work ok, but I need some reassurance/advice on whether there are some problems I might be missing. (from memory) static class SafeInvoker { //Utility to avoid boiler-plate InvokeRequired code //Usage: SafeInvoker.Invoke(myCtrl, () => myCtrl.Enabled = false); public static void Invoke(Control ctrl, Action cmd) { if (ctrl.InvokeRequired) ctrl.BeginInvoke(new MethodInvoker(cmd)); else cmd(); } //Replaces OnMyEventRaised boiler-plate code //Usage: SafeInvoker.RaiseEvent(this, MyEventRaised) public static void RaiseEvent(object sender, EventHandler evnt) { var handler = evnt; if (handler != null) handler(sender, EventArgs.Empty); } } EDIT: See related question here UPDATE Following on from deadlock problems (related in this question), I have switched from Invoke to BeginInvoke (see an explanation here). Another Update Regarding the second snippet, I am increasingly inclined to use the 'empty delegate' pattern, which fixes this problem 'at source' by declaring the event directly with an empty handler, like so: event EventHandler MyEventRaised = delegate {};

    Read the article

  • Regex to detect a proper permalink?

    - by Fedor
    These permalinks above are rerouted to my page: page.php?permalink=events/foo page.php?permalink=events/foo/ page.php?permalink=ru/events/foo page.php?permalink=ru/events/foo/ The events is dynamic, it could be specials or packages. My dilemma is basically; I need to detect an empty link in order so I can feed a robots no index meta tag in the case of: page.php?permalink=events page.php?permalink=events/ page.php?permalink=ru/events/ page.php?permalink=ru/events I can't use a simple pattern such as [a-zA-Z]+\/?(.+)/ since it won't work on the i18n permalinks. What regex could I use which would detect this, using $_GET['permalink'] as the reference to the permalinks? And avoid false positives? Update: Empty link means there's no fragment after the "events/" part. These are empty: page.php?permalink=events page.php?permalink=events/ page.php?permalink=ru/events/ page.php?permalink=ru/events

    Read the article

  • jQuery not replacing text in ReportViewer

    - by firedrawndagger
    I'm trying to replace text that I got back in the ReportViewer using jQuery. My div, wrapped in the table cell, display "empty" as text - which I plan on replacing with my own formatted text on the client side. I can use jQuery just fine to set a class on the div (which is inside a td element). Example: jQuery('div:contains("empty")').addClass('replacetext'); But for some reason I cannot do this: jQuery('div:contains("empty")').replaceWith('<div>Hello World</div>'); I tried this out on some other elements on the page and jQuery does work... but it seems like this issue is ReportViewer (I'm using 2008) specific.

