Search Results

Search found 11297 results on 452 pages for 'delete operator'.

Page 424/452 | < Previous Page | 420 421 422 423 424 425 426 427 428 429 430 431  | Next Page >

  • CakePHP HABTM: Editing one item casuses HABTM row to get recreated, destroys extra data

    - by leo-the-manic
    I'm having trouble with my HABTM relationship in CakePHP. I have two models like so: Department HABTM Location. One large company has many buildings, and each building provides a limited number of services. Each building also has its own webpage, so in addition to the HABTM relationship itself, each HABTM row also has a url field where the user can visit to find additional information about the service they're interested and how it operates at the building they're interested in. I've set up the models like so: <?php class Location extends AppModel { var $name = 'Location'; var $hasAndBelongsToMany = array( 'Department' => array( 'with' => 'DepartmentsLocation', 'unique' => true ) ); } ?> <?php class Department extends AppModel { var $name = 'Department'; var $hasAndBelongsToMany = array( 'Location' => array( 'with' => 'DepartmentsLocation', 'unique' => true ) ); } ?> <?php class DepartmentsLocation extends AppModel { var $name = 'DepartmentsLocation'; var $belongsTo = array( 'Department', 'Location' ); // I'm pretty sure this method is unrelated. It's not being called when this error // occurs. Its purpose is to prevent having two HABTM rows with the same location // and department. function beforeSave() { // kill any existing rows with same associations $this->log(__FILE__ . ": killing existing HABTM rows", LOG_DEBUG); $result = $this->find('all', array("conditions" => array("location_id" => $this->data['DepartmentsLocation']['location_id'], "department_id" => $this->data['DepartmentsLocation']['department_id']))); foreach($result as $row) { $this->delete($row['DepartmentsLocation']['id']); } return true; } } ?> The controllers are completely uninteresting. The problem: If I edit the name of a Location, all of the DepartmentsLocations that were linked to that Location are re-created with empty URLs. Since the models specify that unique is true, this also causes all of the newer rows to overwrite the older rows, which essentially destroys all of the URLs. I would like to know two things: Can I stop this? If so, how? And, on a less technical and more whiney note: Why does this even happen? It seems bizarre to me that editing a field through Cake should cause so much trouble, when I can easily go through phpMyAdmin, edit the Location name there, and get exactly the result I would expect. Why does CakePHP touch the HABTM data when I'm just editing a field on a row? It's not even a foreign key!

    Read the article

  • Event sourcing: Write event before or after updating the model

    - by Magnus
    I'm reasoning about event sourcing and often I arrive at a chicken and egg problem. Would be grateful for some hints on how to reason around this. If I execute all I/O-bound processing async (ie writing to the event log) then how do I handle, or sometimes even detect, failures? I'm using Akka Actors so processing is sequential for each event/message. I do not have any database at this time, instead I would persist all the events in an event log and then keep an aggregated state of all the events in a model stored in memory. Queries are all against this model, you can consider it to be a cache. Example Creating a new user: Validate that the user does not exist in model Persist event to journal Update model (in memory) If step 3 breaks I still have persisted my event so I can replay it at a later date. If step 2 breaks I can handle that as well gracefully. This is fine, but since step 2 is I/O-bound I figured that I should do I/O in a separate actor to free up the first actor for queries: Updating a user while allowing queries (A0 = Front end/GUI actor, A1 = Processor Actor, A2 = IO-actor, E = event bus). (A0-E-A1) Event is published to update user 'U1'. Validate that the user 'U1' exists in model (A1-A2) Persist event to journal (separate actor) (A0-E-A1-A0) Query for user 'U1' profile (A2-A1) Event is now persisted continue to update model (A0-E-A1-A0) Query for user 'U1' profile (now returns fresh data) This is appealing since queries can be processed while I/O-is churning along at it's own pace. But now I can cause myself all kinds of problems where I could have two incompatible commands (delete and then update) be persisted to the event log and crash on me when replayed up at a later date, since I do the validation before persisting the event and then update the model. My aim is to have a simple reasoning around my model (since Actor processes messages sequentially single threaded) but not be waiting for I/O-bound updates when Querying. I get the feeling I'm modeling a database which in itself is might be a problem. If things are unclear please write a comment.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • YASR - Yet another search and replace question

    - by petronius31
    Environment: asp.net c# openxml Ok, so I've been reading a ton of snippets and trying to recreate the wheel, but I'm hoping that somone can help me get to my desination faster. I have multiple documents that I need to merge together... check... I'm able to do that with openxml sdk. Birds are singing, sun is shining so far. Now that I have the document the way I want it, I need to search and replace text and/or content controls. I've tried using my own text - {replace this} but when I look at the xml (rename docx to zip and view the file), the { is nowhere near the text. So I either need to know how to protect that within the doucment so they don't diverge or I need to find another way to search and replace. I'm able to search/replace if it is an xml file, but then I'm back to not being able to combine the doucments easily. Code below... and as I mentioned... document merge works fine... just need to replace stuff. protected void exeProcessTheDoc(object sender, EventArgs e) { string doc1 = Server.MapPath("~/Templates/doc1.docx"); string doc2 = Server.MapPath("~/Templates/doc2.docx"); string final_doc = Server.MapPath("~/Templates/extFinal.docx"); File.Delete(final_doc); File.Copy(doc1, final_doc); using (WordprocessingDocument myDoc = WordprocessingDocument.Open(final_doc, true)) { string altChunkId = "AltChunkId2"; MainDocumentPart mainPart = myDoc.MainDocumentPart; AlternativeFormatImportPart chunk = mainPart.AddAlternativeFormatImportPart( AlternativeFormatImportPartType.WordprocessingML, altChunkId); using (FileStream fileStream = File.Open(doc2, FileMode.Open)) chunk.FeedData(fileStream); AltChunk altChunk = new AltChunk(); altChunk.Id = altChunkId; mainPart.Document.Body.InsertAfter(altChunk, mainPart.Document.Body.Elements<Paragraph>().Last()); mainPart.Document.Save(); } exeSearchReplace(final_doc); } protected void exeSearchReplace(string document) { using (WordprocessingDocument wordDoc = WordprocessingDocument.Open(document, true)) { string docText = null; using (StreamReader sr = new StreamReader(wordDoc.MainDocumentPart. GetStream())) { docText = sr.ReadToEnd(); } Regex regexText = new Regex("acvtClientName"); docText = regexText.Replace(docText, "Hi Everyone!"); using (StreamWriter sw = new StreamWriter(wordDoc.MainDocumentPart.GetStream(FileMode.Create))) { sw.Write(docText); } } } } }

