Search Results

Search found 85897 results on 3436 pages for 'flat file source'.

Page 42/3436 | < Previous Page | 38 39 40 41 42 43 44 45 46 47 48 49  | Next Page >

  • Windows 7 delayed file delete

    - by GregoryM
    I'm stuck with a pretty rare problem that happens on Windows 7 OS only. Every time I'm deleting the file with *.exe extension through explorer, the file doesn't get deleted immediately. I'm forced to wait for around one-two minutes before the system will delete the file. The main problem is that I cannot develop in such situation, because every time I build my solution, the old executable gets 'deleted', but is still there. So the new one cannot be created by Visual Studio. This problem breaks the Steam update progress and a few other installers functionality too. Fresh installed Win7 doesn't have this kind of trouble, so I guess this must be some bad registry entries or some services. Browsing the internet for solutions I found only this: http://www.sevenforums.com/software/72091-several-minute-delay-when-deleting-any-exe-file.html. But the solution the author found is not working (change the userName :)). Is there any ideas how to find what causes this to happen? BTW: when I place the file into Trash bin, no delay occurs. When I delete file with Total Commander - no delay too. Tech details: Windows 7 x64 Ultimate.

    Read the article

  • Windows 7 delayed file delete

    - by GregoryM
    I'm stuck with a pretty rare problem that happens on Windows 7 OS only. Every time I'm deleting the file with *.exe extension through explorer, the file doesn't get deleted immediately. I'm forced to wait for around one-two minutes before the system will delete the file. The main problem is that I cannot develop in such situation, because every time I build my solution, the old executable gets 'deleted', but is still there. So the new one cannot be created by Visual Studio. This problem breaks the Steam update progress and a few other installers functionality too. Fresh installed Win7 doesn't have this kind of trouble, so I guess this must be some bad registry entries or some services. Browsing the internet for solutions I found only this: http://www.sevenforums.com/software/72091-several-minute-delay-when-deleting-any-exe-file.html. But the solution the author found is not working (change the userName :)). Is there any ideas how to find what causes this to happen? BTW: when I place the file into Trash bin, no delay occurs. When I delete file with Total Commander - no delay too. Tech details: Windows 7 x64 Ultimate. UPD: maybe some shadow copying or system restore services (though I have the system restore turned off) block the files? Can't even guess...

    Read the article

  • Source-control 'wet-work'?

    - by Phil Factor
    When a design or creative work is flawed beyond remedy, it is often best to destroy it and start again. The other day, I lost the code to a long and intricate SQL batch I was working on. I’d thought it was impossible, but it happened. With all the technology around that is designed to prevent this occurring, this sort of accident has become a rare event.  If it weren’t for a deranged laptop, and my distraction, the code wouldn’t have been lost this time.  As always, I sighed, had a soothing cup of tea, and typed it all in again.  The new code I hastily tapped in  was much better: I’d held in my head the essence of how the code should work rather than the details: I now knew for certain  the start point, the end, and how it should be achieved. Instantly the detritus of half-baked thoughts fell away and I was able to write logical code that performed better.  Because I could work so quickly, I was able to hold the details of all the columns and variables in my head, and the dynamics of the flow of data. It was, in fact, easier and quicker to start from scratch rather than tidy up and refactor the existing code with its inevitable fumbling and half-baked ideas. What a shame that technology is now so good that developers rarely experience the cleansing shock of losing one’s code and having to rewrite it from scratch.  If you’ve never accidentally lost  your code, then it is worth doing it deliberately once for the experience. Creative people have, until Technology mistakenly prevented it, torn up their drafts or sketches, threw them in the bin, and started again from scratch.  Leonardo’s obsessive reworking of the Mona Lisa was renowned because it was so unusual:  Most artists have been utterly ruthless in destroying work that didn’t quite make it. Authors are particularly keen on writing afresh, and the results are generally positive. Lawrence of Arabia actually lost the entire 250,000 word manuscript of ‘The Seven Pillars of Wisdom’ by accidentally leaving it on a train at Reading station, before rewriting a much better version.  Now, any writer or artist is seduced by technology into altering or refining their work rather than casting it dramatically in the bin or setting a light to it on a bonfire, and rewriting it from the blank page.  It is easy to pick away at a flawed work, but the real creative process is far more brutal. Once, many years ago whilst running a software house that supplied commercial software to local businesses, I’d been supervising an accounting system for a farming cooperative. No packaged system met their needs, and it was all hand-cut code.  For us, it represented a breakthrough as it was for a government organisation, and success would guarantee more contracts. As you’ve probably guessed, the code got mangled in a disk crash just a week before the deadline for delivery, and the many backups all proved to be entirely corrupted by a faulty tape drive.  There were some fragments left on individual machines, but they were all of different versions.  The developers were in despair.  Strangely, I managed to re-write the bulk of a three-month project in a manic and caffeine-soaked weekend.  Sure, that elegant universally-applicable input-form routine was‘nt quite so elegant, but it didn’t really need to be as we knew what forms it needed to support.  Yes, the code lacked architectural elegance and reusability. By dawn on Monday, the application passed its integration tests. The developers rose to the occasion after I’d collapsed, and tidied up what I’d done, though they were reproachful that some of the style and elegance had gone out of the application. By the delivery date, we were able to install it. It was a smaller, faster application than the beta they’d seen and the user-interface had a new, rather Spartan, appearance that we swore was done to conform to the latest in user-interface guidelines. (we switched to Helvetica font to look more ‘Bauhaus’ ). The client was so delighted that he forgave the new bugs that had crept in. I still have the disk that crashed, up in the attic. In IT, we have had mixed experiences from complete re-writes. Lotus 123 never really recovered from a complete rewrite from assembler into C, Borland made the mistake with Arago and Quattro Pro  and Netscape’s complete rewrite of their Navigator 4 browser was a white-knuckle ride. In all cases, the decision to rewrite was a result of extreme circumstances where no other course of action seemed possible.   The rewrite didn’t come out of the blue. I prefer to remember the rewrite of Minix by young Linus Torvalds, or the rewrite of Bitkeeper by a slightly older Linus.  The rewrite of CP/M didn’t do too badly either, did it? Come to think of it, the guy who decided to rewrite the windowing system of the Xerox Star never regretted the decision. I’ll agree that one should often resist calls for a rewrite. One of the worst habits of the more inexperienced programmer is to denigrate whatever code he or she inherits, and then call loudly for a complete rewrite. They are buoyed up by the mistaken belief that they can do better. This, however, is a different psychological phenomenon, more related to the idea of some motorcyclists that they are operating on infinite lives, or the occasional squaddies that if they charge the machine-guns determinedly enough all will be well. Grim experience brings out the humility in any experienced programmer.  I’m referring to quite different circumstances here. Where a team knows the requirements perfectly, are of one mind on methodology and coding standards, and they already have a solution, then what is wrong with considering  a complete rewrite? Rewrites are so painful in the early stages, until that point where one realises the payoff, that even I quail at the thought. One needs a natural disaster to push one over the edge. The trouble is that source-control systems, and disaster recovery systems, are just too good nowadays.   If I were to lose this draft of this very blog post, I know I’d rewrite it much better. However, if you read this, you’ll know I didn’t have the nerve to delete it and start again.  There was a time that one prayed that unreliable hardware would deliver you from an unmaintainable mess of a codebase, but now technology has made us almost entirely immune to such a merciful act of God. An old friend of mine with long experience in the software industry has long had the idea of the ‘source-control wet-work’,  where one hires a malicious hacker in some wild eastern country to hack into one’s own  source control system to destroy all trace of the source to an application. Alas, backup systems are just too good to make this any more than a pipedream. Somehow, it would be difficult to promote the idea. As an alternative, could one construct a source control system that, on doing all the code-quality metrics, would systematically destroy all trace of source code that failed the quality test? Alas, I can’t see many managers buying into the idea. In reading the full story of the near-loss of Toy Story 2, it set me thinking. It turned out that the lucky restoration of the code wasn’t the happy ending one first imagined it to be, because they eventually came to the conclusion that the plot was fundamentally flawed and it all had to be rewritten anyway.  Was this an early  case of the ‘source-control wet-job’?’ It is very hard nowadays to do a rapid U-turn in a development project because we are far too prone to cling to our existing source-code.