    Read the article

  • How to add Category in DotClear blog with HttpWebRequest or MetaWeblog API

    - by Pitming
    I'm trying to create/modify dotclear blogs. For most of the options, i use XmlRpc API (DotClear.MetaWeblog). But didn't find any way to handle categories. So I start to look at the Http packet and try to do "the same as the browser". Here si the method I use to "Http POST" protected HttpStatusCode HttpPost(Uri url_, string data_, bool allowAutoRedirect_) { HttpWebRequest Request; HttpWebResponse Response = null; Stream ResponseStream = null; Request = (System.Net.HttpWebRequest)HttpWebRequest.Create(url_); Request.UserAgent = "Mozilla/5.0 (Windows; U; Windows NT 5.1; fr; rv:1.9.1.5) Gecko/20091102 Firefox/3.5.5 (.NET CLR 3.5.30729)"; Request.Accept = "text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8"; Request.AllowAutoRedirect = allowAutoRedirect_; // Add the network credentials to the request. Request.Credentials = new NetworkCredential(Username, Password); string authInfo = Username + ":" + Password; authInfo = Convert.ToBase64String(Encoding.Default.GetBytes(authInfo)); Request.Headers["Authorization"] = "Basic " + authInfo; Request.Method = "POST"; Request.CookieContainer = Cookies; if(ConnectionCookie!=null) Request.CookieContainer.Add(url_, ConnectionCookie); if (dcAdminCookie != null) Request.CookieContainer.Add(url_, dcAdminCookie); Request.PreAuthenticate = true; ASCIIEncoding encoding = new ASCIIEncoding(); string postData = data_; byte[] data = encoding.GetBytes(postData); //Encoding.UTF8.GetBytes(data_); //encoding.GetBytes(postData); Request.ContentLength = data.Length; Request.ContentType = "application/x-www-form-urlencoded"; Stream newStream = Request.GetRequestStream(); // Send the data. newStream.Write(data, 0, data.Length); newStream.Close(); try { // get the response from the server. Response = (HttpWebResponse)Request.GetResponse(); if (!allowAutoRedirect_) { foreach (Cookie c in Response.Cookies) { if (c.Name == "dcxd") ConnectionCookie = c; if (c.Name == "dc_admin") dcAdminCookie = c; } Cookies.Add(Response.Cookies); } // Get the response stream. ResponseStream = Response.GetResponseStream(); // Pipes the stream to a higher level stream reader with the required encoding format. StreamReader readStream = new StreamReader(ResponseStream, Encoding.UTF8); string result = readStream.ReadToEnd(); if (Request.RequestUri == Response.ResponseUri) { _log.InfoFormat("{0} ==&gt; {1}({2})", Request.RequestUri, Response.StatusCode, Response.StatusDescription); } else { _log.WarnFormat("RequestUri:{0}\r\nResponseUri:{1}\r\nstatus code:{2} Status descr:{3}", Request.RequestUri, Response.ResponseUri, Response.StatusCode, Response.StatusDescription); } } catch (WebException wex) { Response = wex.Response as HttpWebResponse; if (Response != null) { _log.ErrorFormat("{0} ==&gt; {1}({2})", Request.RequestUri, Response.StatusCode, Response.StatusDescription); } Request.Abort(); } finally { if (Response != null) { // Releases the resources of the response. Response.Close(); } } if(Response !=null) return Response.StatusCode; return HttpStatusCode.Ambiguous; } So the first thing to do is to Authenticate as admin. Here is the code: protected bool HttpAuthenticate() { Uri u = new Uri(this.Url); Uri url = new Uri(string.Format("{0}/admin/auth.php", u.GetLeftPart(UriPartial.Authority))); string data = string.Format("user_id={0}&user_pwd={1}&user_remember=1", Username, Password); var ret = HttpPost(url,data,false); return (ret == HttpStatusCode.OK || ret==HttpStatusCode.Found); } 3.Now that I'm authenticate, i need to get a xd_chek info (that i can find on the page so basically it's a GET on /admin/category.php + Regex("dotclear[.]nonce = '(.*)'")) 4.so I'm authenticate and have the xd_check info. The last thing to do seems to post the next category. But of course it does not work at all... here is the code: string postData = string.Format("cat_title={0}&new_cat_parent={1}&xd_check={2}", category_, 0, xdCheck); HttpPost(url, postData, true); If anyone can help me and explain were is it wrong ? thanks in advance.

    Read the article

  • Idiomatic usage of filter, map, build-list and local functions in Racket/Scheme?

    - by Greenhorn
    I'm working through Exercise 21.2.3 of HtDP on my own and was wondering if this is idiomatic usage of the various functions. This is what I have so far: (define-struct ir (name price)) (define list-of-toys (list (make-ir 'doll 10) (make-ir 'robot 15) (make-ir 'ty 21) (make-ir 'cube 9))) ;; helper function (define (price< p toy) (cond [(< (ir-price toy) p) toy] [else empty])) (define (eliminate-exp ua lot) (cond [(empty? lot) empty] [else (filter ir? (map price< (build-list (length lot) (local ((define (f x) ua)) f)) lot))])) To my novice eyes, that seems pretty ugly because I have to define a local function to get build-list to work, since map requires two lists of equal length. Can this be improved for readability? Thank you.

    Read the article

  • checkUnique function?

    - by Chris Leah
    Hey, so I have created a function to check the DB for unique entries, but when I call the function it doesn't seem to work and gives me a fatal error any ideas from the function or do you wish to see the sign up page calling it. Thanks :) //Check for unique entries function checkUnique($table, $field, $compared) { $query = $mysqli->query('SELECT '.$mysqli->real_escape_string($field).' FROM '.$mysqli->real_escape_string($table).' WHERE "'.$mysqli->real_escape_string($field).'" = "'.$mysqli->real_escape_string($compared).'"'); if(!$query){ return TRUE; } else { return FALSE; } } The page calling it..... if (!empty($_POST['username']) && !empty($_POST['password']) && $_POST['password']==$_POST['password_confirm'] && !empty($_POST['email']) && validateEmail($_POST['email']) == TRUE && checkUnqiue('users', 'email', $_POST['email']) == TRUE && checkUnique('users', 'username', $_POST['username']) == TRUE)