    Read the article

  • [NSIS] Custom radio-buttom INI page via Eclipse

    - by Omegazero
    I'm using Eclipse's create InstallOptions menu to create a custom INI page with radio-buttons for repackaging the Blackberry Desktop installer. There are 2 sections for each type: "Internet" and "Enterprise". I need a user to select 1 of the 2 options and depending on their selection, the page will carry over the selection chosen in the custom page, jump to the INSTFILES page, and continue onto the end. I couldn't find any concrete documentation on getting INI pages to load in the script (I'm probably searching incorrectly), and then pass data from one page to the next (according to fields I guess?) Any help is appreciated. Even if it's to tell me I'm blind and can't read a doc (though a link would help :) ) Here's the INI code: ; Auto-generated by EclipseNSIS InstallOptions Script Wizard ; Jul 29, 2009 5:42:56 PM [Settings] NumFields=7 Title=RIM BlackBerry Desktop 5.0 installation CancelEnabled=1 [Field 1] Type=RadioButton Left=15 Top=28 Right=100 Bottom=38 Text=Internet State= Flags=NOTIFY [Field 4] Type=RadioButton Left=15 Top=95 Right=100 Bottom=105 Text=Enterprise Flags=NOTIFY [Field 2] Type=GroupBox Left=0 Top=10 Right=300 Bottom=75 Text= [Field 5] Type=Label Left=30 Top=42 Right=235 Bottom=52 Text=For users who are NOT on the Enterprise (Exchange) server [Field 6] Type=Label Left=30 Top=111 Right=235 Bottom=121 Text=Choose this only if you are on the Exchange server [Field 3] Type=GroupBox Left=0 Top=75 Right=300 Bottom=140 [Field 7] Type=Label Left=0 Top=0 Right=130 Bottom=10 Text=Please choose your installation method ...And here's the NSI code: Auto-generated by EclipseNSIS Script Wizard Jul 29, 2009 5:42:16 PM Name "BlackBerry Desktop" RequestExecutionLevel admin General Symbol Definitions !define VERSION 5.0.0.11 !define COMPANY RIM !define URL http://www.blackberry.com MUI Symbol Definitions !define MUI_ICON BBD.ico !define MUI_LICENSEPAGE_RADIOBUTTONS Included files !include Sections.nsh !include MUI2.nsh Reserved Files ReserveFile "${NSISDIR}\Plugins\AdvSplash.dll" Installer pages !insertmacro MUI_PAGE_WELCOME !insertmacro MUI_PAGE_LICENSE license.txt !insertmacro MUI_PAGE_COMPONENTS !insertmacro MUI_PAGE_INSTFILES !insertmacro MUI_PAGE_FINISH Installer languages !insertmacro MUI_LANGUAGE English Installer attributes OutFile RIM_BlackBerry_Desktop_5.0.exe InstallDir "$TEMP\RIM BlackBerry Desktop 5.0 Setup Files" CRCCheck on XPStyle on ShowInstDetails hide VIProductVersion 5.0.0.11 VIAddVersionKey /LANG=${LANG_ENGLISH} ProductName "BlackBerry Desktop" VIAddVersionKey /LANG=${LANG_ENGLISH} ProductVersion "${VERSION}" VIAddVersionKey /LANG=${LANG_ENGLISH} CompanyName "${COMPANY}" VIAddVersionKey /LANG=${LANG_ENGLISH} CompanyWebsite "${URL}" VIAddVersionKey /LANG=${LANG_ENGLISH} FileVersion "${VERSION}" VIAddVersionKey /LANG=${LANG_ENGLISH} FileDescription "" VIAddVersionKey /LANG=${LANG_ENGLISH} LegalCopyright "" Installer sections Section /o Main SEC0000 SetOutPath $INSTDIR SetOverwrite ifdiff ; TESTING PHASE SectionEnd SectionGroup /e "BlackBerry Desktop Section" Section /o Internet SEC0001 SetOutPath $INSTDIR\DRIVERS SetOverwrite ifdiff ; Execwait 'msiexec /i "$INSTDIR\BlackBerry USB and Modem Drivers_ENG (DM5.0b28).msi" /passive' SetOutPath $INSTDIR SetOverwrite ifdiff ; File /r * ; ExecWait '"$INSTDIR\Setup.exe" /S/v/qb!' SectionEnd Section /o Enterprise SEC0002 SetOutPath $INSTDIR\DRIVERS SetOverwrite ifdiff ; Execwait 'msiexec /i "$INSTDIR\BlackBerry USB and Modem Drivers_ENG (DM5.0b28).msi" /passive' SetOutPath $INSTDIR SetOverwrite ifdiff ; File /r * ; Delete /REBOOTOK "$INSTDIR\Setup.ini" ; Rename /REBOOTOK "$INSTDIR\Setup_Enterprise.ini" "$INSTDIR\Setup.ini" ; ExecWait '"$INSTDIR\Setup.exe" /S/v/qb!' SectionEnd SectionGroupEnd Section Descriptions !insertmacro MUI_FUNCTION_DESCRIPTION_BEGIN !insertmacro MUI_DESCRIPTION_TEXT ${SEC0000} $(SEC0000_DESC) !insertmacro MUI_DESCRIPTION_TEXT ${SEC0001} $(SEC0001_DESC) !insertmacro MUI_FUNCTION_DESCRIPTION_END Installer Language Strings TODO Update the Language Strings with the appropriate translations. LangString SEC0000_DESC ${LANG_ENGLISH} "Installation for non-Exchange/Enterprise BlackBerry Users" LangString SEC0001_DESC ${LANG_ENGLISH} "Installation for Exchange/Enterprise BlackBerry Users"

