Search Results

Search found 45013 results on 1801 pages for 'example'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 411/1801 | < Previous Page | 407 408 409 410 411 412 413 414 415 416 417 418  | Next Page >

  • Spamassassin one-liner to tag & move mail with an X-Spam-Flag: YES to a new directory?

    - by ane
    Say you have a directory with tens of thousands of messages in it. And you want to separate the spam from the non-spam. Specifically, you would like to: Run spamassassin against the directory, tagging each message with an X-Spam-Flag: YES if it thinks it's spam Have a tcsh shell or perl one-liner grep all mail with the flag and move those mails to /tmp/spam What command can you run to accomplish this? For example, some pseudocode: /usr/local/bin/spamassassin -eL ./Maildir/cur/* | grep "X-Spam-Flag: YES" | mv %1 /tmp/spam

    Read the article

  • Changing labels language in LibreOffice

    - by clabacchio
    I'm using the Italian version of LibreOffice 4.0.4, and writing a document in English. I set English as document language, and the spellchecking works properly. However, when I insert captions and cross references, the labels are in italian. For example Tabella instead of Table. What should I change in order to have the proper labeling, besides installing an English version of LibreOffice Writer??

    Read the article

  • Excel 2007: plot data points not on an axis/ force linear x-incrementation without altering integrity of non-linear data

    - by Ennapode
    In Excel, how does one go about plotting points that don't have an x component that is an x-axis label? For example, in my graph, the x-components are derived from the cosine function and aren't linear, but Excel is displaying them as if .0016 to .0062 to .0135 is an equal incrementation. How would I change this so that the x-axis has an even incrementation without altering the integrity of the points themselves? In other words, how do I plot a point with an x component independent from the x-axis label?

    Read the article

  • Program that groups windows into tabs

    - by Arithmomaniac
    I recall once stumbling on a program that could take multiple application windows and wrap them inside a large window with a tabbed interface. One use of this, for example, would be to wrap multiple instances of Excel into one window, and thus icon on the taskbar. I couldn't find mention of this program via Google, because of the multiple meanings of the word "window". Does anyone remember, or know of, such a program?

    Read the article

  • Puppet, secret fatcs

    - by black_rez
    I manage servers with a puppet master and I use Foreman for visualisation. Because of specific regulation, the only access I have is the puppet agent for configuration and some informations can't be visualized by foreman and the master can't store this information. For example, the puppet agent need to get a secret variable (a password store in a file). How I can get it without know this variable? Also I need to keep reports because I want to know what happen on the server.

    Read the article

  • Is it possible to upgrade from a clean install in Windows 8?

    - by Misha
    Does Windows 8 support upgrading from a clean install. For example, buying the upgrade key and entering it on a clear install? Or is it functionally necissary to have the version you are upgrading from installed on the computer. The former was the case with Windows 7, but I recal Windows 2000 needed the an installed copy before an update would proceed. I currently have a linux setup and I have the liceanse for Windows 7, but I don't want to have to downoad two 4 GB isos.

    Read the article

  • Is it possible to change or override the default keyboard shortcuts in Finder?

    - by super
    I would like to override the keyboard-shortcut for a particular built-in action in finder (OS X 10.6.7). An example would be to override the Cmd+N for a New Finder Window to some other action, say Open a blank Text document. I can create the service for opening a blank Text document in automator - and I can map a new keyboard shortcut for this - but the new keyboard shortcut will not override a default keyboard shortcut. I do not want to install any 3rd party applications (like QuickSilver).

    Read the article

  • Automatic installation of Adobe Framemaker 12

    - by YannD
    With Adobe Framemaker XI, We could use Adobe Application Manager Enterprise Edition v3.1 to embed the serial number and pre-validate the sign-in option. An MSI was generated, and then an automatic installation could be performed, for enterprise deployments for example. It seems Adobe Application manager v3.1 is not working with Adobe Framemaker 12. Is there any way to create a customized installation package, or any command line to use? Thanks in advance YannD.

    Read the article

  • ksh + printf stat gap of print

    - by yael
    need to print the follwoing: need smart way by printf to pring this example param1 ............... value1 param2 ............... value2 param3 ............... value1 param4 ............... value2 THX

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

  • Any tool available to make renaming in Windows XP more like Mac OS X?

    - by alex
    I've noticed 1 cool thing and OS X. When you rename a file, it automatically selects everything up until the extension. For example, attempting to rename this.is.a.file.png would preselect this.is.a.file allowing you to quickly rename it whilst preserving the extension. I know I could turn off 'show extensions for known file types', but I like to have them visible. Is there any software that can do this? Thanks

    Read the article

  • Static route toward a DNS Address, it is possible ?

    - by aleroot
    I need to add a static route on a windows server toward a web server with a service, i need to add a static route with this command on windows command prompt : ROUTE ADD -p IPADREESS GATEWAYIP Is there a way to do a static route toward a DNS address instead of a IP Address ? How ? For example : ROUTE ADD -p DNSServer GATEWAYIP

    Read the article

  • What's the most compact way to store a password-protected RSA key?

    - by Tim
    I've tried converting a PEM-encoded key to DER format, and it appears the password is stripped regardless of the -passout argument. Example: openssl rsa -in tmp.pem -outform DER -out tmp.der -passin pass:foo -passout pass:bar -des3 The resulting key appears no longer password-protected, so I am assuming that DER format does not support a password - is that correct? What alternative way is there to store this in a compact, binary form, and keep the password-protection?