    Read the article

  • creating a Menu from SQLite values in Java

    - by shanahobo86
    I am trying to create a ListMenu using data from an SQLite database to define the name of each MenuItem. So in a class called menu.java I have defined the array String classes [] = {}; which should hold each menu item name. In a DBAdapter class I created a function so the user can insert info to a table (This all works fine btw). public long insertContact(String name, String code, String location, String comments, int days, int start, int end, String type) { ContentValues initialValues = new ContentValues(); initialValues.put(KEY_NAME, name); initialValues.put(KEY_CODE, code); initialValues.put(KEY_LOCATION, location); initialValues.put(KEY_COMMENTS, comments); initialValues.put(KEY_DAYS, days); initialValues.put(KEY_START, start); initialValues.put(KEY_END, end); initialValues.put(KEY_TYPE, type); return db.insert(DATABASE_TABLE, null, initialValues); } It would be the Strings inserted into KEY_NAME that I need to populate that String array with. Does anyone know if this is possible? Thanks so much for the help guys. If I implement that function by Sam/Mango the program crashes, am I using it incorrectly or is the error due to the unknown size of the array? DBAdapter db = new DBAdapter(this); String classes [] = db.getClasses(); edit: I should mention that if I manually define the array: String classes [] = {"test1", "test2", "test3", etc}; It works fine. The error is a NullPointerException Here's the logcat (sorry about the formatting). I hadn't initialized with db = helper.getReadableDatabase(); in the getClasses() function but unfortunately it didn't fix the problem. 11-11 22:53:39.117: D/dalvikvm(17856): Late-enabling CheckJNI 11-11 22:53:39.297: D/TextLayoutCache(17856): Using debug level: 0 - Debug Enabled: 0 11-11 22:53:39.337: D/libEGL(17856): loaded /system/lib/egl/libGLES_android.so 11-11 22:53:39.337: D/libEGL(17856): loaded /system/lib/egl/libEGL_adreno200.so 11-11 22:53:39.357: D/libEGL(17856): loaded /system/lib/egl/libGLESv1_CM_adreno200.so 11-11 22:53:39.357: D/libEGL(17856): loaded /system/lib/egl/libGLESv2_adreno200.so 11-11 22:53:39.387: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:39.407: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5c66d000 size:36593664 offset:32825344 fd:65 11-11 22:53:39.417: E/(17856): Can't open file for reading 11-11 22:53:39.417: E/(17856): Can't open file for reading 11-11 22:53:39.417: D/OpenGLRenderer(17856): Enabling debug mode 0 11-11 22:53:39.477: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5ecd3000 size:40361984 offset:36593664 fd:68 11-11 22:53:40.507: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61451000 size:7254016 offset:3485696 fd:71 11-11 22:53:41.077: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:41.077: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61c4c000 size:7725056 offset:7254016 fd:74 11-11 22:53:41.097: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x623aa000 size:8196096 offset:7725056 fd:80 11-11 22:53:41.937: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x62b7b000 size:8667136 offset:8196096 fd:83 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x61c4c000 size:7725056 offset:7254016 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x623aa000 size:8196096 offset:7725056 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x62b7b000 size:8667136 offset:8196096 11-11 22:53:42.167: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:42.177: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61c5d000 size:17084416 offset:13316096 fd:74 11-11 22:53:42.317: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x63853000 size:20852736 offset:17084416 fd:80 11-11 22:53:42.357: D/OpenGLRenderer(17856): Flushing caches (mode 0) 11-11 22:53:42.357: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x5c66d000 size:36593664 offset:32825344 11-11 22:53:42.357: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x5ecd3000 size:40361984 offset:36593664 11-11 22:53:42.367: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x61451000 size:7254016 offset:3485696 11-11 22:53:42.757: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5c56d000 size:24621056 offset:20852736 fd:65 11-11 22:53:44.247: D/AndroidRuntime(17856): Shutting down VM 11-11 22:53:44.247: W/dalvikvm(17856): threadid=1: thread exiting with uncaught exception (group=0x40ac3210) 11-11 22:53:44.257: E/AndroidRuntime(17856): FATAL EXCEPTION: main 11-11 22:53:44.257: E/AndroidRuntime(17856): java.lang.RuntimeException: Unable to instantiate activity ComponentInfo{niall.shannon.timetable/niall.shannon.timetable.menu}: java.lang.NullPointerException 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1891) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:1992) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.access$600(ActivityThread.java:127) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:1158) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.os.Handler.dispatchMessage(Handler.java:99) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.os.Looper.loop(Looper.java:137) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.main(ActivityThread.java:4441) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.reflect.Method.invokeNative(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.reflect.Method.invoke(Method.java:511) 11-11 22:53:44.257: E/AndroidRuntime(17856): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:823) 11-11 22:53:44.257: E/AndroidRuntime(17856): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:590) 11-11 22:53:44.257: E/AndroidRuntime(17856): at dalvik.system.NativeStart.main(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): Caused by: java.lang.NullPointerException 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.content.ContextWrapper.openOrCreateDatabase(ContextWrapper.java:221) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.database.sqlite.SQLiteOpenHelper.getWritableDatabase(SQLiteOpenHelper.java:157) 11-11 22:53:44.257: E/AndroidRuntime(17856): at niall.shannon.timetable.DBAdapter.getClasses(DBAdapter.java:151) 11-11 22:53:44.257: E/AndroidRuntime(17856): at niall.shannon.timetable.menu.<init>(menu.java:15) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.Class.newInstanceImpl(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.Class.newInstance(Class.java:1319) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.Instrumentation.newActivity(Instrumentation.java:1023) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1882) 11-11 22:53:44.257: E/AndroidRuntime(17856): ... 11 more 11-11 22:53:46.527: I/Process(17856): Sending signal. PID: 17856 SIG: 9