    Read the article

  • check only one checkbox in gridview using jquery

    - by Gurbax Singh Bhangal
    i have a grid view in which i have placed the checkbox in itemtemplate i want only the one checkbox is selected from Gridview to select that perticular row so that i can use that id to edit or delete the row aspx page code is <asp:TemplateField Visible="false"> <ItemTemplate> <asp:Label ID="lblId" runat="server" Text='<%#Eval("id") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> Select </HeaderTemplate> <ItemTemplate> <asp:CheckBox ID="chkSelect" runat="server"/> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> Branch Name </HeaderTemplate> <ItemTemplate> <asp:Label ID="lblBranch_Name" runat="server" Text='<%# Bind("Branch") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> Address </HeaderTemplate> <ItemTemplate> <asp:Label ID="lblAddress" runat="server" Text='<%# Eval("Address") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> City </HeaderTemplate> <ItemTemplate> <asp:Label ID="lblCity" runat="server" Text='<%# Bind("City") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> </Columns> and i want when i click on the checkbox which is at first of each row only one check box is selected from all the rows thanks

    Read the article

  • Delaying emails in PHP to avoid exceeding server limit

    - by Andrew P.
    Okay, so here's my problem: I have a list of members on a website, and periodically one of the admins my site (who are not very web or tech savvy) will send a newsletter to the memberlist. My current memberlist is well over 800 individuals long. So, I wrote an email script that sends the email to the full memberlist, with the members listed in the Bcc header. However, I've discovered that my host server has a limit of 300 emails per hour, which I apparently exceed even though the members are listed in the Bcc field. (I wasn't previously aware that the behaviour of Bcc was to send separate emails for each name on the list...) After some thought, I've come to the conclusion that my only solution is to have my script send only the email to only the first 300 emails, wait an hour, and send a second email to the next three hundred, wait another hour, and so on until I've sent the email to the whole member list. Looking around on the internet, I've seen some other solutions people have come up with for delaying emails in PHP. Sleep() is obviously not an option, because I can't just leave the script open and running for 3 or four hours. I've seen some people suggest cron jobs, but I'm not sure how feasible it would be to create three new cron jobs every time I send an email, use them once, and then delete them afterward. The final (and what I think is the smartest) solution I've seen, is to have a table in my database to temporarily store the emails to be delayed and sent later, and then create a cron job that checks this sql table every hour or so, compares the timestamp of the row to the current timestamp, and then sends the email if an hour has passed. So I'm asking you all which method you would recommend. Is there an easier solution that I've completely looked over (aside from getting a different hosting plan. ha!), or is there a cleaner way to do it than the database / cron job approach? tl;dr: I have 800 emails to send in an hour on a server that limits me to 300/hr. Using PHP, find a way to get around this problem in a way that the person sending the email needs only to click "send."

    Read the article

  • What is causing this SQL 2005 Primary Key Deadlock between two real-time bulk upserts?

    - by skimania
    Here's the scenario: I've got a table called MarketDataCurrent (MDC) that has live updating stock prices. I've got one process called 'LiveFeed' which reads prices streaming from the wire, queues up inserts, and uses a 'bulk upload to temp table then insert/update to MDC table.' (BulkUpsert) I've got another process which then reads this data, computes other data, and then saves the results back into the same table, using a similar BulkUpsert stored proc. Thirdly, there are a multitude of users running a C# Gui polling the MDC table and reading updates from it. Now, during the day when the data is changing rapidly, things run pretty smoothly, but then, after market hours, we've recently started seeing an increasing number of Deadlock exceptions coming out of the database, nowadays we see 10-20 a day. The imporant thing to note here is that these happen when the values are NOT changing. Here's all the relevant info: Table Def: CREATE TABLE [dbo].[MarketDataCurrent]( [MDID] [int] NOT NULL, [LastUpdate] [datetime] NOT NULL, [Value] [float] NOT NULL, [Source] [varchar](20) NULL, CONSTRAINT [PK_MarketDataCurrent] PRIMARY KEY CLUSTERED ( [MDID] ASC )WITH (PAD_INDEX = OFF, STATISTICS_NORECOMPUTE = OFF, IGNORE_DUP_KEY = OFF, ALLOW_ROW_LOCKS = ON, ALLOW_PAGE_LOCKS = ON) ON [PRIMARY] ) ON [PRIMARY] - stackoverflow wont let me post images until my reputation goes up to 10, so i'll add them as soon as you bump me up, hopefully as a result of this question. ![alt text][1] [1]: http://farm5.static.flickr.com/4049/4690759452_6b94ff7b34.jpg I've got a Sql Profiler Trace Running, catching the deadlocks, and here's what all the graphs look like. stackoverflow wont let me post images until my reputation goes up to 10, so i'll add them as soon as you bump me up, hopefully as a result of this question. ![alt text][2] [2]: http://farm5.static.flickr.com/4035/4690125231_78d84c9e15_b.jpg Process 258 is called the following 'BulkUpsert' stored proc, repeatedly, while 73 is calling the next one: ALTER proc [dbo].[MarketDataCurrent_BulkUpload] @updateTime datetime, @source varchar(10) as begin transaction update c with (rowlock) set LastUpdate = getdate(), Value = t.Value, Source = @source from MarketDataCurrent c INNER JOIN #MDTUP t ON c.MDID = t.mdid where c.lastUpdate < @updateTime and c.mdid not in (select mdid from MarketData where LiveFeedTicker is not null and PriceSource like 'LiveFeed.%') and c.value <> t.value insert into MarketDataCurrent with (rowlock) select MDID, getdate(), Value, @source from #MDTUP where mdid not in (select mdid from MarketDataCurrent with (nolock)) and mdid not in (select mdid from MarketData where LiveFeedTicker is not null and PriceSource like 'LiveFeed.%') commit And the other one: ALTER PROCEDURE [dbo].[MarketDataCurrent_LiveFeedUpload] AS begin transaction -- Update existing mdid UPDATE c WITH (ROWLOCK) SET LastUpdate = t.LastUpdate, Value = t.Value, Source = t.Source FROM MarketDataCurrent c INNER JOIN #TEMPTABLE2 t ON c.MDID = t.mdid; -- Insert new MDID INSERT INTO MarketDataCurrent with (ROWLOCK) SELECT * FROM #TEMPTABLE2 WHERE MDID NOT IN (SELECT MDID FROM MarketDataCurrent with (NOLOCK)) -- Clean up the temp table DELETE #TEMPTABLE2 commit To clarify, those Temp Tables are being created by the C# code on the same connection and are populated using the C# SqlBulkCopy class. To me it looks like it's deadlocking on the PK of the table, so I tried removing that PK and switching to a Unique Constraint instead but that increased the number of deadlocks 10-fold. I'm totally lost as to what to do about this situation and am open to just about any suggestion. HELP!!

