Search Results

Search found 40913 results on 1637 pages for 'string length'.

Page 410/1637 | < Previous Page | 406 407 408 409 410 411 412 413 414 415 416 417  | Next Page >

• creating a Menu from SQLite values in Java

  - by shanahobo86

  I am trying to create a ListMenu using data from an SQLite database to define the name of each MenuItem. So in a class called menu.java I have defined the array String classes [] = {}; which should hold each menu item name. In a DBAdapter class I created a function so the user can insert info to a table (This all works fine btw). public long insertContact(String name, String code, String location, String comments, int days, int start, int end, String type) { ContentValues initialValues = new ContentValues(); initialValues.put(KEY_NAME, name); initialValues.put(KEY_CODE, code); initialValues.put(KEY_LOCATION, location); initialValues.put(KEY_COMMENTS, comments); initialValues.put(KEY_DAYS, days); initialValues.put(KEY_START, start); initialValues.put(KEY_END, end); initialValues.put(KEY_TYPE, type); return db.insert(DATABASE_TABLE, null, initialValues); } It would be the Strings inserted into KEY_NAME that I need to populate that String array with. Does anyone know if this is possible? Thanks so much for the help guys. If I implement that function by Sam/Mango the program crashes, am I using it incorrectly or is the error due to the unknown size of the array? DBAdapter db = new DBAdapter(this); String classes [] = db.getClasses(); edit: I should mention that if I manually define the array: String classes [] = {"test1", "test2", "test3", etc}; It works fine. The error is a NullPointerException Here's the logcat (sorry about the formatting). I hadn't initialized with db = helper.getReadableDatabase(); in the getClasses() function but unfortunately it didn't fix the problem. 11-11 22:53:39.117: D/dalvikvm(17856): Late-enabling CheckJNI 11-11 22:53:39.297: D/TextLayoutCache(17856): Using debug level: 0 - Debug Enabled: 0 11-11 22:53:39.337: D/libEGL(17856): loaded /system/lib/egl/libGLES_android.so 11-11 22:53:39.337: D/libEGL(17856): loaded /system/lib/egl/libEGL_adreno200.so 11-11 22:53:39.357: D/libEGL(17856): loaded /system/lib/egl/libGLESv1_CM_adreno200.so 11-11 22:53:39.357: D/libEGL(17856): loaded /system/lib/egl/libGLESv2_adreno200.so 11-11 22:53:39.387: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:39.407: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5c66d000 size:36593664 offset:32825344 fd:65 11-11 22:53:39.417: E/(17856): Can't open file for reading 11-11 22:53:39.417: E/(17856): Can't open file for reading 11-11 22:53:39.417: D/OpenGLRenderer(17856): Enabling debug mode 0 11-11 22:53:39.477: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5ecd3000 size:40361984 offset:36593664 fd:68 11-11 22:53:40.507: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61451000 size:7254016 offset:3485696 fd:71 11-11 22:53:41.077: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:41.077: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61c4c000 size:7725056 offset:7254016 fd:74 11-11 22:53:41.097: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x623aa000 size:8196096 offset:7725056 fd:80 11-11 22:53:41.937: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x62b7b000 size:8667136 offset:8196096 fd:83 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x61c4c000 size:7725056 offset:7254016 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x623aa000 size:8196096 offset:7725056 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x62b7b000 size:8667136 offset:8196096 11-11 22:53:42.167: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:42.177: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61c5d000 size:17084416 offset:13316096 fd:74 11-11 22:53:42.317: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x63853000 size:20852736 offset:17084416 fd:80 11-11 22:53:42.357: D/OpenGLRenderer(17856): Flushing caches (mode 0) 11-11 22:53:42.357: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x5c66d000 size:36593664 offset:32825344 11-11 22:53:42.357: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x5ecd3000 size:40361984 offset:36593664 11-11 22:53:42.367: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x61451000 size:7254016 offset:3485696 11-11 22:53:42.757: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5c56d000 size:24621056 offset:20852736 fd:65 11-11 22:53:44.247: D/AndroidRuntime(17856): Shutting down VM 11-11 22:53:44.247: W/dalvikvm(17856): threadid=1: thread exiting with uncaught exception (group=0x40ac3210) 11-11 22:53:44.257: E/AndroidRuntime(17856): FATAL EXCEPTION: main 11-11 22:53:44.257: E/AndroidRuntime(17856): java.lang.RuntimeException: Unable to instantiate activity ComponentInfo{niall.shannon.timetable/niall.shannon.timetable.menu}: java.lang.NullPointerException 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1891) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:1992) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.access$600(ActivityThread.java:127) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:1158) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.os.Handler.dispatchMessage(Handler.java:99) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.os.Looper.loop(Looper.java:137) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.main(ActivityThread.java:4441) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.reflect.Method.invokeNative(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.reflect.Method.invoke(Method.java:511) 11-11 22:53:44.257: E/AndroidRuntime(17856): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:823) 11-11 22:53:44.257: E/AndroidRuntime(17856): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:590) 11-11 22:53:44.257: E/AndroidRuntime(17856): at dalvik.system.NativeStart.main(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): Caused by: java.lang.NullPointerException 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.content.ContextWrapper.openOrCreateDatabase(ContextWrapper.java:221) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.database.sqlite.SQLiteOpenHelper.getWritableDatabase(SQLiteOpenHelper.java:157) 11-11 22:53:44.257: E/AndroidRuntime(17856): at niall.shannon.timetable.DBAdapter.getClasses(DBAdapter.java:151) 11-11 22:53:44.257: E/AndroidRuntime(17856): at niall.shannon.timetable.menu.<init>(menu.java:15) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.Class.newInstanceImpl(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.Class.newInstance(Class.java:1319) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.Instrumentation.newActivity(Instrumentation.java:1023) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1882) 11-11 22:53:44.257: E/AndroidRuntime(17856): ... 11 more 11-11 22:53:46.527: I/Process(17856): Sending signal. PID: 17856 SIG: 9