    Read the article

  • Grails LDAP authentication failed

    - by Leo
    Hi, guys I am developing a web app by using Grails and using Grails LDAP as my Authentication mechanism. However, i always get following error: {Error 500: Cannot pass null or empty values to constructor Servlet: default URI: /ldap-app/j_spring_security_check Exception Message: Cannot pass null or empty values to constructor Caused by: Cannot pass null or empty values to constructor Class: GrailsAuthenticationProcessingFilter } My SecurityConfig.groovy file is : security { // see DefaultSecurityConfig.groovy for all settable/overridable properties active = true loginUserDomainClass = "User" authorityDomainClass = "Role" requestMapClass = "Requestmap" useLdap = true ldapRetrieveDatabaseRoles = false ldapRetrieveGroupRoles = false ldapServer = 'ldap://worf-mi.dapc.kao.au:389' ldapManagerDn = 'CN=sa-ldap-its,OU=Unix Servers for Kerberos,OU=Information Technology Services,OU=Special Accounts,DC=nexus,DC=dpac,DC=cn' ldapManagerPassword = 'Asdf1234' ldapSearchBase = 'OU=People,DC=nexus,DC=dpac,DC=cn' ldapSearchFilter = '(&(cn={0})(objectClass=user))' }

    Read the article

  • Android ksoap nested soap objects in request gives error in response

    - by Smalesy
    I'm trying to do the following soap request on Android using KSOAP. It contains a list of nested soap objects. However, I must be doing something wrong as I get an error back. The request I am trying to generate is as follows: <?xml version="1.0" encoding="utf-8"?> <soap12:Envelope xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:soap12="http://www.w3.org/2003/05/soap-envelope"> <soap12:Body> <SetAttendanceMarks xmlns="http://hostname.net/"> <strSessionToken>string</strSessionToken> <LessonMarks> <Count>int</Count> <LessonMarks> <LessonMark> <StudentId>int</StudentId> <EventInstanceId>int</EventInstanceId> <Mark>string</Mark> </LessonMark> <LessonMark> <StudentId>int</StudentId> <EventInstanceId>int</EventInstanceId> <Mark>string</Mark> </LessonMark> </LessonMarks> </LessonMarks> </SetAttendanceMarks> </soap12:Body> </soap12:Envelope> My code is as follows: public boolean setAttendanceMarks(List<Mark> list) throws Exception { boolean result = false; String methodName = "SetAttendanceMarks"; String soapAction = getHost() + "SetAttendanceMarks"; SoapObject lessMarksN = new SoapObject(getHost(), "LessonMarks"); for (Mark m : list) { PropertyInfo smProp =new PropertyInfo(); smProp.setName("LessonMark"); smProp.setValue(m); smProp.setType(Mark.class); lessMarksN.addProperty(smProp); } PropertyInfo cProp =new PropertyInfo(); cProp.setName("Count"); cProp.setValue(list.size()); cProp.setType(Integer.class); SoapObject lessMarks = new SoapObject(getHost(), "LessonMarks"); lessMarks.addProperty(cProp); lessMarks.addSoapObject(lessMarksN); PropertyInfo sProp =new PropertyInfo(); sProp.setName("strSessionToken"); sProp.setValue(mSession); sProp.setType(String.class); SoapObject request = new SoapObject(getHost(), methodName); request.addProperty(sProp); request.addSoapObject(lessMarks); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope(SoapEnvelope.VER12); envelope.dotNet = true; envelope.setOutputSoapObject(request); HttpTransportSE androidHttpTransport = new HttpTransportSE(getURL()); androidHttpTransport.debug = true; androidHttpTransport.call(soapAction, envelope); String a = androidHttpTransport.requestDump; String b = androidHttpTransport.responseDump; SoapObject resultsRequestSOAP = (SoapObject) envelope.bodyIn; SoapObject res = (SoapObject) resultsRequestSOAP.getProperty(0); String resultStr = res.getPropertyAsString("Result"); if (resultStr.contentEquals("OK")) { result = true; } return result; } The error I get is as follows: <?xml version="1.0" encoding="utf-8"?><soap:Envelope xmlns:soap="http://www.w3.org/2003/05/soap-envelope" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <soap:Body> <soap:Fault> <soap:Code> <soap:Value>soap:Sender</soap:Value> </soap:Code> <soap:Reason> <soap:Text xml:lang="en">Server was unable to read request. ---&gt; There is an error in XML document (1, 383). ---&gt; The specified type was not recognized: name='LessonMarks', namespace='http://gsdregapp.net/', at &lt;LessonMarks xmlns='http://gsdregapp.net/'&gt;.</soap:Text> </soap:Reason> <soap:Detail /> </soap:Fault> </soap:Body> </soap:Envelope> Can anybody tell me what I am doing wrong? I will be most grateful for any assistance!