    Read the article

  • WMS authentication plugin

    - by roul
    Hi, I'm trying to create a custom authentication plugin for WMS 2009 in C#. I managed to implement something that for some reason blocks all requests... [ComVisible(true)] [Guid("C0A0B38C-C4FE-43B5-BE9E-C100A83BBCEE")] public class AuthenticationPlugin : IWMSBasicPlugin, IWMSAuthenticationPlugin, IWMSAuthenticationContext private const string SubKey = "SOFTWARE\\Microsoft\\Windows Media\\Server\\RegisteredPlugins\\Authentication\\{C0A0B38C-C4FE-43B5-BE9E-C100A83BBCEE}"; [ComRegisterFunction] public static void RegisterFunction(Type t) { try { RegistryKey regHKLM = Registry.LocalMachine; regHKLM = regHKLM.CreateSubKey(SubKey); regHKLM.SetValue(null, "UC WMS Authentication plugin"); RegistryKey regHKCR = Registry.ClassesRoot; regHKCR = regHKCR.CreateSubKey("CLSID\\{C0A0B38C-C4FE-43B5-BE9E-C100A83BBCEE}\\Properties"); regHKCR.SetValue("Name", CustomC WMS Authentication plugin"); regHKCR.SetValue("Author", "Me"); regHKCR.SetValue("CopyRight", "Copyright 2009. All rights reserved"); regHKCR.SetValue("Description", "Enables custom WMS authentication"); } catch (Exception error) { Console.WriteLine(error.Message, "Inside RegisterFunction(). Cannot Register."); } } [ComUnregisterFunction] public static void UnRegisterFunction(Type t) { try { RegistryKey regHKLM = Registry.LocalMachine; regHKLM.DeleteSubKey(SubKey); RegistryKey regHKCR = Registry.ClassesRoot; regHKCR.DeleteSubKeyTree("CLSID\\{C0A0B38C-C4FE-43B5-BE9E-C100A83BBCEE}"); regHKCR.DeleteSubKeyTree("CSEventTest.CSEventPlugin"); } catch (Exception error) { Console.WriteLine(error.Message, "Cannot delete a subkey."); } } #region IWMSBasicPlugin Members public void InitializePlugin(IWMSContext serverContext, WMSNamedValues namedValues, IWMSClassObject classFactory) { } public void ShutdownPlugin() { } public void EnablePlugin(ref int flags, ref int heartbeatPeriod) { } public void DisablePlugin() { } public object GetCustomAdminInterface() { return null; } public void OnHeartbeat() { } #endregion #region IWMSAuthenticationPlugin Members public IWMSAuthenticationContext CreateAuthenticationContext() { return (IWMSAuthenticationContext)this; } public int GetFlags() { return Convert.ToInt32(WMS_AUTHENTICATION_FLAGS.WMS_AUTHENTICATION_ANONYMOUS, CultureInfo.InvariantCulture); } public string GetPackageName() { return "Custom WMS Authentication"; } public string GetProtocolName() { return "Basic"; } #endregion #region IWMSAuthenticationContext Members public void Authenticate(object responseBlob, IWMSContext userContext, IWMSContext presentationContext, IWMSCommandContext commandContext, IWMSAuthenticationCallback callBack, object context) { callBack.OnAuthenticateComplete(WMS_AUTHENTICATION_RESULT.WMS_AUTHENTICATION_SUCCESS, null, context); } public IWMSAuthenticationPlugin GetAuthenticationPlugin() { return (IWMSAuthenticationPlugin)this; } public string GetImpersonationAccountName() { return String.Empty; } public int GetImpersonationToken() { return 0; } public string GetLogicalUserID() { return this.GetImpersonationAccountName(); } #endregion } Can anyone spot why this is happening? Also, is there any way I could have a look at the code for the standard Anonymous Authentication plugin already installed on the server? Is it in an assembly somewhere? Thanks.