  Read the article

• Coordinates in distorted grid

  - by Carsten

  I have a grid in a 2D system like the one in the before image where all points A,B,C,D,A',B',C',D' are given (meaning I know the respective x- and y-coordinates). I need to calculate the x- and y-coordinates of A(new), B(new), C(new) and D(new) when the grid is distorted (so that A' is moved to A'(new), B' is moved to B'(new), C' is moved to C'(new) and D' is moved to D'(new)). The distortion happens in a way in which the lines of the grid are each divided into sub-lines of equal length (meaning for example that AB is divided into 5 parts of the equal length |AB|/5 and A(new)B(new) is divided into 5 parts of the equal length |A(new)B(new)|/5). The distortion is done with the DistortImage class of the Sandy 3D Flash engine. (My practical task is to distort an image using this class where the handles are not positioned at the corners of the image like in this demo but somewhere within it).

  Read the article

• Android ksoap nested soap objects in request gives error in response

  - by Smalesy

  I'm trying to do the following soap request on Android using KSOAP. It contains a list of nested soap objects. However, I must be doing something wrong as I get an error back. The request I am trying to generate is as follows: <?xml version="1.0" encoding="utf-8"?> <soap12:Envelope xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:soap12="http://www.w3.org/2003/05/soap-envelope"> <soap12:Body> <SetAttendanceMarks xmlns="http://hostname.net/"> <strSessionToken>string</strSessionToken> <LessonMarks> <Count>int</Count> <LessonMarks> <LessonMark> <StudentId>int</StudentId> <EventInstanceId>int</EventInstanceId> <Mark>string</Mark> </LessonMark> <LessonMark> <StudentId>int</StudentId> <EventInstanceId>int</EventInstanceId> <Mark>string</Mark> </LessonMark> </LessonMarks> </LessonMarks> </SetAttendanceMarks> </soap12:Body> </soap12:Envelope> My code is as follows: public boolean setAttendanceMarks(List<Mark> list) throws Exception { boolean result = false; String methodName = "SetAttendanceMarks"; String soapAction = getHost() + "SetAttendanceMarks"; SoapObject lessMarksN = new SoapObject(getHost(), "LessonMarks"); for (Mark m : list) { PropertyInfo smProp =new PropertyInfo(); smProp.setName("LessonMark"); smProp.setValue(m); smProp.setType(Mark.class); lessMarksN.addProperty(smProp); } PropertyInfo cProp =new PropertyInfo(); cProp.setName("Count"); cProp.setValue(list.size()); cProp.setType(Integer.class); SoapObject lessMarks = new SoapObject(getHost(), "LessonMarks"); lessMarks.addProperty(cProp); lessMarks.addSoapObject(lessMarksN); PropertyInfo sProp =new PropertyInfo(); sProp.setName("strSessionToken"); sProp.setValue(mSession); sProp.setType(String.class); SoapObject request = new SoapObject(getHost(), methodName); request.addProperty(sProp); request.addSoapObject(lessMarks); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope(SoapEnvelope.VER12); envelope.dotNet = true; envelope.setOutputSoapObject(request); HttpTransportSE androidHttpTransport = new HttpTransportSE(getURL()); androidHttpTransport.debug = true; androidHttpTransport.call(soapAction, envelope); String a = androidHttpTransport.requestDump; String b = androidHttpTransport.responseDump; SoapObject resultsRequestSOAP = (SoapObject) envelope.bodyIn; SoapObject res = (SoapObject) resultsRequestSOAP.getProperty(0); String resultStr = res.getPropertyAsString("Result"); if (resultStr.contentEquals("OK")) { result = true; } return result; } The error I get is as follows: <?xml version="1.0" encoding="utf-8"?><soap:Envelope xmlns:soap="http://www.w3.org/2003/05/soap-envelope" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <soap:Body> <soap:Fault> <soap:Code> <soap:Value>soap:Sender</soap:Value> </soap:Code> <soap:Reason> <soap:Text xml:lang="en">Server was unable to read request. ---&gt; There is an error in XML document (1, 383). ---&gt; The specified type was not recognized: name='LessonMarks', namespace='http://gsdregapp.net/', at &lt;LessonMarks xmlns='http://gsdregapp.net/'&gt;.</soap:Text> </soap:Reason> <soap:Detail /> </soap:Fault> </soap:Body> </soap:Envelope> Can anybody tell me what I am doing wrong? I will be most grateful for any assistance!