    Read the article

  • Company's logo on Facebook Apps

    - by Iuri Sampaio
    Since a few months ago I've struggling to find a good source explaning how to have my website logo on the facebook apps I attach on my website. In the link bellow (grabbed from facebook website) we can see a fair example of a Share app, with logo, title and description. https://www.facebook.com/sharer/sharer.php?u=https://parse.com I already completed app's profile with all kinds of information the forms have. What do I need to do to show my logo on facebook apps? Best wishes, Iuri

    Read the article

  • FTP script needs blank line

    - by Ones and Zeroes
    I am trying to determine the reason for some FTP servers requiring a blank line in the script as follows: open server.com username ftp_commands bye Refer to blank line required after username credentials. Example from: FTP from batch file another reference to the same: http://newsgroups.derkeiler.com/Archive/Comp/comp.sys.ibm.as400.misc/2008-05/msg00227.html Also discussed here: archive.midrange.com/midrange-l/200601/msg00048.html "The behavior I'm observing is the same as if I didn't specify the password to login." with an answer referring to our same fix... archive.midrange.com/midrange-l/200601/msg00053.html and archive.midrange.com/midrange-l/200601/msg00065.html Note: It is my experience that FTP questions attract uncouth responses. Admittedly FTP is outdated, but many clients still have legacy systems, which they cannot upgrade or replace. The reason thereof should not be discussed here. The intention of this question is to invite a positive response. Please do not respond if you disagree with the above. If you have never encountered this same issue, please do not respond. I suspect this may be limited to FTP scripts executed from Windows machines, but have been told that this happens often and with many different servers. My specific interest is to understand what may cause this as I have a real world example of a production system suddenly requiring this as a workaround fix, after running for many years without issue. The server belongs to a third party who claims no change on their end. Server details unknown and cannot be determined. Any help or encouragement from someone who has come across the same, would be appreciated. ps. Sorry for the many words and references to painful responses, but I have asked similar questions on serverfault and elsewhere and unfortunately got back kneejerk responses to FTP and respondents debating the validity of the question. I would truly not ask, or re-post this question online if I had a better understanding of the issue. I know of people who have seen this issue, but don't know what causes it. I am wary that this question would again turn into another irrelevant discussion. Please, I ask very nicely: Please do not respond if you have not encountered a similar issue. FURTHER EDIT: Please do not suggest changing the product. The problem is not the blank line requirement. We know this fixes the issue. The problem is not being able to explain the reason for the blank line in the first place. Slight difference, but a critical point to note wrt the answering of this question.

    Read the article

  • convert video to images

    - by Liam
    How can I convert a video file to a sequence of images, for example one frame every N seconds. Can mplayer or ffmpeg do this? I have used MPlayer to grab screenshots manually but I would like to automate this for a long video.

    Read the article

  • How to enable WordPress to have multiple sites without a re-direct

    - by user57039
    I'm using WordPress to manage my site and when the site does a re-direct, it slows down performance. For example, WordPress allows you a single default site, www.mycompany.com. If a user goes to mycompany.com, WP will re-direct it www.mycompany.com. Is there a way to configure WP so that it will listen on both www.mycompany.com and mycompany.com without redirects. The redirects are causing performance hits to the site.

    Read the article

  • Is there a GraphicsMagick equivalent to ImageMagick's image stack?

    - by naivedeveloper
    Although GraphicsMagick is a fork of ImageMagick, there are dissimilarities between the two, namely in the support of image stacking in ImageMagick, but not in GraphicsMagick. Taken from the ImageMagick documentation: convert wand.gif \( wizard.gif -rotate 30 \) +append images.gif In this example, the rotate command is applied only to the wizard.gif resource. My question is: Is there an equivalent to image stacking in GraphicsMagick?

    Read the article

  • Postfix $smtpd_banner rules

    - by horen
    For monitoring purposes I would like to add the IP address to the Postfix smtpd_banner: smtpd_banner = $myhostname ESMTP $smtp_bind_address which works and outputs: 220 mail.mydomain.com ESMTP 123.456.789.0 Now I am wondering if there are any (negative) repercussions to expect. I couldn't find anything about it in the RFC docs. The Postfix docs add another parameter ($mail_name) in their example, so I think I am fine. I just want to verify that my syntax is correct and is allowed.

    Read the article

  • Adding addresses to ActiveDirectory with Thunderbird

    - by Fa3ien
    We use a Windows 2003 server and XP stations. The server's LDAP is working ok, as I am able to retrieve the addresses it contains with Thunderbird. I'd like to be able to ADD an address to the server's book (the address of a new contact that freshly wrote me, for example) directly from Thunderbird, but that doesn't seem possible. What can I do ?

    Read the article

  • Is there a keyboard shortcut to close windows from the Windows 7 taskbar window selector?

    - by Richard Szalay
    If, for example, Windows Explorer is in the first position of the taskbar and there are multiple explorer windows open, holding START and pressing 1 will cycle through the available windows and display an x on the top-right of the selected item that can be clicked to close the window. Is there a keyboard shortcut to close the selected window while still keeping the window list around (moving to the next item)?

    Read the article

  • Powerpoint: control image sequence with a slider

    - by Mat
    I have an image sequence (10 images) that step by step visualize the construction of something. I'd like to include these images into my powerpoint presentation in such a way that i can step between them by moving a slider below the image, similar to the timebar of a movie player (in quicktime for example you can step through a move file frame by frame by moving the bar on the bottom). What's the easiest way to do this with Microsoft Powerpoint 2010?

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 407 408 409 410 411 412 413 414 415 416 417 418  | Next Page >