    Read the article

  • Seeding repository Rhino Mocks

    - by ahsteele
    I am embarking upon my first journey of test driven development in C#. To get started I'm using MSTest and Rhino.Mocks. I am attempting to write my first unit tests against my ICustomerRepository. It seems tedious to new up a Customer for each test method. In ruby-on-rails I'd create a seed file and load the customer for each test. It seems logical that I could put this boiler plate Customer into a property of the test class but then I would run the risk of it being modified. What are my options for simplifying this code? [TestMethod] public class CustomerTests : TestClassBase { [TestMethod] public void CanGetCustomerById() { // arrange var customer = new Customer() { CustId = 5, DifId = "55", CustLookupName = "The Dude", LoginList = new[] { new Login { LoginCustId = 5, LoginName = "tdude" } } }; var repository = Stub<ICustomerRepository>(); // act repository.Stub(rep => rep.GetById(5)).Return(customer); // assert Assert.AreEqual(customer, repository.GetById(5)); } [TestMethod] public void CanGetCustomerByDifId() { // arrange var customer = new Customer() { CustId = 5, DifId = "55", CustLookupName = "The Dude", LoginList = new[] { new Login { LoginCustId = 5, LoginName = "tdude" } } }; var repository = Stub<ICustomerRepository>(); // act repository.Stub(rep => rep.GetCustomerByDifID("55")).Return(customer); // assert Assert.AreEqual(customer, repository.GetCustomerByDifID("55")); } [TestMethod] public void CanGetCustomerByLogin() { // arrange var customer = new Customer() { CustId = 5, DifId = "55", CustLookupName = "The Dude", LoginList = new[] { new Login { LoginCustId = 5, LoginName = "tdude" } } }; var repository = Stub<ICustomerRepository>(); // act repository.Stub(rep => rep.GetCustomerByLogin("tdude")).Return(customer); // assert Assert.AreEqual(customer, repository.GetCustomerByLogin("tdude")); } } Test Base Class public class TestClassBase { protected T Stub<T>() where T : class { return MockRepository.GenerateStub<T>(); } } ICustomerRepository and IRepository public interface ICustomerRepository : IRepository<Customer> { IList<Customer> FindCustomers(string q); Customer GetCustomerByDifID(string difId); Customer GetCustomerByLogin(string loginName); } public interface IRepository<T> { void Save(T entity); void Save(List<T> entity); bool Save(T entity, out string message); void Delete(T entity); T GetById(int id); ICollection<T> FindAll(); }

    Read the article

  • How can I fix this NavigationController and UIToolbar offset issue in Objective-C?

    - by editor
    I'm adding a couple of buttons to an already-existing NavigationController. The two buttons are added to a UIView, which is pushed onto the NavigationItem. The buttons stop and reload a UIWebView. Problem is that there's a slight offset issue that is making it all look pretty ugly. I wish I could set the UIToolbar to transparent or clear background but that doesn't seem to be an option. Can't seem to use negative offsets either. I've got color matching, but if you look closely there's 1px or 2px of highlighting up top that's causing a visual mismatch and then a slight offset at the bottom. Some relevant code below (based on this, inbound Googlers). What are my options to resolve this? // create a toolbar for the buttons UIToolbar* toolbar = [[UIToolbar alloc] initWithFrame:CGRectMake(0, 0, 100, 45)]; [toolbar setBarStyle: UIBarStyleDefault]; UIColor *colorForBar = [[UIColor alloc] initWithRed:.72 green:0 blue:0 alpha:0]; toolbar.tintColor = colorForBar; [colorForBar release]; //[toolbar setTranslucent:YES]; // create an array for the buttons NSMutableArray* buttons = [[NSMutableArray alloc] initWithCapacity:3]; // create a standard reload button UIBarButtonItem *reloadButton = [[UIBarButtonItem alloc] initWithBarButtonSystemItem:UIBarButtonSystemItemRefresh target:self action:@selector(reload)]; reloadButton.style = UIBarButtonItemStyleBordered; [buttons addObject:reloadButton]; [reloadButton release]; // create a spacer between the buttons UIBarButtonItem *spacer = [[UIBarButtonItem alloc] initWithBarButtonSystemItem:UIBarButtonSystemItemFixedSpace target:nil action:nil]; [buttons addObject:spacer]; [spacer release]; // create a standard delete button with the trash icon UIBarButtonItem *stopButton = [[UIBarButtonItem alloc] initWithBarButtonSystemItem:UIBarButtonSystemItemStop target:self action:@selector(stopLoading)]; stopButton.style = UIBarButtonItemStyleBordered; [buttons addObject:stopButton]; [stopButton release]; // put the buttons in the toolbar and release them [toolbar setItems:buttons animated:NO]; [buttons release]; // place the toolbar into the navigation bar self.navigationItem.rightBarButtonItem = [[UIBarButtonItem alloc] initWithCustomView:toolbar]; [toolbar release];

    Read the article

  • Unique_ptr compiler errors

    - by Godric Seer
    I am designing and entity-component system for a project, and C++ memory management is giving me a few issues. I just want to make sure my design is legitimate. So to start I have an Entity class which stores a vector of Components: class Entity { private: std::vector<std::unique_ptr<Component> > components; public: Entity() { }; void AddComponent(Component* component) { this -> components.push_back(std::unique_ptr<Component>(component)); } ~Entity(); }; Which if I am not mistaken means that when the destructor is called (even the default, compiler created one), the destructor for the Entity, will call ~components, which will call ~std::unique_ptr for each element in the vector, and lead to the destruction of each Component, which is what I want. The component class has virtual methods, but the important part is its constructor: Component::Component(Entity parent) { parent.addComponent(this) // I am not sure if this would work like I expect // Other things here } As long as passing this to the method works, this also does what I want. My confusion is in the factory. What I want to do is something along the lines of: std::shared_ptr<Entity> createEntity() { std::shared_ptr<Entity> entityPtr(new Entity()); new Component(*parent); // Initialize more, and other types of Components return entityPtr; } Now, I believe that this setup will leave the ownership of the Component in the hands of its Parent Entity, which is what I want. First a small question, do I need to pass the entity into the Component constructor by reference or pointer or something? If I understand C++, it would pass by value, which means it gets copied, and the copied entity would die at the end of the constructor. The second, and main question is that code based on this sample will not compile. The complete error is too large to print here, however I think I know somewhat of what is going on. The compiler's error says I can't delete an incomplete type. My Component class has a purely virtual destructor with an implementation: inline Component::~Component() { }; at the end of the header. However since the whole point is that Component is actually an interface. I know from here that a complete type is required for unique_ptr destruction. The question is, how do I work around this? For reference I am using gcc 4.4.6.