  Read the article

• iPhone - Get a pointer to the data behind CGDataProvider?

  - by jtrim

  I'm trying to take a CGImage and copy its data into a buffer for later processing. The code below is what I have so far, but there's one thing I don't like about it - it's copying the image data twice. Once for CGDataProviderCopyData() and once for the :getBytes:length call on imgData. I haven't been able to find a way to copy the image data directly into my buffer and cut out the CGDataProviderCopyData() step, but there has to be a way...any pointers? (...pun ftw) NSData *imgData = (NSData *)(CGDataProviderCopyData(CGImageGetDataProvider(myCGImageRef))); CGImageRelease(myCGImageRef); // i've got a previously-defined pointer to an available buffer called "mybuff" [imgData getBytes:mybuff length:[imgData length]];

  Read the article

• JQuery never reaches success or fail on aspx returning json.

  - by David

  Basicaly I have my aspx page doing <% Response.Clear(); Response.Write("{\"Success\": \"true\" }"); Response.End(); %> My JQuery code is function DoSubmit(r) { if (r == null || r.length == 0 || formdata == null || formdata.length == 0) return; for (i = 0; i < formdata.length; i++) { var fd = formdata[i]; r[fd.Name] = fd.Value; } r["ModSeq"] = tblDef.ModSeq; jQuery.ajax({ url: "NashcoUpdate.aspx" , succsess: doRow , error: DoSubmitError , complete: DoSubmitComplete , dataType: "json" , cache: false , data: r , type: "post" }) } When I call the DoSubmit() function every thing works but the doRow or DoSubmitError functions never get called only the DoSubmitComplete function. When I look at the response text in teh DoSubmitComple function it is {"Success": "true" } Every JSON tester I have tried says that this is valied JSON. What am I doing wrong here?

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• ZIPLIB problem on opening zip files