    Read the article

  • How to simulate inner join on very large files in java (without running out of memory)

    - by Constantin
    I am trying to simulate SQL joins using java and very large text files (INNER, RIGHT OUTER and LEFT OUTER). The files have already been sorted using an external sort routine. The issue I have is I am trying to find the most efficient way to deal with the INNER join part of the algorithm. Right now I am using two Lists to store the lines that have the same key and iterate through the set of lines in the right file once for every line in the left file (provided the keys still match). In other words, the join key is not unique in each file so would need to account for the Cartesian product situations ... left_01, 1 left_02, 1 right_01, 1 right_02, 1 right_03, 1 left_01 joins to right_01 using key 1 left_01 joins to right_02 using key 1 left_01 joins to right_03 using key 1 left_02 joins to right_01 using key 1 left_02 joins to right_02 using key 1 left_02 joins to right_03 using key 1 My concern is one of memory. I will run out of memory if i use the approach below but still want the inner join part to work fairly quickly. What is the best approach to deal with the INNER join part keeping in mind that these files may potentially be huge public class Joiner { private void join(BufferedReader left, BufferedReader right, BufferedWriter output) throws Throwable { BufferedReader _left = left; BufferedReader _right = right; BufferedWriter _output = output; Record _leftRecord; Record _rightRecord; _leftRecord = read(_left); _rightRecord = read(_right); while( _leftRecord != null && _rightRecord != null ) { if( _leftRecord.getKey() < _rightRecord.getKey() ) { write(_output, _leftRecord, null); _leftRecord = read(_left); } else if( _leftRecord.getKey() > _rightRecord.getKey() ) { write(_output, null, _rightRecord); _rightRecord = read(_right); } else { List<Record> leftList = new ArrayList<Record>(); List<Record> rightList = new ArrayList<Record>(); _leftRecord = readRecords(leftList, _leftRecord, _left); _rightRecord = readRecords(rightList, _rightRecord, _right); for( Record equalKeyLeftRecord : leftList ){ for( Record equalKeyRightRecord : rightList ){ write(_output, equalKeyLeftRecord, equalKeyRightRecord); } } } } if( _leftRecord != null ) { write(_output, _leftRecord, null); _leftRecord = read(_left); while(_leftRecord != null) { write(_output, _leftRecord, null); _leftRecord = read(_left); } } else { if( _rightRecord != null ) { write(_output, null, _rightRecord); _rightRecord = read(_right); while(_rightRecord != null) { write(_output, null, _rightRecord); _rightRecord = read(_right); } } } _left.close(); _right.close(); _output.flush(); _output.close(); } private Record read(BufferedReader reader) throws Throwable { Record record = null; String data = reader.readLine(); if( data != null ) { record = new Record(data.split("\t")); } return record; } private Record readRecords(List<Record> list, Record record, BufferedReader reader) throws Throwable { int key = record.getKey(); list.add(record); record = read(reader); while( record != null && record.getKey() == key) { list.add(record); record = read(reader); } return record; } private void write(BufferedWriter writer, Record left, Record right) throws Throwable { String leftKey = (left == null ? "null" : Integer.toString(left.getKey())); String leftData = (left == null ? "null" : left.getData()); String rightKey = (right == null ? "null" : Integer.toString(right.getKey())); String rightData = (right == null ? "null" : right.getData()); writer.write("[" + leftKey + "][" + leftData + "][" + rightKey + "][" + rightData + "]\n"); } public static void main(String[] args) { try { BufferedReader leftReader = new BufferedReader(new FileReader("LEFT.DAT")); BufferedReader rightReader = new BufferedReader(new FileReader("RIGHT.DAT")); BufferedWriter output = new BufferedWriter(new FileWriter("OUTPUT.DAT")); Joiner joiner = new Joiner(); joiner.join(leftReader, rightReader, output); } catch (Throwable e) { e.printStackTrace(); } } } After applying the ideas from the proposed answer, I changed the loop to this private void join(RandomAccessFile left, RandomAccessFile right, BufferedWriter output) throws Throwable { long _pointer = 0; RandomAccessFile _left = left; RandomAccessFile _right = right; BufferedWriter _output = output; Record _leftRecord; Record _rightRecord; _leftRecord = read(_left); _rightRecord = read(_right); while( _leftRecord != null && _rightRecord != null ) { if( _leftRecord.getKey() < _rightRecord.getKey() ) { write(_output, _leftRecord, null); _leftRecord = read(_left); } else if( _leftRecord.getKey() > _rightRecord.getKey() ) { write(_output, null, _rightRecord); _pointer = _right.getFilePointer(); _rightRecord = read(_right); } else { long _tempPointer = 0; int key = _leftRecord.getKey(); while( _leftRecord != null && _leftRecord.getKey() == key ) { _right.seek(_pointer); _rightRecord = read(_right); while( _rightRecord != null && _rightRecord.getKey() == key ) { write(_output, _leftRecord, _rightRecord ); _tempPointer = _right.getFilePointer(); _rightRecord = read(_right); } _leftRecord = read(_left); } _pointer = _tempPointer; } } if( _leftRecord != null ) { write(_output, _leftRecord, null); _leftRecord = read(_left); while(_leftRecord != null) { write(_output, _leftRecord, null); _leftRecord = read(_left); } } else { if( _rightRecord != null ) { write(_output, null, _rightRecord); _rightRecord = read(_right); while(_rightRecord != null) { write(_output, null, _rightRecord); _rightRecord = read(_right); } } } _left.close(); _right.close(); _output.flush(); _output.close(); } UPDATE While this approach worked, it was terribly slow and so I have modified this to create files as buffers and this works very well. Here is the update ... private long getMaxBufferedLines(File file) throws Throwable { long freeBytes = Runtime.getRuntime().freeMemory() / 2; return (freeBytes / (file.length() / getLineCount(file))); } private void join(File