    Read the article

  • Why is my UIImageView blurred?

    - by Denis M
    I have a really weird problem with UIImageView. I have an image (an RGB png) 45x45 pixels which I add to the view. I can see that image is blurred after added to the view. Here is the same image in the simulator (left) and in Xcode (right): I have custom UIImageView class with this initWithImage code: - (id) initWithImage:(UIImage*) image { self = [super initWithImage:image]; self.frame = CGRectMake(0, 0, 45, 45); self.contentMode = UIViewContentModeScaleAspectFit; self.quantity = 1; if (self) { self.label = [[UITextField alloc]initWithFrame:CGRectMake(0,40,45,25)]; self.label.font = [UIFont systemFontOfSize:16]; self.label.borderStyle = UITextBorderStyleNone; self.label.enabled = TRUE; self.label.userInteractionEnabled = TRUE; self.label.delegate = self; self.label.keyboardType = UIKeyboardTypeNumbersAndPunctuation; self.label.textAlignment = UITextAlignmentCenter; } self.userInteractionEnabled = TRUE; // Prepare 3 buttons: count up, count down, and delete self.deleteButton = [UIButton buttonWithType:UIButtonTypeRoundedRect]; self.deleteButton.hidden = NO; self.deleteButton.userInteractionEnabled = YES; self.deleteButton.titleLabel.font = [UIFont systemFontOfSize:20]; self.deleteButton.titleLabel.textColor = [UIColor redColor]; [self.deleteButton setTitle:@"X" forState:UIControlStateNormal]; [self.deleteButton addTarget:self action:@selector(deleteIcon:) forControlEvents:UIControlEventTouchUpInside]; self.upCountButton = [UIButton buttonWithType:UIButtonTypeRoundedRect]; self.upCountButton.hidden = NO; self.upCountButton.userInteractionEnabled = YES; [self.upCountButton setTitle:@"+" forState:UIControlStateNormal]; [self.upCountButton addTarget:self action:@selector(addQuantity:) forControlEvents:UIControlEventTouchUpInside]; self.downCountButton = [UIButton buttonWithType:UIButtonTypeRoundedRect]; self.downCountButton.hidden = YES; self.downCountButton.userInteractionEnabled = YES; [self.downCountButton setTitle:@"-" forState:UIControlStateNormal]; [self.downCountButton addTarget:self action:@selector(removeQuantity:) forControlEvents:UIControlEventTouchUpInside]; return self; } I create it like this: UIImage *desertIcon = [UIImage imageNamed:@"desert.png"]; IconObj *desertIconView = [[IconObj alloc] initWithImage:desertIcon]; desertIconView.center = CGPointMake(265,VERTICAL_POINT_ICON); desertIconView.type = [IconObj TYPE_DESERT]; [self.view addSubview:desertIconView]; [desertIconView release]; Why would the displayed image be so than the one stored in a file?

    Read the article

  • How to embed html table into the body of email

    - by Michael Mao
    Hi all: I am sending info to target email via PHP native mail() method right now. Everything else works fine but the table part troubles me the most. See sample output : Dear Michael Mao : Thank you for purchasing flight tickets with us, here is your receipt : Your tickets will be delivered by mail to the following address : Street Address 1 : sdfsdafsadf sdf Street Address 2 : N/A City : Sydney State : nsw Postcode : 2 Country : Australia Credit Card Number : *************1234 Your purchase details are recorded as : <table><tr><th class="delete">del?</th><th class="from_city">from</th><th class="to_city">to</th><th class="quantity">qty</th><th class="price">unit price</th><th class="price">total price</th></tr><tr class="evenrow" id="Sydney-Lima"><td><input name="isDeleting" type="checkbox"></td><td>Sydney</td><td>Lima</td><td>1</td><td>1030.00</td><td>1030</td></tr><tr class="oddrow" id="Sydney-Perth"><td><input name="isDeleting" type="checkbox"></td><td>Sydney</td><td>Perth</td><td>3</td><td>340.00</td><td>1020</td></tr><tr class="totalprice"><td colspan="5">Grand Total Price</td><td id="grandtotal">2050</td></tr></table> The source of table is directly taken from a webpage, exactly as the same. However, Gmail, Hotmail and most of other emails will ignore to render this as a table. So I am wondering, without using Outlook or other email sending agent software, how could I craft a embedded table for the PHP mail() method to send? Current code snippet corresponds to table generation : $purchaseinfo = $_POST["purchaseinfo"]; //if html tags are not to be filtered in the body of email $stringBuilder .= "<table>" .stripslashes($purchaseinfo) ."</table>"; //must send json response back to caller ajax request if(mail($email, 'Your purchase information on www.hardlyworldtravel.com', $emailbody, $headers)) echo json_encode(array("feedback"=>"successful")); else echo json_encode(array("feedback"=>"error")); Any hints and suggestions are welcomed, thanks a lot in advance.