  - by Ahmet vardar

  I am using this class to create zip <?php // vim: expandtab sw=4 ts=4 sts=4: class zipfile { var $datasec = array(); var $ctrl_dir = array(); var $eof_ctrl_dir = "\x50\x4b\x05\x06\x00\x00\x00\x00"; var $old_offset = 0; function unix2DosTime($unixtime = 0) { $timearray = ($unixtime == 0) ? getdate() : getdate($unixtime); if ($timearray['year'] < 1980) { $timearray['year'] = 1980; $timearray['mon'] = 1; $timearray['mday'] = 1; $timearray['hours'] = 0; $timearray['minutes'] = 0; $timearray['seconds'] = 0; } // end if return (($timearray['year'] - 1980) << 25) | ($timearray['mon'] << 21) | ($timearray['mday'] << 16) | ($timearray['hours'] << 11) | ($timearray['minutes'] << 5) | ($timearray['seconds'] >> 1); } // end of the 'unix2DosTime()' method function addFile($data, $name, $time = 0) { $name = str_replace('\\', '/', $name); $dtime = dechex($this->unix2DosTime($time)); $hexdtime = '\x' . $dtime[6] . $dtime[7] . '\x' . $dtime[4] . $dtime[5] . '\x' . $dtime[2] . $dtime[3] . '\x' . $dtime[0] . $dtime[1]; eval('$hexdtime = "' . $hexdtime . '";'); $fr = "\x50\x4b\x03\x04"; $fr .= "\x14\x00"; // ver needed to extract $fr .= "\x00\x00"; // gen purpose bit flag $fr .= "\x08\x00"; // compression method $fr .= $hexdtime; // last mod time and date // "local file header" segment $unc_len = strlen($data); $crc = crc32($data); $zdata = gzcompress($data); $zdata = substr(substr($zdata, 0, strlen($zdata) - 4), 2); // fix crc bug $c_len = strlen($zdata); $fr .= pack('V', $crc); // crc32 $fr .= pack('V', $c_len); // compressed filesize $fr .= pack('V', $unc_len); // uncompressed filesize $fr .= pack('v', strlen($name)); // length of filename $fr .= pack('v', 0); // extra field length $fr .= $name; // "file data" segment $fr .= $zdata; // "data descriptor" segment (optional but necessary if archive is not // served as file) $fr .= pack('V', $crc); // crc32 $fr .= pack('V', $c_len); // compressed filesize $fr .= pack('V', $unc_len); // uncompressed filesize // add this entry to array $this -> datasec[] = $fr; // now add to central directory record $cdrec = "\x50\x4b\x01\x02"; $cdrec .= "\x00\x00"; // version made by $cdrec .= "\x14\x00"; // version needed to extract $cdrec .= "\x00\x00"; // gen purpose bit flag $cdrec .= "\x08\x00"; // compression method $cdrec .= $hexdtime; // last mod time & date $cdrec .= pack('V', $crc); // crc32 $cdrec .= pack('V', $c_len); // compressed filesize $cdrec .= pack('V', $unc_len); // uncompressed filesize $cdrec .= pack('v', strlen($name) ); // length of filename $cdrec .= pack('v', 0 ); // extra field length $cdrec .= pack('v', 0 ); // file comment length $cdrec .= pack('v', 0 ); // disk number start $cdrec .= pack('v', 0 ); // internal file attributes $cdrec .= pack('V', 32 ); // external file attributes - 'archive' bit set $cdrec .= pack('V', $this -> old_offset ); // relative offset of local header $this -> old_offset += strlen($fr); $cdrec .= $name; // optional extra field, file comment goes here // save to central directory $this -> ctrl_dir[] = $cdrec; } // end of the 'addFile()' method function file() { $data = implode('', $this -> datasec); $ctrldir = implode('', $this -> ctrl_dir); return $data . $ctrldir . $this -> eof_ctrl_dir . pack('v', sizeof($this -> ctrl_dir)) . // total # of entries "on this disk" pack('v', sizeof($this -> ctrl_dir)) . // total # of entries overall pack('V', strlen($ctrldir)) . // size of central dir pack('V', strlen($data)) . // offset to start of central dir "\x00\x00"; // .zip file comment length } // end of the 'file()' method function addFiles($files ) { foreach($files as $file) { if (is_file($file)) //directory check { $data = implode("",file($file)); $this->addFile($data,$file); } } } function output($file) { $fp=fopen($file,"w"); fwrite($fp,$this->file()); fclose($fp); } } // end of the 'zipfile' class ?> It creates zip file but when i try to open it on Mac os x snow leopard and windows 7, it doesnt open. on mac i had this error: Error 1: operation not permitted Any idea ? thanks

  Read the article

• pass an ID with hyperlik but cant get this ID value from a fk in one table when i click in insert