left, File right, File output, JoinType joinType) throws Throwable { BufferedReader leftFile = new BufferedReader(new FileReader(left)); BufferedReader rightFile = new BufferedReader(new FileReader(right)); BufferedWriter outputFile = new BufferedWriter(new FileWriter(output)); long maxBufferedLines = getMaxBufferedLines(right); Record leftRecord; Record rightRecord; leftRecord = read(leftFile); rightRecord = read(rightFile); while( leftRecord != null && rightRecord != null ) { if( leftRecord.getKey().compareTo(rightRecord.getKey()) < 0) { if( joinType == JoinType.LeftOuterJoin || joinType == JoinType.LeftExclusiveJoin || joinType == JoinType.FullExclusiveJoin || joinType == JoinType.FullOuterJoin ) { write(outputFile, leftRecord, null); } leftRecord = read(leftFile); } else if( leftRecord.getKey().compareTo(rightRecord.getKey()) > 0 ) { if( joinType == JoinType.RightOuterJoin || joinType == JoinType.RightExclusiveJoin || joinType == JoinType.FullExclusiveJoin || joinType == JoinType.FullOuterJoin ) { write(outputFile, null, rightRecord); } rightRecord = read(rightFile); } else if( leftRecord.getKey().compareTo(rightRecord.getKey()) == 0 ) { String key = leftRecord.getKey(); List<File> rightRecordFileList = new ArrayList<File>(); List<Record> rightRecordList = new ArrayList<Record>(); rightRecordList.add(rightRecord); rightRecord = consume(key, rightFile, rightRecordList, rightRecordFileList, maxBufferedLines); while( leftRecord != null && leftRecord.getKey().compareTo(key) == 0 ) { processRightRecords(outputFile, leftRecord, rightRecordFileList, rightRecordList, joinType); leftRecord = read(leftFile); } // need a dispose for deleting files in list } else { throw new Exception("DATA IS NOT SORTED"); } } if( leftRecord != null ) { if( joinType == JoinType.LeftOuterJoin || joinType == JoinType.LeftExclusiveJoin || joinType == JoinType.FullExclusiveJoin || joinType == JoinType.FullOuterJoin ) { write(outputFile, leftRecord, null); } leftRecord = read(leftFile); while(leftRecord != null) { if( joinType == JoinType.LeftOuterJoin || joinType == JoinType.LeftExclusiveJoin || joinType == JoinType.FullExclusiveJoin || joinType == JoinType.FullOuterJoin ) { write(outputFile, leftRecord, null); } leftRecord = read(leftFile); } } else { if( rightRecord != null ) { if( joinType == JoinType.RightOuterJoin || joinType == JoinType.RightExclusiveJoin || joinType == JoinType.FullExclusiveJoin || joinType == JoinType.FullOuterJoin ) { write(outputFile, null, rightRecord); } rightRecord = read(rightFile); while(rightRecord != null) { if( joinType == JoinType.RightOuterJoin || joinType == JoinType.RightExclusiveJoin || joinType == JoinType.FullExclusiveJoin || joinType == JoinType.FullOuterJoin ) { write(outputFile, null, rightRecord); } rightRecord = read(rightFile); } } } leftFile.close(); rightFile.close(); outputFile.flush(); outputFile.close(); } public void processRightRecords(BufferedWriter outputFile, Record leftRecord, List<File> rightFiles, List<Record> rightRecords, JoinType joinType) throws Throwable { for(File rightFile : rightFiles) { BufferedReader rightReader = new BufferedReader(new FileReader(rightFile)); Record rightRecord = read(rightReader); while(rightRecord != null){ if( joinType == JoinType.LeftOuterJoin || joinType == JoinType.RightOuterJoin || joinType == JoinType.FullOuterJoin || joinType == JoinType.InnerJoin ) { write(outputFile, leftRecord, rightRecord); } rightRecord = read(rightReader); } rightReader.close(); } for(Record rightRecord : rightRecords) { if( joinType == JoinType.LeftOuterJoin || joinType == JoinType.RightOuterJoin || joinType == JoinType.FullOuterJoin || joinType == JoinType.InnerJoin ) { write(outputFile, leftRecord, rightRecord); } } } /** * consume all records having key (either to a single list or multiple files) each file will * store a buffer full of data. The right record returned represents the outside flow (key is * already positioned to next one or null) so we can't use this record in below while loop or * within this block in general when comparing current key. The trick is to keep consuming * from a List. When it becomes empty, re-fill it from the next file until all files have * been consumed (and the last node in the list is read). The next outside iteration will be * ready to be processed (either it will be null or it points to the next biggest key * @throws Throwable * */ private Record consume(String key, BufferedReader reader, List<Record> records, List<File> files, long bufferMaxRecordLines ) throws Throwable { boolean processComplete = false; Record record = records.get(records.size() - 1); while(!processComplete){ long recordCount = records.size(); if( record.getKey().compareTo(key) == 0 ){ record = read(reader); while( record != null && record.getKey().compareTo(key) == 0 && recordCount < bufferMaxRecordLines ) { records.add(record); recordCount++; record = read(reader); } } processComplete = true; // if record is null, we are done if( record != null ) { // if the key has changed, we are done if( record.getKey().compareTo(key) == 0 ) { // Same key means we have exhausted the buffer. // Dump entire buffer into a file. The list of file // pointers will keep track of the files ... processComplete = false; dumpBufferToFile(records, files); records.clear(); records.add(record); } } } return record; } /** * Dump all records in List of Record objects to a file. Then, add that * file to List of File objects * * NEED TO PLACE A LIMIT ON NUMBER OF FILE POINTERS (check size of file list) * * @param records * @param files * @throws Throwable */ private void dumpBufferToFile(List<Record> records, List<File> files) throws Throwable { String prefix = "joiner_" + files.size() + 1; String suffix = ".dat"; File file = File.createTempFile(prefix, suffix, new File("cache")); BufferedWriter writer = new BufferedWriter(new FileWriter(file)); for( Record record : records ) { writer.write( record.dump() ); } files.add(file); writer.flush(); writer.close(); }

    Read the article

  • Source-control 'wet-work'?