    Read the article

  • how to pass data when using MenuItem.ItemContainerStyle

    - by black sensei
    Hello Experts! i've been trying to have a dynamic ContextMenu to show the name property of each of the object in its collection of objects. here is concrete example ,i'm connecting to a webservice to pull contacts and groups of a particular account.so i have those as global variables.i display the contacts in a listbox and i want to show on right click of a contact in the listbox the list of groups that it can be added to. to be able to add a contact to a group i need the id of the contact(which i have) and the id of the group which i'm looking for here is my code. xmlns:serviceAdmin="clr-namespace:MyWpfApp.serviceAdmin" ...... <ListBox.ContextMenu> <ContextMenu> <MenuItem Header="Refresh" Click="RefreshContact_Click"></MenuItem> <MenuItem Header="Add New Contact" Click="ContactNew_Click"></MenuItem> <MenuItem Header="Add to Group" Name="groupMenus"> //<!--<MenuItem.Resources> // <DataTemplate DataType="{x:Type serviceAdmin:groupInfo}" x:Key="groupMenuKey" > // <MenuItem> // <TextBlock Text="{Binding name}" /> // </MenuItem> // </DataTemplate> // </MenuItem.Resources>--> <MenuItem.ItemContainerStyle> <Style> <Setter Property="MenuItem.Header" Value="{Binding name}"/> <Setter Property="MenuItem.Tag" Value="{Binding id}" /> </Style> </MenuItem.ItemContainerStyle> </MenuItem> <MenuItem Header="Delete Selected" Click="ContactDelete_Click"></MenuItem> </ContextMenu> </ListBox.ContextMenu> ...... and on xaml.cs //this code is in the method that loads the groups loadedgroup = service.getGroups(session.key, null); groupListBox.ItemsSource = loadedgroup; groupMenus.ItemsSource = loadedgroup.ToList(); this code is showing the name of the groups alright but i need the id of the group clicked on. If you've noticed i commented a portion of the xaml code. with that i could bind(with ease) the id to the tag.But it won't work and the MenuItem.ItemContainerStyle is the one working but then i'm lost: Question 1 : how do i create a handler method for a click event of a submenu that has the names of the groups? Question 2 : how do i get the clicked group id to work with? thanks for reading and kindly help me in this

    Read the article

  • Multiprogramming in Django, writing to the Database

    - by Marcus Whybrow
    Introduction I have the following code which checks to see if a similar model exists in the database, and if it does not it creates the new model: class BookProfile(): # ... def save(self, *args, **kwargs): uniqueConstraint = {'book_instance': self.book_instance, 'collection': self.collection} # Test for other objects with identical values profiles = BookProfile.objects.filter(Q(**uniqueConstraint) & ~Q(pk=self.pk)) # If none are found create the object, else fail. if len(profiles) == 0: super(BookProfile, self).save(*args, **kwargs) else: raise ValidationError('A Book Profile for that book instance in that collection already exists') I first build my constraints, then search for a model with those values which I am enforcing must be unique Q(**uniqueConstraint). In addition I ensure that if the save method is updating and not inserting, that we do not find this object when looking for other similar objects ~Q(pk=self.pk). I should mention that I ham implementing soft delete (with a modified objects manager which only shows non-deleted objects) which is why I must check for myself rather then relying on unique_together errors. Problem Right thats the introduction out of the way. My problem is that when multiple identical objects are saved in quick (or as near as simultaneous) succession, sometimes both get added even though the first being added should prevent the second. I have tested the code in the shell and it succeeds every time I run it. Thus my assumption is if say we have two objects being added Object A and Object B. Object A runs its check upon save() being called. Then the process saving Object B gets some time on the processor. Object B runs that same test, but Object A has not yet been added so Object B is added to the database. Then Object A regains control of the processor, and has allready run its test, even though identical Object B is in the database, it adds it regardless. My Thoughts The reason I fear multiprogramming could be involved is that each Object A and Object is being added through an API save view, so a request to the view is made for each save, thus not a single request with multiple sequential saves on objects. It might be the case that Apache is creating a process for each request, and thus causing the problems I think I am seeing. As you would expect, the problem only occurs sometimes, which is characteristic of multiprogramming or multiprocessing errors. If this is the case, is there a way to make the test and set parts of the save() method a critical section, so that a process switch cannot happen between the test and the set?

    Read the article

  • Various GPS Android Functionality Questions..

    - by Tyler
    Hello - I have a few questions (so far) with the the LocationManager on Android and GPS in general.. Feel free to answer any number of the questions below, and I appreciate your help in advance! (I noticed this stuff doesn't appear to be documented very well, so hopefully these questions will help others out too!) 1) I am using the following code, but I think there may be extra fluff in here that I do not need. Can you tell me if I can delete any of this? LocationManager lm = (LocationManager) getSystemService(Context.LOCATION_SERVICE); LocationListener locationListener = new MyLocationListener(); lm.requestLocationUpdates(LocationManager.GPS_PROVIDER, 0, 0, locationListener); LocationProvider locationProvider = lm.getProvider("gps"); Location currentLocation = lm.getLastKnownLocation(locationProvider.getName()); 2) Is there a way to hold off on the last step (accessing "getLastKnownLocation" until after I am sure I have a GPS lock? What happens if this is called and GPS is still looking for signal? 3) MOST importantly, I want to ensure I have a GPS lock before I proceed to my next method, so is there a way to check to see if GPS is locked on and getLastKnownLocation is up to date? 4) Is there a way to 'shut down' the GPS listener once it does receive a lock and getLastKnownLocation is updated? I don't see a need to keep this running for my application once I have obtained a lock.. 5) Can you please confirm my assumption that "getLastKnownLocation" is updated frequently as the receiver moves? 6) In my code, I also have a class called "MyLocationListener" (code below) that I honestly just took from another example.. Is this actually needed? I assume this updates my location manager whenever the location changes, but it sure doesn't appear that there is much to the class itself! private class MyLocationListener implements LocationListener { @Override public void onLocationChanged(Location loc) { if (loc != null) { //Toast.makeText(getBaseContext(), "Location changed : Lat: " + loc.getLatitude() + " Lng: " + loc.getLongitude(), Toast.LENGTH_SHORT).show(); } } @Override public void onProviderDisabled(String provider) { // TODO Auto-generated method stub } @Override public void onProviderEnabled(String provider) { // TODO Auto-generated method stub } @Override public void onStatusChanged(String provider, int status, Bundle extras) { // TODO Auto-generated method stub } }