    Read the article

  • MVC 3 Remote Validation jQuery error on submit

    - by Richard Reddy
    I seem to have a weird issue with remote validation on my project. I am doing a simple validation check on an email field to ensure that it is unique. I've noticed that unless I put the cursor into the textbox and then remove it to trigger the validation at least once before submitting my form I will get a javascript error. e[h] is not a function jquery.min.js line 3 If I try to resubmit the form after the above error is returned everything works as expected. It's almost like the form tried to submit before waiting for the validation to return or something. Am I required to silently fire off a remote validation request on submit before submitting my form? Below is a snapshot of the code I'm using: (I've also tried GET instead of POST but I get the same result). As mentioned above, the code works fine but the form returns a jquery error unless the validation is triggered at least once. Model: public class RegisterModel { [Required] [Remote("DoesUserNameExist", "Account", HttpMethod = "POST", ErrorMessage = "User name taken.")] [Display(Name = "User name")] public string UserName { get; set; } [Required] [Display(Name = "Firstname")] public string Firstname { get; set; } [Display(Name = "Surname")] public string Surname { get; set; } [Required] [Remote("DoesEmailExist", "Account", HttpMethod = "POST", ErrorMessage = "Email taken.", AdditionalFields = "UserName")] [Display(Name = "Email address")] public string Email { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Password")] public string Password { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Confirm password")] public string ConfirmPassword { get; set; } [Display(Name = "Approved?")] public bool IsApproved { get; set; } } public class UserRoleModel { [Display(Name = "Assign Roles")] public IEnumerable<RoleViewModel> AllRoles { get; set; } public RegisterModel RegisterUser { get; set; } } Controller: // POST: /Account/DoesEmailExist // passing in username so that I can ignore the same email address for the same user on edit page [HttpPost] public JsonResult DoesEmailExist([Bind(Prefix = "RegisterUser.Email")]string Email, [Bind(Prefix = "RegisterUser.UserName")]string UserName) { var user = Membership.GetUserNameByEmail(Email); if (!String.IsNullOrEmpty(UserName)) { if (user == UserName) return Json(true); } return Json(user == null); } View: <script src="//ajax.googleapis.com/ajax/libs/jquery/1.7.1/jquery.min.js" type="text/javascript"></script> <script src="//ajax.googleapis.com/ajax/libs/jqueryui/1.8.17/jquery-ui.min.js" type="text/javascript"></script> <script type="text/javascript" src="/Content/web/js/jquery.unobtrusive-ajax.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.unobtrusive.min.js"></script> ...... @using (Html.BeginForm()) { @Html.AntiForgeryToken() <div class="titleh"> <h3>Edit a user account</h3> </div> <div class="body"> @Html.HiddenFor(model => model.RegisterUser.UserName) @Html.Partial("_CreateOrEdit", Model) <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(model => model.RegisterUser.IsApproved)</span> @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, true, new { @class = "uniform" }) Active @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, false, new { @class = "uniform" }) Disabled <div class="clear"></div> </div> <div class="button-box"> <input type="submit" name="submit" value="Save" class="st-button"/> @Html.ActionLink("Back to List", "Index", null, new { @class = "st-clear" }) </div> </div> } CreateEdit Partial View @model Project.Domain.Entities.UserRoleModel <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Firstname)</span> @Html.TextBoxFor(m => m.RegisterUser.Firstname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Firstname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Surname)</span> @Html.TextBoxFor(m => m.RegisterUser.Surname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Surname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Email)</span> @Html.TextBoxFor(m => m.RegisterUser.Email, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Email) <div class="clear"></div> </div> Thanks, Rich