    - by Phil Factor
    When a design or creative work is flawed beyond remedy, it is often best to destroy it and start again. The other day, I lost the code to a long and intricate SQL batch I was working on. I’d thought it was impossible, but it happened. With all the technology around that is designed to prevent this occurring, this sort of accident has become a rare event.  If it weren’t for a deranged laptop, and my distraction, the code wouldn’t have been lost this time.  As always, I sighed, had a soothing cup of tea, and typed it all in again.  The new code I hastily tapped in  was much better: I’d held in my head the essence of how the code should work rather than the details: I now knew for certain  the start point, the end, and how it should be achieved. Instantly the detritus of half-baked thoughts fell away and I was able to write logical code that performed better.  Because I could work so quickly, I was able to hold the details of all the columns and variables in my head, and the dynamics of the flow of data. It was, in fact, easier and quicker to start from scratch rather than tidy up and refactor the existing code with its inevitable fumbling and half-baked ideas. What a shame that technology is now so good that developers rarely experience the cleansing shock of losing one’s code and having to rewrite it from scratch.  If you’ve never accidentally lost  your code, then it is worth doing it deliberately once for the experience. Creative people have, until Technology mistakenly prevented it, torn up their drafts or sketches, threw them in the bin, and started again from scratch.  Leonardo’s obsessive reworking of the Mona Lisa was renowned because it was so unusual:  Most artists have been utterly ruthless in destroying work that didn’t quite make it. Authors are particularly keen on writing afresh, and the results are generally positive. Lawrence of Arabia actually lost the entire 250,000 word manuscript of ‘The Seven Pillars of Wisdom’ by accidentally leaving it on a train at Reading station, before rewriting a much better version.  Now, any writer or artist is seduced by technology into altering or refining their work rather than casting it dramatically in the bin or setting a light to it on a bonfire, and rewriting it from the blank page.  It is easy to pick away at a flawed work, but the real creative process is far more brutal. Once, many years ago whilst running a software house that supplied commercial software to local businesses, I’d been supervising an accounting system for a farming cooperative. No packaged system met their needs, and it was all hand-cut code.  For us, it represented a breakthrough as it was for a government organisation, and success would guarantee more contracts. As you’ve probably guessed, the code got mangled in a disk crash just a week before the deadline for delivery, and the many backups all proved to be entirely corrupted by a faulty tape drive.  There were some fragments left on individual machines, but they were all of different versions.  The developers were in despair.  Strangely, I managed to re-write the bulk of a three-month project in a manic and caffeine-soaked weekend.  Sure, that elegant universally-applicable input-form routine was‘nt quite so elegant, but it didn’t really need to be as we knew what forms it needed to support.  Yes, the code lacked architectural elegance and reusability. By dawn on Monday, the application passed its integration tests. The developers rose to the occasion after I’d collapsed, and tidied up what I’d done, though they were reproachful that some of the style and elegance had gone out of the application. By the delivery date, we were able to install it. It was a smaller, faster application than the beta they’d seen and the user-interface had a new, rather Spartan, appearance that we swore was done to conform to the latest in user-interface guidelines. (we switched to Helvetica font to look more ‘Bauhaus’ ). The client was so delighted that he forgave the new bugs that had crept in. I still have the disk that crashed, up in the attic. In IT, we have had mixed experiences from complete re-writes. Lotus 123 never really recovered from a complete rewrite from assembler into C, Borland made the mistake with Arago and Quattro Pro  and Netscape’s complete rewrite of their Navigator 4 browser was a white-knuckle ride. In all cases, the decision to rewrite was a result of extreme circumstances where no other course of action seemed possible.   The rewrite didn’t come out of the blue. I prefer to remember the rewrite of Minix by young Linus Torvalds, or the rewrite of Bitkeeper by a slightly older Linus.  The rewrite of CP/M didn’t do too badly either, did it? Come to think of it, the guy who decided to rewrite the windowing system of the Xerox Star never regretted the decision. I’ll agree that one should often resist calls for a rewrite. One of the worst habits of the more inexperienced programmer is to denigrate whatever code he or she inherits, and then call loudly for a complete rewrite. They are buoyed up by the mistaken belief that they can do better. This, however, is a different psychological phenomenon, more related to the idea of some motorcyclists that they are operating on infinite lives, or the occasional squaddies that if they charge the machine-guns determinedly enough all will be well. Grim experience brings out the humility in any experienced programmer.  I’m referring to quite different circumstances here. Where a team knows the requirements perfectly, are of one mind on methodology and coding standards, and they already have a solution, then what is wrong with considering  a complete rewrite? Rewrites are so painful in the early stages, until that point where one realises the payoff, that even I quail at the thought. One needs a natural disaster to push one over the edge. The trouble is that source-control systems, and disaster recovery systems, are just too good nowadays.   If I were to lose this draft of this very blog post, I know I’d rewrite it much better. However, if you read this, you’ll know I didn’t have the nerve to delete it and start again.  There was a time that one prayed that unreliable hardware would deliver you from an unmaintainable mess of a codebase, but now technology has made us almost entirely immune to such a merciful act of God. An old friend of mine with long experience in the software industry has long had the idea of the ‘source-control wet-work’,  where one hires a malicious hacker in some wild eastern country to hack into one’s own  source control system to destroy all trace of the source to an application. Alas, backup systems are just too good to make this any more than a pipedream. Somehow, it would be difficult to promote the idea. As an alternative, could one construct a source control system that, on doing all the code-quality metrics, would systematically destroy all trace of source code that failed the quality test? Alas, I can’t see many managers buying into the idea. In reading the full story of the near-loss of Toy Story 2, it set me thinking. It turned out that the lucky restoration of the code wasn’t the happy ending one first imagined it to be, because they eventually came to the conclusion that the plot was fundamentally flawed and it all had to be rewritten anyway.  Was this an early  case of the ‘source-control wet-job’?’ It is very hard nowadays to do a rapid U-turn in a development project because we are far too prone to cling to our existing source-code.

    Read the article

  • Data Source Connection Pool Sizing

    - by Steve Felts
    Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin:0in; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:10.0pt; font-family:"Times New Roman","serif";} One of the most time-consuming procedures of a database application is establishing a connection. The connection pooling of the data source can be used to minimize this overhead.  That argues for using the data source instead of accessing the database driver directly. Configuring the size of the pool in the data source is somewhere between an art and science – this article will try to move it closer to science.  From the beginning, WLS data source has had an initial capacity and a maximum capacity configuration values.  When the system starts up and when it shrinks, initial capacity is used.  The pool can grow to maximum capacity.  Customers found that they might want to set the initial capacity to 0 (more on that later) but didn’t want the pool to shrink to 0.  In WLS 10.3.6, we added minimum capacity to specify the lower limit to which a pool will shrink.  If minimum capacity is not set, it defaults to the initial capacity for upward compatibility.   We also did some work on the shrinking in release 10.3.4 to reduce thrashing; the algorithm that used to shrink to the maximum of the currently used connections or the initial capacity (basically the unused connections were all released) was changed to shrink by half of the unused connections. The simple approach to sizing the pool is to set the initial/minimum capacity to the maximum capacity.  Doing this creates all connections at startup, avoiding creating connections on demand and the pool is stable.  However, there are a number of reasons not to take this simple approach. When WLS is booted, the deployment of the data source includes synchronously creating the connections.  The more connections that are configured in initial capacity, the longer the boot time for WLS (there have been several projects for parallel boot in WLS but none that are available).  Related to creating a lot of connections at boot time is the problem of logon storms (the database gets too much work at one time).   WLS has a solution for that by setting the login delay seconds on the pool but that also increases the boot time. There are a number of cases where it is desirable to set the initial capacity to 0.  By doing that, the overhead of creating connections is deferred out of the boot and the database doesn’t need to be available.  An application may not want WLS to automatically connect to the database until it is actually needed, such as for some code/warm failover configurations. There are a number of cases where minimum capacity should be less than maximum capacity.  Connections are generally expensive to keep around.  They cause state to be kept on both the client and the server, and the state on the backend may be heavy (for example, a process).  Depending on the vendor, connection usage may cost money.  If work load is not constant, then database connections can be freed up by shrinking the pool when connections are not in use.  When using Active GridLink, connections can be created as needed according to runtime load balancing (RLB) percentages instead of by connection load balancing (CLB) during data source deployment. Shrinking is an effective technique for clearing the pool when connections are not in use.  In addition to the obvious reason that there times where the workload is lighter,  there are some configurations where the database and/or firewall conspire to make long-unused or too-old connections no longer viable.  There are also some data source features where the connection has state and cannot be used again unless the state matches the request.  Examples of this are identity based pooling where the connection has a particular owner and XA affinity where the connection is associated with a particular RAC node.  At this point, WLS does not re-purpose (discard/replace) connections and shrinking is a way to get rid of the unused existing connection and get a new one with the correct state when needed. So far, the discussion has focused on the relationship of initial, minimum, and maximum capacity.  Computing the maximum size requires some knowledge about the application and the current number of simultaneously active users, web sessions, batch programs, or whatever access patterns are common.  The applications should be written to only reserve and close connections as needed but multiple statements, if needed, should be done in one reservation (don’t get/close more often than necessary).  This means that the size of the pool is likely to be significantly smaller then the number of users.   If possible, you can pick a size and see how it performs under simulated or real load.  There is a high-water mark statistic (ActiveConnectionsHighCount) that tracks the maximum connections concurrently used.  In general, you want the size to be big enough so that you never run out of connections but no bigger.   It will need to deal with spikes in usage, which is where shrinking after the spike is important.  Of course, the database capacity also has a big influence on the decision since it’s important not to overload the database machine.  Planning also needs to happen if you are running in a Multi-Data Source or Active GridLink configuration and expect that the remaining nodes will take over the connections when one of the nodes in the cluster goes down.  For XA affinity, additional headroom is also recommended.  In summary, setting initial and maximum capacity to be the same may be simple but there are many other factors that may be important in making the decision about sizing.