  - by susan

  Something strange happened in my codes, actually I have a hyperlink that pass ID value in a query string to second page.in second page i have 2 sql datasource that both these sql datasources should get this id value and pass it to a filter parameter to show sth in datalist. so in another word I have a first page that has an hyperlink read ID value from a datasource and pass it to second page.its like below: <asp:HyperLink ID="HyperLink1" runat="server" NavigateUrl='<%# "~/forumpage.aspx?ID="+Eval("ID")%>'><%#Eval("title")%> </asp:HyperLink> then in second page i have one sql datasource with a query like this ...where ID=@id and get this id in query string from db.it work great . but i have problem with second sql datasource in second page it has a query sth like below:...forms.question_id=@id then in sql reference both to query string as ID that get by first page in hyperlink. but when i click in insert button show me error with fk. error:Error:The INSERT statement conflicted with the FOREIGN KEY constraint "FK_forumreply_forumquestions". The conflict occurred in database "forum", table "dbo.forumquestions", column 'ID'. The statement has been terminated. my tables (question(ID,user_id(fk),Cat_id(fk),title,bodytext) (reply(ID,userr_id(fk),questionn_id(fk),titlereply,bodytestreply); When by hand in cb i gave a number in questionn_id like 1 it show me successful but when it want read from a filter by datasource this field face with problem. plzzzz help i really need skip from this part.and cause i am new i guess I cant understand the logic way clearly. <asp:SqlDataSource ID="sdsreply" runat="server" ConnectionString="<%$ ConnectionStrings:forumConnectionString %>" SelectCommand="SELECT forumreply.ID, forumreply.userr_id, forumreply.questionn_id, forumreply.bodytextreply, forumreply.datetimereply, forumquestions.ID AS Expr1, forumusers.ID AS Expr2, forumusers.username FROM forumquestions INNER JOIN forumreply ON forumquestions.ID = forumreply.questionn_id INNER JOIN forumusers ON forumquestions.user_id = forumusers.ID AND forumreply.userr_id = forumusers.ID where forumreply.questionn_id=@questionn_id"> <SelectParameters> <asp:QueryStringParameter Name="questionn_id" QueryStringField="ID" /> </SelectParameters> </asp:SqlDataSource> it is cb for second page in insert button: { if (Session["userid"] != null) { lblreply.Text = Session["userid"].ToString(); } else { Session["userid"]=null; } if (HttpContext.Current.User.Identity.IsAuthenticated) { lblshow.Text = string.Empty; string d = HttpContext.Current.User.Identity.Name; lblshow.Text =d + "???? ??? ?????." ; foreach (DataListItem item in DataList2.Items) { Label questionn_idLabel = (Label)item.FindControl("questionn_idLabel"); Label userr_idLabel = (Label)item.FindControl("userr_idLabel"); lbltest.Text = string.Empty; lbltest.Text = questionn_idLabel.Text; lblreply.Text = string.Empty; lblreply.Text = userr_idLabel.Text; } } else { lblshow.Text = "??? ??? ??? ??? ?? ?? ?????? ???? ???? ???? ????? ??? ??? ? ??? ????? ???????."; } } { if(HttpContext.Current.User.Identity.IsAuthenticated) { if (Page.IsValid) { SqlConnection con = new SqlConnection(ConfigurationManager.ConnectionStrings["forumConnectionString"].ConnectionString); try { con.Open(); SqlCommand cmd = new SqlCommand("insert into forumreply (userr_id,questionn_id,bodytextreply,datetimereply)values(@userr_id,@questionn_id,@bodytextreply,@datetimereply)", con); cmd.Parameters.AddWithValue("userr_id",lblreply.Text); cmd.Parameters.AddWithValue("questionn_id",lbltest.Text); cmd.Parameters.AddWithValue("bodytextreply",txtbody.Text); cmd.Parameters.AddWithValue("datetimereply",DateTime.Now ); cmd.ExecuteNonQuery(); } catch (Exception exp) { Response.Write("<b>Error:</b>"); Response.Write(exp.Message); } finally { con.Close(); } lblmsg.Text = "???? ??? ?? ?????? ??? ?????.thx"; lblshow.Visible = false; //lbltxt.Text = txtbody.Text; txtbody.Text = string.Empty; } } else { lblmsg.Text = string.Empty; Session["rem"] = Request.UrlReferrer.AbsoluteUri; Response.Redirect("~/login.aspx"); } }

  Read the article

• Loop through hex variable in C

  - by Jud Stephenson

  I have the following code in a project that write's the ascii representation of packet to a unix tty: int written = 0; int start_of_data = 3; //write data to fifo while (length) { if ((written = write(fifo_fd, &packet[start_of_data], length)) == -1) { printf("Error writing to FIFO\n"); } else { length -= written; } } I just want to take the data that would have been written to the socket and put it in a variable. to debug, I have just been trying to printf the first letter/digit. I have tried numerous ways to get it to print out, but I keep getting hex forms (I think). The expected output is: 13176 and the hex value is: 31 33 31 37 36 0D 0A (if that is even hex) Obviously my C skills are not the sharpest tools in the shed. Any help would be appreciated.

  Read the article

• Creating a Large Matrix in ff

  - by Ryan Rosario

  I am trying to create a huge matrix in ff, and I know that ff is good for this sort of thing. But, there is a major problem. The dimensions of the matrix exceed .Machine$max_integer! I am running on a 64 bit machine, using 64bit R and 64bit ff. Is there any way to get around this problem? It's been suggested that R is using the MAXINT value from stdint.h. Is there any way to fix this without changing that file and possibly breaking build? > ffMatrix <- ff(vmode="boolean", dim=c(1e10,1e10)) Error in if (length < 0 || length > .Machine$integer.max) stop("length must be between 1 and .Machine$integer.max") : missing value where TRUE/FALSE needed In addition: Warning message: In ff(vmode = "boolean", dim = c(1e+10, 1e+10)) : NAs introduced by coercion > 1e+10 > .Machine$integer.max [1] TRUE

  Read the article

• Embed font in a mac bundle

  - by RW

  I have a program I am writing. I want to use a fancy font. Can I just embed my font into my bundle and use it from there. My code... NSMutableAttributedString *recOf; recOf = [[NSMutableAttributedString alloc] initWithString:@"In Recognition of"]; length = [recOf length]; [recOf addAttribute:NSFontAttributeName value:[NSFont fontWithName:@"Edwardian Script ITC" size:50] range:NSMakeRange(0, length)]; [[NSColor blackColor] set]; p.x = (bounds.size.width/2)- (([recOf size].width)/2); p.y = (bounds.size.height/1.7); [recOf drawAtPoint:p]; [recOf release];

  Read the article

• Good conventions for embedding schema of a flat file

  - by Ville Koskinen

  We receive lots of data as flat files: delimitted or just fixed length records. It's sometimes hard to find out what the files actually contain. Are there any well established practices for embedding the schema of the file to the beginning or the end of a file to make the file self-explanatory? Just to get an idea, imagine something like this: <data name=test records=2 type=fixed> <field name=foo start=0 length=2 type=numeric> <field name=bar start=2 length=4 type=text> </data> 11test 12ing We would parse the xml in the beginning and use it for reading the records.