    Read the article

  • Write a sql for searching with multiple conditions

    - by Lu Lu
    Hello everyone, I have a table Student with 2 fields: Name: nvarchar(256) Age: int User will use a WinForm application to input a Name and a Age for searching. If inputted Name is empty, sql will not query Name field. If inputted Age is 0, sql will not query Age field. If Name is Null and inputted Name is empty - record is matched. If Name is Null and inputted Name is not empty - record is not matched. And also similar for Age field. My problem is that how to write a sql like this. P/S: I use SQL Server 2005. Please help me. Thanks.

    Read the article

  • pass an ID with hyperlik but cant get this ID value from a fk in one table when i click in insert

    - by susan
    Something strange happened in my codes, actually I have a hyperlink that pass ID value in a query string to second page.in second page i have 2 sql datasource that both these sql datasources should get this id value and pass it to a filter parameter to show sth in datalist. so in another word I have a first page that has an hyperlink read ID value from a datasource and pass it to second page.its like below: <asp:HyperLink ID="HyperLink1" runat="server" NavigateUrl='<%# "~/forumpage.aspx?ID="+Eval("ID")%>'><%#Eval("title")%> </asp:HyperLink> then in second page i have one sql datasource with a query like this ...where ID=@id and get this id in query string from db.it work great . but i have problem with second sql datasource in second page it has a query sth like below:...forms.question_id=@id then in sql reference both to query string as ID that get by first page in hyperlink. but when i click in insert button show me error with fk. error:Error:The INSERT statement conflicted with the FOREIGN KEY constraint "FK_forumreply_forumquestions". The conflict occurred in database "forum", table "dbo.forumquestions", column 'ID'. The statement has been terminated. my tables (question(ID,user_id(fk),Cat_id(fk),title,bodytext) (reply(ID,userr_id(fk),questionn_id(fk),titlereply,bodytestreply); When by hand in cb i gave a number in questionn_id like 1 it show me successful but when it want read from a filter by datasource this field face with problem. plzzzz help i really need skip from this part.and cause i am new i guess I cant understand the logic way clearly. <asp:SqlDataSource ID="sdsreply" runat="server" ConnectionString="<%$ ConnectionStrings:forumConnectionString %>" SelectCommand="SELECT forumreply.ID, forumreply.userr_id, forumreply.questionn_id, forumreply.bodytextreply, forumreply.datetimereply, forumquestions.ID AS Expr1, forumusers.ID AS Expr2, forumusers.username FROM forumquestions INNER JOIN forumreply ON forumquestions.ID = forumreply.questionn_id INNER JOIN forumusers ON forumquestions.user_id = forumusers.ID AND forumreply.userr_id = forumusers.ID where forumreply.questionn_id=@questionn_id"> <SelectParameters> <asp:QueryStringParameter Name="questionn_id" QueryStringField="ID" /> </SelectParameters> </asp:SqlDataSource> it is cb for second page in insert button: { if (Session["userid"] != null) { lblreply.Text = Session["userid"].ToString(); } else { Session["userid"]=null; } if (HttpContext.Current.User.Identity.IsAuthenticated) { lblshow.Text = string.Empty; string d = HttpContext.Current.User.Identity.Name; lblshow.Text =d + "???? ??? ?????." ; foreach (DataListItem item in DataList2.Items) { Label questionn_idLabel = (Label)item.FindControl("questionn_idLabel"); Label userr_idLabel = (Label)item.FindControl("userr_idLabel"); lbltest.Text = string.Empty; lbltest.Text = questionn_idLabel.Text; lblreply.Text = string.Empty; lblreply.Text = userr_idLabel.Text; } } else { lblshow.Text = "??? ??? ??? ??? ?? ?? ?????? ???? ???? ???? ????? ??? ??? ? ??? ????? ???????."; } } { if(HttpContext.Current.User.Identity.IsAuthenticated) { if (Page.IsValid) { SqlConnection con = new SqlConnection(ConfigurationManager.ConnectionStrings["forumConnectionString"].ConnectionString); try { con.Open(); SqlCommand cmd = new SqlCommand("insert into forumreply (userr_id,questionn_id,bodytextreply,datetimereply)values(@userr_id,@questionn_id,@bodytextreply,@datetimereply)", con); cmd.Parameters.AddWithValue("userr_id",lblreply.Text); cmd.Parameters.AddWithValue("questionn_id",lbltest.Text); cmd.Parameters.AddWithValue("bodytextreply",txtbody.Text); cmd.Parameters.AddWithValue("datetimereply",DateTime.Now ); cmd.ExecuteNonQuery(); } catch (Exception exp) { Response.Write("<b>Error:</b>"); Response.Write(exp.Message); } finally { con.Close(); } lblmsg.Text = "???? ??? ?? ?????? ??? ?????.thx"; lblshow.Visible = false; //lbltxt.Text = txtbody.Text; txtbody.Text = string.Empty; } } else { lblmsg.Text = string.Empty; Session["rem"] = Request.UrlReferrer.AbsoluteUri; Response.Redirect("~/login.aspx"); } }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Hash Table: Should I increase the element count on collisions?