    Read the article

  • Flash AS3 load file xml

    - by Elias
    Hello, I'm just trying to load an xml file witch can be anywere in the hdd, this is what I have done to browse it, but later when I'm trying to load the file it would only look in the same path of the swf file here is the code package { import flash.display.Sprite; import flash.events.; import flash.net.; public class cargadorXML extends Sprite { public var cuadro:Sprite = new Sprite(); public var file:FileReference; public var req:URLRequest; public var xml:XML; public var xmlLoader:URLLoader = new URLLoader(); public function cargadorXML() { cuadro.graphics.beginFill(0xFF0000); cuadro.graphics.drawRoundRect(0,0,100,100,10); cuadro.graphics.endFill(); cuadro.addEventListener(MouseEvent.CLICK,browser); addChild(cuadro); } public function browser(e:Event) { file = new FileReference(); file.addEventListener(Event.SELECT,bien); file.browse(); } public function bien(e:Event) { xmlLoader.addEventListener(Event.COMPLETE, loadXML); req=new URLRequest(file.name); xmlLoader.load(req); } public function loadXML(e:Event) { xml=new XML(e.target.data); //xml.name=file.name; trace(xml); } } } when I open a xml file that isnt it the same directory as the swf, it gives me an unfound file error. is there anything I can do? cause for example for mp3 there is an especial class for loading the file, see http://www.flexiblefactory.co.uk/flexible/?p=46 thanks

    Read the article

  • Unable to access Java-created file -- sometimes

    - by BlairHippo
    In Java, I'm working with code running under WinXP that creates a file like this: public synchronized void store(Properties props, byte[] data) { try { File file = filenameBasedOnProperties(props); if ( file.exists() ) { return; } File temp = File.createTempFile("tempfile", null); FileOutputStream out = new FileOutputStream(temp); out.write(data); out.flush(); out.close(); file.getParentFile().mkdirs(); temp.renameTo(file); } catch (IOException ex) { // Complain and whine and stuff } } Sometimes, when a file is created this way, it's just about totally inaccessible from outside the code (though the code responsible for opening and reading the file has no problem), even when the application isn't running. When accessed via Windows Explorer, I can't move, rename, delete, or even open the file. Under Cygwin, I get the following when I ls -l the directory: ls: cannot access [big-honkin-filename] total 0 ?????????? ? ? ? ? ? [big-honkin-filename] As implied, the filenames are big, but under the 260-character max for XP (though they are slightly over 200 characters). To further add to the sense the my computer just wants me to feel stupid, sometimes the files created by this code are perfectly normal. The only pattern I've spotted is that once one file in the directory "locks", the rest are screwed. Anybody ever run into something like this before, or have any insights into what's going on here?

    Read the article

  • Modifying File while in use using Java

    - by Marquinio
    Hi all, I have this recurrent Java JAR program tasks that tries to modify a file every 60seconds. Problem is that if user is viewing the file than Java program will not be able to modify the file. I get the typical IOException. Anyone knows if there is a way in Java to modify a file currently in use? Or anyone knows what would be the best way to solve this problem? I was thinking of using the File canRead(), canWrite() methods to check if file is in use. If file is in use then I'm thinking of making a backup copy of data that could not be written. Then after 60 seconds add some logic to check if backup file is empty or not. If backup file is not empty then add its contents to main file. If empty then just add new data to main file. Of course, the first thing I will always do is check if file is in use. Thanks for all your ideas.

    Read the article

  • How to compare two file structures in PHP?

    - by OM The Eternity
    I have a function which gives me the complete file structure upto n-level, function getDirectory($path = '.', $ignore = '') { $dirTree = array (); $dirTreeTemp = array (); $ignore[] = '.'; $ignore[] = '..'; $dh = @opendir($path); while (false !== ($file = readdir($dh))) { if (!in_array($file, $ignore)) { if (!is_dir("$path/$file")) { //display of file and directory name with their modification time $stat = stat("$path/$file"); $statdir = stat("$path"); $dirTree["$path"][] = $file. " === ". date('Y-m-d H:i:s', $stat['mtime']) . " Directory == ".$path."===". date('Y-m-d H:i:s', $statdir['mtime']) ; } else { $dirTreeTemp = getDirectory("$path/$file", $ignore); if (is_array($dirTreeTemp))$dirTree = array_merge($dirTree, $dirTreeTemp); } } } closedir($dh); return $dirTree; } $ignore = array('.htaccess', 'error_log', 'cgi-bin', 'php.ini', '.ftpquota'); //function call $dirTree = getDirectory('.', $ignore); //file structure array print print_r($dirTree); Now here my requirement is , I have two sites The Development/Test Site- where i do testing of all the changes The Production Site- where I finally post all the changes as per test in development site Now, for example, I have tested an image upload in the Development/test site, and i found it appropriate to publish on Production site then i will completely transfer the Development/Test DB detail to Production DB, but now I want to compare the files structure as well to transfer the corresponding image file to Production folder. There could be the situation when I update the image by editing the image and upload it with same name, now in this case the image file would be already present there, which will restrict the use of "file_exist" logic, so for these type of situations....HOW CAN I COMPARE THE TWO FILE STRUCTURE TO GET THE SYNCHRONIZATION DONE AS PER REQUIREMENT??