  Read the article

• Delphi DateTimeFormat returning wrong year

  - by Leslie

  I have a form that allows users to enter a date of birth: ie: 4/16/40 Then when the user processes the form there's a function that checks it's length, adds leading zeros, parses the date and then uses FormatDateTime to just return the year of birth: strTemp := strPostedByDOB; If Length(strTemp) = 5 then strTemp = '0' + strTemp; if Length(strTemp) = 6 then begin strTemp := Copy(strTemp, 1 ,2) + '/' + copy(strTemp, 3, 2) + '/' + Copy(strTemp, 5, 2); strTemp := FormatDateTime('YYYY', StrToDate(strTemp)); end else strTemp := EmptyStr; using this code the strTemp is calculated as 2040 instead of 1940. Can anyone help me figure out how to make it show 1940 in strTemp? Do I have to change the form to accept a 4 digit year? Thanks, Leslie

  Read the article

• Ruby: what the hell does this code saying ????

  - by wefwgeweg

  i discovered this in a dark place one day...what the hell is it supposed to do ?? def spliceElement(newelement,dickwad) dox = Nokogiri::HTML(newelement) fuck = dox.xpath("//text()").to_a fuck.each do |shit| if shit.text.include? ": " dickwad << shit.text.split(': ')[1].strip + "|" else if shit.text =~ /\s{1,}/ or shit.text =~ /\n{1,}/ puts "fuck" else dickwad << shit.text.squeeze(" ").strip + "|" end end end dickwad << "\n" end def extract(newdoc, newarray) doc = Nokogiri::HTML(newdoc) collection = Array.new newarray.each do |dong| newb = doc.xpath(dong).to_a #puts doc.xpath(dong).text collection << newb end dickwad = ""; if collection.length > 1 (0...collection.first.length).each do |i| (0...collection.length).each do |j| somefield = collection[j][i].to_s.gsub(/\s{2,}/,' ') spliceElement(somefield, dickwad) end newrow = dickwad.chop + "\n" return newrow.to_s end else collection.first.each do |shit| somefield = shit.to_s.gsub(/\s{2,}/,' ') spliceElement(somefield, dickwad) puts somefield + "\n\n" #newrow = dickwad.chop + "\n" #puts newrow #return newrow.to_s sleep 1 end end

  Read the article

• In Haskell, how can you sort a list of infinite lists of strings?

  - by HaskellNoob

  So basically, if I have a (finite or infinite) list of (finite or infinite) lists of strings, is it possible to sort the list by length first and then by lexicographic order, excluding duplicates? A sample input/output would be: Input: [["a", "b",...], ["a", "aa", "aaa"], ["b", "bb", "bbb",...], ...] Output: ["a", "b", "aa", "bb", "aaa", "bbb", ...] I know that the input list is not a valid haskell expression but suppose that there is an input like that. I tried using merge algorithm but it tends to hang on the inputs that I give it. Can somebody explain and show a decent sorting function that can do this? If there isn't any function like that, can you explain why? In case somebody didn't understand what I meant by the sorting order, I meant that shortest length strings are sorted first AND if one or more strings are of same length then they are sorted using < operator. Thanks!

  Read the article

• SQL CHECK constraint issues

  - by blahblah

  I'm using SQL Server 2008 and I have a table with three columns: Length, StartTime and EndTime. I want to make a CHECK constraint on this table which says that: if Length == NULL then StartTime <> NULL and EndTime <> NULL else StartTime == NULL and EndTime == NULL I've begun to try things like this: Length == NULL AND StartTime <> NULL AND EndTime <> NULL Obviously this is not enough, but even this simple expression will not validate. I get the error: "Error validating 'CK_Test_Length_Or_Time'. Do you want to edit the constraint?" Any ideas on how to go about doing this?