    - by Nazgulled
    Hi, Right now my hash tables count the number of every element inserted into the hash table. I use this count, with the total hash table size, to calculate the load factor and when it reaches like 70%, I rehash it. I was thinking that maybe I should only count the inserted elements with fills an empty slot instead of all of them. Cause the collision method I'm using is separate chaining. The factor load keeps increasing but if there can be a few collisions leaving lots of empty slots on the hash table. You are probably thinking that if I have that many collisions, maybe I'm not using the best hashing method. But that's not the point, I'm using one of the know hashing algorithms out there, I tested 3 of them on my sample data and selected the one who produced less collisions. My question still remains. Should I keep counting every element inserted, or just the ones that fill an empty slot in the Hash Table?

    Read the article

  • SSIS Data Flow Task Excel Source

    - by Gerard
    Hi, I have a data flow task set up in SSIS. The source is from an Excel source not an SQL DB. The problem i seem to get is that, the package is importing empty rows. My data has data in 555200 rows, but however when importing the SSIS package imports over 900,000 rows. The extra rows are imported even though the other empty. When i then download this table into excel there are empty rows in between the data. Is there anyway i can avoid this? Thanks Gerard

    Read the article

  • AJAX calls from multiple browser tabs at the same time:

    - by Bindi
    When an user tries to send AJAX requests simultaneously from multiple browser tabs, the earlier requests get completed and the page loads but the other AJAX calls are preempted. AS a result of which the response is empty for the other calls. Only one call survives. In my application using struts 2.0, JSP and javascript and the prototype framework, i found that the server response is empty in the cases mentioned above though the data gets updated in teh database with the request parameters. The onSucess event handler for Ajax.request gets called but the the response is empty. Can you please help? Thanks

    Read the article

  • why javascript can not read the cookie in asp.net ?

    - by MemoryLeak
    I want to read the sessionid in cookie which is automatically generated by asp.net. such as ASP.NET_SessionId. but when i use javascript: document.cookie = "ASP.NET_SessionId=;" since i want to set the ASP.NET_SessionId to be empty. but after the javascript executed, i found instead of change the ASP.NET_SessionId to empty, system generate a new cookie with ASP.NET_SessionId equal to empty. why system not modify the cookie but generate a new one ? Thanks!

    Read the article

  • CakePHP: How do I order results based on a 2-level deep association model?

    - by KcYxA
    I'm hoping I won't need to resort to custom queries. A related question would be: how do I retrieve data so that if an associated model is empty, no record is retrieved at all, as opposed to an empty array for an associated model? As an oversimplified example, say I have the following models: City -- Street -- House How do I sort City results by House numbers? How do I retrieve City restuls that have at least one House in it? I don't want a record with a city name and details and an empty House array as it messes up pagination results. CakePHP retrieves House records belonging to the Street in a separate query, so putting somthing like 'House.number DESC' into the 'order' field of the search query returns a 'field does not exist' error. Any ideas?