    Read the article

  • File mkdirs() method not working in android/java

    - by Leif Andersen
    I've been pulling out my hair on this for a while now. The following method is supposed to download a file, and save it to the location specified on the hard drive. private static void saveImage(Context context, boolean backgroundUpdate, URL url, File file) { if (!Tools.checkNetworkState(context, backgroundUpdate)) return; // Get the image try { // Make the file file.getParentFile().mkdirs(); // Set up the connection URLConnection uCon = url.openConnection(); InputStream is = uCon.getInputStream(); BufferedInputStream bis = new BufferedInputStream(is); // Download the data ByteArrayBuffer baf = new ByteArrayBuffer(50); int current = 0; while ((current = bis.read()) != -1) { baf.append((byte) current); } // Write the bits to the file OutputStream os = new FileOutputStream(file); os.write(baf.toByteArray()); os.close(); } catch (Exception e) { // Any exception is probably a newtork faiilure, bail return; } } Also, if the file doesn't exist, it is supposed to make the directory for the file. (And if there is another file already in that spot, it should just not do anything). However, for some reason, the mkdirs() method never makes the directory. I've tried everything from explicit parentheses, to explicitly making the parent file class, and nothing seems to work. I'm fairly certain that the drive is writable, as it's only called after that has already been determined, also that is true after running through it while debugging. So the method fails because the parent directories aren't made. Can anyone tell me if there is anything wrong with the way I'm calling it? Also, if it helps, here is the source for the file I'm calling it in: https://github.com/LeifAndersen/NetCatch/blob/master/src/net/leifandersen/mobile/android/netcatch/services/RSSService.java Thank you

    Read the article

  • Where can I collaborate with my friend on source code in real time?

    - by Carson Myers
    I mean, other than a conference room :) Using google docs, I can upload any kind of file and view it with other people, watch them edit it in real time, with a live chat happening in the same window. This is awesome. How can I do the same thing with source code? I'm looking for a web application where I can upload source files that will be displayed in some kind of editor, with syntax highlighting, and allow others to view it and edit it in real time. Preferably with a live chat also, but not necessary. Does anybody know where I can find this?

    Read the article

  • Where do you find the Bash source files of programs in Linux/Mac OSX?

    - by AndrewKS
    I am currently writing some convenience methods for my terminal in my bash_profile and am sure if what I am writing is "the best way". I figure a good way to verify whether what I'm doing is right or not would be to find some source code of more established programs and see how they do it. My question then is, where can I find this code on my Mac? An example is, with Macports installed, where is the source code that opens the port interactive console when I type nothing but "port" in my shell? (I added Linux in the title even though I am on a Mac because I assume the answer would be the same for both) Edit: The answer I am looking for is in terms of which directory relative to the programs will I find their unix scripts.

    Read the article

  • Unset the system immutable bit in Mac OS X

    - by skylarking
    In theory I believe you can unlock and remove the system immutable bit with: chflags noschg /Path/To/File But how can you do this when you've set the bit as root? I have a file that is locked, and even running this command as root will not work as the operation is not permitted. I tried logging in as Single-User mode to no avail. I seem to remember that even though you are in as root you are in at level '1'. And to be able to remove the system-immutable flag you need to be logged in at level '0'. Does this have something to do with this issue?

    Read the article

  • How to choose an open source, Asterisk friendly firewall?

    - by Lucas
    I'm in pain. We are moving to a SIP based VOIP system and for whatever reason, we could not get our hosted Asterisk solution to work with our Sonicwall. Our VOIP provider gave up and is recommending an open source vendor, pfSense. A little background: We have about 30 users in our network. We use a few IPSec VPN connections for remote networks. I would like, but don't need, application layer filtering. We're active internet users, so properly traffic shaping is probably a concern. How can I tell if an open source firewall will handle VOIP setup smoothly with a hosted Asterisk system?

    Read the article

  • I want to make my Application Open Source, but I'm unsure...

    - by Joern
    Hi! I have written a website, which is my big idea. Now I'm planning a version for intranets. The big question in my head is: "shall I make it open source?" and next are: What do I have to prepare What do I need for a good start What is the best way to find people with the same interests Who gives me the proof that I won't find a copy of my idea on another page, stolen from my open source code Please Discuss with me, give some good arguments pro and contra. Yours, Joern.

    Read the article

  • Deciding On Features For Open Source

    - by Robz / Fervent Coder
    Open source feature selection is subjective. An interesting question was posed to me recently at a presentation - “How do you decide what features to include in the [open source] projects you manage?” Is It Objective? I’d like to say that it’s really objective and that we vote on features and look at what carries the most interest of the populace. Actually no I wouldn’t. I don’t think I would enjoy working on open source (OSS) as much if it someone else decided on what features I should include. It already works that way at work. I don’t want to come home from work and work on things that others decide for me unless they are paying me for those features. So how do I decide on features for our open source projects? I think there are at least three paths to feature selection and they are not necessarily mutually exclusive. Feature Selection IS the Set of Features For the Domain Your product, in whatever domain it is in, needs to have the basic set of features that make it answer the needs of that domain. That is different for every product, but if you take for example a build tool, at the very least it needs to be able to compile source. And these basic needed features are not always objective either. Two people could completely disagree what makes for a required feature to meet a domain need for a product. Even one person may disagree with himself/herself about what features are needed based on different timeframes. So that leads us down to subjective. Feature Selection IS An Answer To Competition Some features go in because the competition adds a feature that may draw others away from your product offering. With OSS, there are all free alternatives, so if your competition adds a killer feature and you don’t, there isn’t much other than learning (how to use the other product) to move your customers off to the competition. If you want to keep your customers, you need to be ready to answer the questions of adding the features your competition has added.  Sometimes it’s about adding a feature that your competition charges for, but you add it for free. That draws people to the free alternative – so sometimes that adds a motivation to select a feature. Sometimes it’s because you want those features in your product, either to learn how you can answer the question of how to do something and/or because you have a need for that feature and you want it in your product. That also leads us down the road to subjective. Feature Selection IS Subjective I decide on features based on what I want to see in the product I am working on. Things I am interested in or have the biggest need for usually get picked first, with things that do not interest me either coming later or not at all. Most people get interested in an area of OSS because it solves a need for them and/or they find it interesting. If one of these two things is not happening and they are not being paid, it’s likely that person will move on to something else they find interesting or just stop OSS altogether. OSS feature selection is just that – subjective. If it wasn’t, it wouldn’t be opinionated and it wouldn’t have a personality about it. Most people like certain OSS because they like where the product is going or the personalities behind the product. For me, I want my products to be easy to use and solve an important problem. If it takes you more than 5-10 minutes to learn how to use my product, I know you are probably going somewhere else. So I pick features that make the product easy to use and learn, and those are not always the simplest features to work on. I work for conventions and make the product opinionated, because I think that is what makes using a product easier, if it already works with little setup. And I like to provide the ability for power users to get in and change the conventions to suit their needs. So those are required features for me above and beyond the domain features. I like to think I do a pretty good job at this. Usually when I present on something I’ve created, I like seeing people’s eyes light up when they see how simple it is to set up a powerful product like UppercuT. Patches And/Or Donations But remember before you say I’m a bad person or won’t use my product, I’ll always accept patches or I might like the feature that you suggest. If you like using the products I provide and they solve a problem for you the two biggest compliments you can provide are either a patch or a donation.  If you think the product is great, but if it could do this one other thing, it would be awesome(!), then consider contacting me and providing a patch, or consider contacting me with a donation and a request to put the feature in. And alternatively, if it’s a big feature, you could hire me to work on the product to make it even better. What If There Are Multiple Committers? In the question of multiple committers, I choose that someone always makes the ultimate decision to select whether a feature should be part of a product or not. But for other OSS project maybe this is not the case. If there is not an ultimate decision maker, then there is the possibility of either adding every feature suggested or having a deadlock on two conflicting features.   So let me pose this question. If you work on Open Source, how do you decide on what features to put in your open source projects? How do you decide what doesn’t belong? What do you do when there are conflicting features?