  Read the article

• getting a key out of a javascript hash

  - by mcintyre321

  I working with the latest draft of the twitter annotations api. An example bit of data looks like status { annotations : [ {myAnnotationType:{myKey:myValue}}, {someoneElsesAnnotationType:{theirKey:theirValue}}, ] } now i want to check a status to see if it has an annotation with myAnnotationType in it. If annotations was a hash instead of an array I could just write var ann = status.annotations.myAnnotationType. But its not so I wrote this instead: function getKeys(obj){ var keys = []; for (key in obj) { if (obj.hasOwnProperty(key)) { keys[keys.length] = key; } } return keys; } function getAnnotation(status, type){ for(var i=0;i<status.annotations.length;i++){ var keys = getKeys(status.annotations[i]); for(var j=0;j<keys.length;j++){ if(keys[j] == type){ return status.annotations[i]; } } } } var ann = getAnnotation(status, "myAnnotationType"); There must be a better way! Is there? PS I can't use jquery or anything as this is js to be used in a caja widget and the container doesn't support external libs

  Read the article

• For Loop help In a Hash Cracker Homework.

  - by aaron burns

  On the homework I am working on we are making a hash cracker. I am implementing it so as to have my cracker. java call worker.java. Worker.java implements Runnable. Worker is to take the start and end of a list of char, the hash it is to crack, and the max length of the password that made the hash. I know I want to do a loop in run() BUT I cannot think of how I would do it so it would go to the given max pasword length. I have posted the code I have so far. Any directions or areas I should look into.... I thought there was a way to do this with a certain way to write the loop but I don't know or can't find the correct syntax. Oh.. also. In main I divide up so x amount of threads can be chosen and I know that as of write now it only works for an even number of the 40 possible char given. package HashCracker; import java.util.*; import java.security.MessageDigest; import java.security.NoSuchAlgorithmException; public class Cracker { // Array of chars used to produce strings public static final char[] CHARS = "abcdefghijklmnopqrstuvwxyz0123456789.,-!".toCharArray(); public static final int numOfChar=40; /* Given a byte[] array, produces a hex String, such as "234a6f". with 2 chars for each byte in the array. (provided code) */ public static String hexToString(byte[] bytes) { StringBuffer buff = new StringBuffer(); for (int i=0; i<bytes.length; i++) { int val = bytes[i]; val = val & 0xff; // remove higher bits, sign if (val<16) buff.append('0'); // leading 0 buff.append(Integer.toString(val, 16)); } return buff.toString(); } /* Given a string of hex byte values such as "24a26f", creates a byte[] array of those values, one byte value -128..127 for each 2 chars. (provided code) */ public static byte[] hexToArray(String hex) { byte[] result = new byte[hex.length()/2]; for (int i=0; i<hex.length(); i+=2) { result[i/2] = (byte) Integer.parseInt(hex.substring(i, i+2), 16); } return result; } public static void main(String args[]) throws NoSuchAlgorithmException { if(args.length==1)//Hash Maker { //create a byte array , meassage digestand put password into it //and get out a hash value printed to the screen using provided methods. byte[] myByteArray=args[0].getBytes(); MessageDigest hasher=MessageDigest.getInstance("SHA-1"); hasher.update(myByteArray); byte[] digestedByte=hasher.digest(); String hashValue=Cracker.hexToString(digestedByte); System.out.println(hashValue); } else//Hash Cracker { ArrayList<Thread> myRunnables=new ArrayList<Thread>(); int numOfThreads = Integer.parseInt(args[2]); int charPerThread=Cracker.numOfChar/numOfThreads; int start=0; int end=charPerThread-1; for(int i=0; i<numOfThreads; i++) { //creates, stores and starts threads. Runnable tempWorker=new Worker(start, end, args[1], Integer.parseInt(args[1])); Thread temp=new Thread(tempWorker); myRunnables.add(temp); temp.start(); start=end+1; end=end+charPerThread; } } } import java.util.*; public class Worker implements Runnable{ private int charStart; private int charEnd; private String Hash2Crack; private int maxLength; public Worker(int start, int end, String hashValue, int maxPWlength) { charStart=start; charEnd=end; Hash2Crack=hashValue; maxLength=maxPWlength; } public void run() { byte[] myHash2Crack_=Cracker.hexToArray(Hash2Crack); for(int i=charStart; i<charEnd+1; i++) { Cracker.numOfChar[i]////// this is where I am stuck. } } }

  Read the article

• What is the sense of permiting the user to use no passwords longer than xx chars?

  - by reox

  Its more like a usability question or maybe database, or even maybe security (consider injection attacks) but what is the sense of permiting the user's password to a be not longer than xx chars? It does not make any sense to me, because longer passwords are mostly considered better and even harder to crack, and some users use password safes, so the password length should not matter. I understand that passwords with more than 20 chars are hardly to remember, but if you use diceware or password safe you dont have any problem with that. I really cant understand why there are sites that say "your password need to be between 5 and 8 chars"... also should the password saved as hash, so the length of the field in the database is fixed, so where is the problem? i think that most of the sites where the password is has to be a fixed length are not even using any hashing method...

  Read the article

• Reading HttpURLConnection InputStream - manual buffer or BufferedInputStream?