    Read the article

  • Weird problem cucumber behaving differently when run with the debugger

    - by James
    When I run a cucumber test it executes the code thinking that a collection obtained inside of a controller via a has_many relationship on a model is empty when it isn't. I ran this same test but with the debugger turned and a breakpoint before the collection is used. When I print collection in the debugger at this breakpoint the collection is as it should be (not empty). Then I continue and the test executes as it should. With no debugger and breakpoints though, the test exectues as though the collection is empty. Has anyone had a problem like this/what did you do to fix it?

    Read the article

  • PHP - Short hand if statement with a date format with weird output.

    - by McNabbToSkins
    I am using a short hand notation of an if statement to format a field. If the field is an empty string I leave it as an empty string, if not then I am trying to format it to a proper datetime format so it can be inserted into a mysql db. here is my php code $date = ($date == '') ? date("Y-m-d", strtotime($date)) : $date; for some reason when the $date string is not empty it is returning it int he format 'm/d/Y' example: 04/01/2010 When I pull the code out of the shorthand if $date = date("Y-m-d", strtotime($date)); print($date); it is formatted correctly like this 'Y-m-d' or 2010-04-01. Does anyone know why this happens? Thanks

    Read the article

  • Optimize conditional operators branching in C#

    - by abatishchev
    Hello. I have next code: return this.AllowChooseAny.Value ? radioSpecific.Checked ? UserManager.CurrentUser.IsClient ? txtSubject.Text : subjectDropDownList.SelectedItem.Text : String.Empty : UserManager.CurrentUser.IsClient ? txtSubject.Text : subjectDropDownList.SelectedItem.Text; or in less complex form: return any ? specified ? isClient ? textbox : dropdown : empty : isClient ? textbox : dropdown; or in schematic form: | any / \ specified isClient / \ / \ isClient empty textbox dropdown / \ textbox dropdown Evidently I have a duplicated block on two different levels. Is it possible to optimize this code to probably split them to one? Or something like that..

    Read the article

  • how to insert date in mysql table

    - by mithun1538
    Hello everyone, I have a mysql table called pollOfTheWeek. It has a column "pollDate" of type date. I have two questions regarding this : 1. I declared the column while creating the table as [pollDate date] What I wanted is that this column be set automatically, when the user doesnt enter any value for this column. How do i declare the column to achieve this? Assuming that I have the same declaration as above, how do I enter an empty value. I mean if the column was of type varchar, I would enter empty value as " ". But since it is of type date, I get error when I enter the value as " ". How do I enter empty value for the pollDate column?

    Read the article

  • Fully custom validation error message with Rails

    - by marcgg
    Using Rails I'm trying to get an error message like "The song field can't be empty" on save. Doing the following: validates_presence_of :song_rep_xyz, :message => "can't be empty" ... only displays "Song Rep XYW can't be empty", which is not good because the title of the field is not user friendly. How can I change the title of the field itself ? I could change the actual name of the field in the database, but I have multiple "song" fields and I do need to have specific field names. I don't want to hack around rails' validation process and I feel there should be a way of fixing that.

    Read the article

  • Convert inline image tags like [image:123:title:size] into HTML img tags

    - by Jacques Joubert
    I am looking for help with regular expression $pattern to convert inline image tags like [image:123:title:size] into HTML img tags. here is the code: //[image:ID:caption:size] $content = '[image:38:title:800x900]'; preg_match_all( '/\[image:(\d+)(:?)([^\]]*)\]/i', $content, $images ); if( !empty( $images[0] ) ) { // There are image inline tags in the content foreach( $images[0] as $i => $tag ) { $link_ID = (int)$images[1][$i]; $caption = empty( $images[2][$i] ) ? '#' : $images[3][$i]; $size = empty( $images[4][$i] ) ? '#' : $images[4][$i]; } echo '<br />'; echo 'ID: '.$link_ID.'<br />'; echo 'Tag: '.$caption.'<br />'; echo 'size: '.$size.'<br />'; } which outputs: ID: 12 Tag: caption:size size: # Any help would be great!

    Read the article

  • Fully custom validation error message with Rails

    - by marcgg
    Using Rails I'm trying to get an error message like "The song field can't be empty" on save. Doing the following: validates_presence_of :song_rep_xyz, :message => "can't be empty" ... only displays "Song Rep XYW can't be empty", which is not good because the title of the field is not user friendly. How can I change the title of the field itself ? I could change the actual name of the field in the database, but I have multiple "song" fields and I do need to have specific field names. I don't want to hack around rails' validation process and I feel there should be a way of fixing that.

    Read the article

< Previous Page | 404 405 406 407 408 409 410 411 412 413 414 415  | Next Page >