    Read the article

  • Sort Data in Windows Phone using Collection View Source

    - by psheriff
    When you write a Windows Phone application you will most likely consume data from a web service somewhere. If that service returns data to you in a sort order that you do not want, you have an easy alternative to sort the data without writing any C# or VB code. You use the built-in CollectionViewSource object in XAML to perform the sorting for you. This assumes that you can get the data into a collection that implements the IEnumerable or IList interfaces.For this example, I will be using a simple Product class with two properties, and a list of Product objects using the Generic List class. Try this out by creating a Product class as shown in the following code:public class Product {  public Product(int id, string name)   {    ProductId = id;    ProductName = name;  }  public int ProductId { get; set; }  public string ProductName { get; set; }}Create a collection class that initializes a property called DataCollection with some sample data as shown in the code below:public class Products : List<Product>{  public Products()  {    InitCollection();  }  public List<Product> DataCollection { get; set; }  List<Product> InitCollection()  {    DataCollection = new List<Product>();    DataCollection.Add(new Product(3,        "PDSA .NET Productivity Framework"));    DataCollection.Add(new Product(1,        "Haystack Code Generator for .NET"));    DataCollection.Add(new Product(2,        "Fundamentals of .NET eBook"));    return DataCollection;  }}Notice that the data added to the collection is not in any particular order. Create a Windows Phone page and add two XML namespaces to the Page.xmlns:scm="clr-namespace:System.ComponentModel;assembly=System.Windows"xmlns:local="clr-namespace:WPSortData"The 'local' namespace is an alias to the name of the project that you created (in this case WPSortData). The 'scm' namespace references the System.Windows.dll and is needed for the SortDescription class that you will use for sorting the data. Create a phone:PhoneApplicationPage.Resources section in your Windows Phone page that looks like the following:<phone:PhoneApplicationPage.Resources>  <local:Products x:Key="products" />  <CollectionViewSource x:Key="prodCollection"      Source="{Binding Source={StaticResource products},                       Path=DataCollection}">    <CollectionViewSource.SortDescriptions>      <scm:SortDescription PropertyName="ProductName"                           Direction="Ascending" />    </CollectionViewSource.SortDescriptions>  </CollectionViewSource></phone:PhoneApplicationPage.Resources>The first line of code in the resources section creates an instance of your Products class. The constructor of the Products class calls the InitCollection method which creates three Product objects and adds them to the DataCollection property of the Products class. Once the Products object is instantiated you now add a CollectionViewSource object in XAML using the Products object as the source of the data to this collection. A CollectionViewSource has a SortDescriptions collection that allows you to specify a set of SortDescription objects. Each object can set a PropertyName and a Direction property. As you see in the above code you set the PropertyName equal to the ProductName property of the Product object and tell it to sort in an Ascending direction.All you have to do now is to create a ListBox control and set its ItemsSource property to the CollectionViewSource object. The ListBox displays the data in sorted order by ProductName and you did not have to write any LINQ queries or write other code to sort the data!<ListBox    ItemsSource="{Binding Source={StaticResource prodCollection}}"   DisplayMemberPath="ProductName" />SummaryIn this blog post you learned that you can sort any data without having to change the source code of where the data comes from. Simply feed the data into a CollectionViewSource in XAML and set some sort descriptions in XAML and the rest is done for you! This comes in very handy when you are consuming data from a source where the data is given to you and you do not have control over the sorting.NOTE: You can download this article and many samples like the one shown in this blog entry at my website. http://www.pdsa.com/downloads. Select “Tips and Tricks”, then “Sort Data in Windows Phone using Collection View Source” from the drop down list.Good Luck with your Coding,Paul Sheriff** SPECIAL OFFER FOR MY BLOG READERS **We frequently offer a FREE gift for readers of my blog. Visit http://www.pdsa.com/Event/Blog for your FREE gift!

    Read the article

  • Database Partitioning and Multiple Data Source Considerations

    - by Jeffrey McDaniel
    With the release of P6 Reporting Database 3.0 partitioning was added as a feature to help with performance and data management.  Careful investigation of requirements should be conducting prior to installation to help improve overall performance throughout the lifecycle of the data warehouse, preventing future maintenance that would result in data loss. Before installation try to determine how many data sources and partitions will be required along with the ranges.  In P6 Reporting Database 3.0 any adjustments outside of defaults must be made in the scripts and changes will require new ETL runs for each data source.  Considerations: 1. Standard Edition or Enterprise Edition of Oracle Database.   If you aren't using Oracle Enterprise Edition Database; the partitioning feature is not available. Multiple Data sources are only supported on Enterprise Edition of Oracle   Database. 2. Number of Data source Ids for partitioning during configuration.   This setting will specify how many partitions will be allocated for tables containing data source information.  This setting requires some evaluation prior to installation as       there are repercussions if you don't estimate correctly.   For example, if you configured the software for only 2 data sources and the partition setting was set to 2, however along came a 3rd data source.  The necessary steps to  accommodate this change are as follows: a) By default, 3 partitions are configured in the Reporting Database scripts. Edit the create_star_tables_part.sql script located in <installation directory>\star\scripts   and search for partition.  You’ll see P1, P2, P3.  Add additional partitions and sub-partitions for P4 and so on. These will appear in several areas.  (See P6 Reporting Database 3.0 Installation and Configuration guide for more information on this and how to adjust partition ranges). b) Run starETL -r.  This will recreate each table with the new partition key.  The effect of this step is that all tables data will be lost except for history related tables.   c) Run starETL for each of the 3 data sources (with the data source # (starETL.bat "-s2" -as defined in P6 Reporting Database 3.0 Installation and Configuration guide) The best strategy for this setting is to overestimate based on possible growth.  If during implementation it is deemed that there are atleast 2 data sources with possibility for growth, it is a better idea to set this setting to 4 or 5, allowing room for the future and preventing a ‘start over’ scenario. 3. The Number of Partitions and the Number of Months per Partitions are not specific to multi-data source.  These settings work in accordance to a sub partition of larger tables with regard to time related data.  These settings are dataset specific for optimization.  The number of months per partition is self explanatory, optimally the smaller the partition, the better query performance so if the dataset has an extremely large number of spread/history records, a lower number of months is optimal.  Working in accordance with this setting is the number of partitions, this will determine how many "buckets" will be created per the number of months setting.  For example, if you kept the default for # of partitions of 3, and select 2 months for each partitions you would end up with: -1st partition, 2 months -2nd partition, 2 months -3rd partition, all the remaining records Therefore with records to this setting, it is important to analyze your source db spread ranges and history settings when determining the proper number of months per partition and number of partitions to optimize performance.  Also be aware the DBA will need to monitor when these partition ranges will fill up and when additional partitions will need to be added.  If you get to the final range partition and there are no additional range partitions all data will be included into the last partition. 