  - by stormin986

  When reading the InputStream of an HttpURLConnection, is there any reason to use one of the following over the other? I've seen both used in examples. Manual Buffer: while ((length = inputStream.read(buffer)) > 0) { os.write(buf, 0, ret); } BufferedInputStream is = http.getInputStream(); bis = new BufferedInputStream(is); ByteArrayBuffer baf = new ByteArrayBuffer(50); int current = 0; while ((current = bis.read()) != -1) { baf.append(current); } EDIT I'm still new to HTTP in general but one consideration that comes to mind is that if I am using a persistent HTTP connection, I can't just read until the input stream is empty right? In that case, wouldn't I need to read the message length and just read the input stream for that length? And similarly, if NOT using a persistent connection, is the code I included 100% good to go in terms of reading the stream properly?

  Read the article

• XNA Music mixing real-time

  - by Adam L. S.

  I've created a "format" to store segments of music (prelude part, repeated part, ending part) and time information for these segments (offset, scored length) so I can mix it up in real-time as if it were one piece of music, while repeating the repeated part (optionally) indefinitely. This way, the segments can store decay where the next segment is played, while the previous one is finished. (I've created a player for this in Java, and used the Clip class.) I wanted this format, so I can provide a finite length music (for a jukebox feature), while I play infinite length music in-games. However, when I wanted to code a class in XNA that manages this "format" I've noticed, that there is no obvious way to play "Songs" simultaneously/overlapped. How can I do this/what is the best practice, not leaving the XNA framework? (I don't want to create infinite play-lists.)

  Read the article

• Randomized experiments in R

  - by gd047

  Here is a simple randomized experiment. In the following code I calculate the p-value under the null hypothesis that two different fertilizers applied to tomato plants have no effect in plants yields. The first random sample (x) comes from plants where a standard fertilizer has been used, while an "improved" one has been used in the plants where the second sample (y) comes from. x <- c(11.4,25.3,29.9,16.5,21.1) y <- c(23.7,26.6,28.5,14.2,17.9,24.3) total <- c(x,y) first <- combn(total,length(x)) second <- apply(first,2,function(x) total[!total %in% x]) dif.treat <- apply(second,2,mean) - apply(first,2,mean) # the first element of dif.treat is the one that I'm interested in (p.value <- length(dif.treat[dif.treat >= dif.treat[1]]) / length(dif.treat)) Do you know of any R function that performs tests like this one?

  Read the article

• Best practise question

  - by sid_com

  Hello! With version would you prefer? #!/usr/bin/env perl use warnings; use strict; use 5.010; my $p = 7; # 33 my $prompt = ' : '; my $key = 'very important text'; my $value = 'Hello, World!'; my $length = length $key . $prompt; $p -= $length; Option 1: $key = $key . ' ' x $p . $prompt; Option 2: if ( $p > 0 ) { $key = $key . ' ' x $p . $prompt; } else { $key = $key . $prompt; } say "$key$value"

  Read the article

• Sending big file by webservice and OOM exception

  - by phenevo

  Hi, I have webservice, with method: [WebMethod] public byte[] GetFile(string FName) { System.IO.FileStream fs1 = null; fs1 = System.IO.File.Open(FName, FileMode.Open, FileAccess.Read); byte[] b1 = new byte[fs1.Length]; fs1.Read(b1, 0, (int)fs1.Length); fs1.Close(); return b1; } and it works with small file like 1mb, but when it comes to photoshop's file (about 1,5gb) I get: System.OutOfMemoryException on this line: Byte[] img = new Byte[fs.Length]; The idea is I have winforms application which get this file and saving it on local disc.

  Read the article

• Python 3.1 - Memory Error during sampling of a large list

  - by jimy

  The input list can be more than 1 million numbers. When I run the following code with smaller 'repeats', its fine; def sample(x): length = 1000000 new_array = random.sample((list(x)),length) return (new_array) def repeat_sample(x): i = 0 repeats = 100 list_of_samples = [] for i in range(repeats): list_of_samples.append(sample(x)) return(list_of_samples) repeat_sample(large_array) However, using high repeats such as the 100 above, results in MemoryError. Traceback is as follows; Traceback (most recent call last): File "C:\Python31\rnd.py", line 221, in <module> STORED_REPEAT_SAMPLE = repeat_sample(STORED_ARRAY) File "C:\Python31\rnd.py", line 129, in repeat_sample list_of_samples.append(sample(x)) File "C:\Python31\rnd.py", line 121, in sample new_array = random.sample((list(x)),length) File "C:\Python31\lib\random.py", line 309, in sample result = [None] * k MemoryError I am assuming I'm running out of memory. I do not know how to get around this problem. Thank you for your time!

  Read the article

< Previous Page | 406 407 408 409 410 411 412 413 414 415 416 417  | Next Page >