    Read the article

  • java.lang.NoClassDefFoundError in command line

    - by Graham
    Hi, I'm developing an application in Eclipse and it runs fine from within Eclipse. The problem I'm having is that when I export it to a jar file and run it from the command line I get a NoClassDefFound error for javax.mail.internet. In both my project build path and class path I have included the activation.jar and mail.jar libraries required for me to use javax.mail.internet, and like I said it works fine from within Eclipse but not when I export it to a jar. If my build path has those files and so does my class path why would this not be working? Here is the error stack: Exception in thread "AWT-EventQueue-0" java.lang.NoClassDefFoundError: javax/mai l/internet/InternetAddress at airit.com.Auxiliary.validateEmail(Auxiliary.java:29) at airit.com.MainFrame.actionPerformed(MainFrame.java:79) at javax.swing.AbstractButton.fireActionPerformed(Unknown Source) at javax.swing.AbstractButton$Handler.actionPerformed(Unknown Source) at javax.swing.DefaultButtonModel.fireActionPerformed(Unknown Source) at javax.swing.DefaultButtonModel.setPressed(Unknown Source) at javax.swing.plaf.basic.BasicButtonListener.mouseReleased(Unknown Sour ce) at java.awt.Component.processMouseEvent(Unknown Source) at javax.swing.JComponent.processMouseEvent(Unknown Source) at java.awt.Component.processEvent(Unknown Source) at java.awt.Container.processEvent(Unknown Source) at java.awt.Component.dispatchEventImpl(Unknown Source) at java.awt.Container.dispatchEventImpl(Unknown Source) at java.awt.Component.dispatchEvent(Unknown Source) at java.awt.LightweightDispatcher.retargetMouseEvent(Unknown Source) at java.awt.LightweightDispatcher.processMouseEvent(Unknown Source) at java.awt.LightweightDispatcher.dispatchEvent(Unknown Source) at java.awt.Container.dispatchEventImpl(Unknown Source) at java.awt.Window.dispatchEventImpl(Unknown Source) at java.awt.Component.dispatchEvent(Unknown Source) at java.awt.EventQueue.dispatchEvent(Unknown Source) at java.awt.EventDispatchThread.pumpOneEventForFilters(Unknown Source) at java.awt.EventDispatchThread.pumpEventsForFilter(Unknown Source) at java.awt.EventDispatchThread.pumpEventsForHierarchy(Unknown Source) at java.awt.EventDispatchThread.pumpEvents(Unknown Source) at java.awt.EventDispatchThread.pumpEvents(Unknown Source) at java.awt.EventDispatchThread.run(Unknown Source) Caused by: java.lang.ClassNotFoundException: javax.mail.internet.InternetAddress at java.net.URLClassLoader$1.run(Unknown Source) at java.security.AccessController.doPrivileged(Native Method) at java.net.URLClassLoader.findClass(Unknown Source) at java.lang.ClassLoader.loadClass(Unknown Source) at sun.misc.Launcher$AppClassLoader.loadClass(Unknown Source) at java.lang.ClassLoader.loadClass(Unknown Source) ... 27 more

    Read the article

  • how to display a JFrame from an applet?

    - by mithun1538
    Hello everyone, I have this class called PollFrame that extends JFrame in a file called PollFrame.java . PollFrame contains a form. I have an applet, which has a button in it. When the button is clicked, I want the PollFrame to be displayed. I set the ActionPerformed as: Pollframe poll = new PollFrame(); // This initializes the form poll.setVisible(true); However, when I click the button, I get the following error : Exception in thread "AWT-EventQueue-2" java.security.AccessControlException: access denied (java.lang.RuntimePermission exitVM.0) at java.security.AccessControlContext.checkPermission(Unknown Source) at java.security.AccessController.checkPermission(Unknown Source) at java.lang.SecurityManager.checkPermission(Unknown Source) at java.lang.SecurityManager.checkExit(Unknown Source) at javax.swing.JFrame.setDefaultCloseOperation(Unknown Source) at com.org.pollFrame.initComponents(pollFrame.java:54) at com.org.pollFrame.<init>(pollFrame.java:11) at com.org.EmployeeApplet.requestRoomActionPerformed(EmployeeApplet.java:216) at com.org.EmployeeApplet.access$300(EmployeeApplet.java:7) at com.org.EmployeeApplet$4.actionPerformed(EmployeeApplet.java:71) at javax.swing.AbstractButton.fireActionPerformed(Unknown Source) at javax.swing.AbstractButton$Handler.actionPerformed(Unknown Source) at javax.swing.DefaultButtonModel.fireActionPerformed(Unknown Source) at javax.swing.DefaultButtonModel.setPressed(Unknown Source) at javax.swing.plaf.basic.BasicButtonListener.mouseReleased(Unknown Source) at java.awt.Component.processMouseEvent(Unknown Source) at javax.swing.JComponent.processMouseEvent(Unknown Source) at java.awt.Component.processEvent(Unknown Source) at java.awt.Container.processEvent(Unknown Source) at java.awt.Component.dispatchEventImpl(Unknown Source) at java.awt.Container.dispatchEventImpl(Unknown Source) at java.awt.Component.dispatchEvent(Unknown Source) at java.awt.LightweightDispatcher.retargetMouseEvent(Unknown Source) at java.awt.LightweightDispatcher.processMouseEvent(Unknown Source) at java.awt.LightweightDispatcher.dispatchEvent(Unknown Source) at java.awt.Container.dispatchEventImpl(Unknown Source) at java.awt.Component.dispatchEvent(Unknown Source) at java.awt.EventQueue.dispatchEvent(Unknown Source) at java.awt.EventDispatchThread.pumpOneEventForFilters(Unknown Source) at java.awt.EventDispatchThread.pumpEventsForFilter(Unknown Source) at java.awt.EventDispatchThread.pumpEventsForHierarchy(Unknown Source) at java.awt.EventDispatchThread.pumpEvents(Unknown Source) at java.awt.EventDispatchThread.pumpEvents(Unknown Source) at java.awt.EventDispatchThread.run(Unknown Source) I am guessing fromt he above error that calling another class file from an applet is prohibited. Is there any way I can display the PollFrame from the applet?

    Read the article

  • SSIS flat file insertion failure to rollback

    - by Pramodtech
    I have simple SSIS package which reads data from flat file and insert into SQL database. The file has 90K rows and sometimes because of bad data package fails but it insert the partial records before it fails. What I need is if insertion fails at any time between, no records should be inserted into DB, rollback everything. how can I put it in transaction?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

< Previous Page | 38 39 40 41 42 43 44 45 46 47 48 49  | Next Page >