    Read the article

  • GWT combobox not displaying correctly

    - by James
    Hi, I am using GWT with GWT-EXT running in glassfish. I create 2 combo boxes as follows: import com.extjs.gxt.ui.client.widget.form.ComboBox; import com.extjs.gxt.ui.client.widget.form.SimpleComboBox; this.contentPanel = new ContentPanel(); this.contentPanel.setFrame(true); this.contentPanel.setSize((int)(Window.getClientWidth()*0.95), 600); this.contentPanel.setLayout(new FitLayout()); initWidget(this.contentPanel); SimpleComboBox<String> combo = new SimpleComboBox<String>(); combo.setEmptyText("Select a topic..."); combo.add("String1"); combo.add("String2"); this.contentPanel.add(combo); ComboBox combo1 = new ComboBox(); combo1.setEmptyText("Select a topic..."); ListStore topics = new ListStore(); topics.add("String3"); topics.add("String4"); combo.setStore(topics); this.contentPanel.add(combo1); When these are loaded in the browser (IE 8.0, Firefox 3.6.6 or Chrome 10.0) the combo boxes are shown but don't have the pull down arrow. They look like a text field with the "Select a topic..." text. When you select the text it disappears and if you type a character and then delete it the options are shown (i.e. pull down is invoked) however, there is still no pull down arrow. Does anyone know what the issue might be? Or how I can investigate further? Is it possible to see the actual HTML the browser is getting, when I View Page Source I only get the landing page HTML. As an additional I also have a import com.google.gwt.user.client.ui.Grid that does not render correctly. It is in table format but has no grid lines or header bar etc. Cheers, James

    Read the article

  • dynamiclly schedule a lead sales agent

    - by Josh
    I have a website that I'm trying to migrate from classic asp to asp.net. It had a lead schedule, where each sales agent would be featured for the current day, or part of the day.The next day a new agent would be scheduled. It was driven off a database table that had a row for each day in it. So to figure out if a sales agent would show on a day, it was easy, just find today's date in the table. Problem was it ran out rows, and you had to run a script to update the lead days 6 months at a time. Plus if there was ever any change to the schedule, you had to delete all the rows and re-run the script. So I'm trying to code it where sql server figures that out for me, and no script has to be ran. I have a table like so CREATE TABLE [dbo].[LeadSchedule]( [leadid] [int] IDENTITY(1,1) NOT NULL, [userid] [int] NOT NULL, [sunday] [bit] NOT NULL, [monday] [bit] NOT NULL, [tuesday] [bit] NOT NULL, [wednesday] [bit] NOT NULL, [thursday] [bit] NOT NULL, [friday] [bit] NOT NULL, [saturday] [bit] NOT NULL, [StartDate] [smalldatetime] NULL, [EndDate] [smalldatetime] NULL, [StartTime] [time](0) NULL, [EndTime] [time](0) NULL, [order] [int] NULL, So the user can schedule a sales agent depending on their work schedule. Also if they wanted to they could split certain days, or sales agents by time, So from Midnight to 4 it was one agent, from 4-midnight it was another. So far I've tried using a numbers table, row numbers, goofy date math, and I'm at a loss. Any suggestions on how to handle this purely from sql code? If it helps, the table should always be small, like less than 20 never over 100. update After a few hours all I've managed to come up with is the below. It doesn't handle filling in days not available or times, just rotates through all the sales agents with leadTable as ( select leadid,userid,[order],StartDate, case DATEPART(dw,getdate()) when 1 then sunday when 2 then monday when 3 then tuesday when 4 then wednesday when 5 then thursday when 6 then friday when 7 then saturday end as DayAvailable , ROW_NUMBER() OVER (ORDER BY [order] ASC) AS ROWID from LeadSchedule where GETDATE()>=StartDate and (CONVERT(time(0),GETDATE())>= StartTime or StartTime is null) and (CONVERT(time(0),GETDATE())<= EndTime or EndTime is null) ) select userid, DATEADD(d,(number+ROWID-2)*totalUsers,startdate ) leadday from (select *, (select COUNT(1) from leadTable) totalUsers from leadTable inner join Numbers on 1=1 where DayAvailable =1 ) tb1 order by leadday asc

    Read the article

  • Image rescale and write rescaled image file in blackberry

    - by Karthick
    I am using the following code to resize and save the file in to the blackberry device. After image scale I try to write image file into device. But it gives the same data. (Height and width of the image are same).I have to make rescaled image file.Can anyone help me ??? class ResizeImage extends MainScreen implements FieldChangeListener { private String path="file:///SDCard/BlackBerry/pictures/test.jpg"; private ButtonField btn; ResizeImage() { btn=new ButtonField("Write File"); btn.setChangeListener(this); add(btn); } public void fieldChanged(Field field, int context) { if (field == btn) { try { InputStream inputStream = null; //Get File Connection FileConnection fileConnection = (FileConnection) Connector.open(path); if (fileConnection.exists()) { inputStream = fileConnection.openInputStream(); //byte data[]=inputStream.toString().getBytes(); ByteArrayOutputStream baos = new ByteArrayOutputStream(); int j = 0; while((j=inputStream.read()) != -1) { baos.write(j); } byte data[] = baos.toByteArray(); inputStream.close(); fileConnection.close(); WriteFile("file:///SDCard/BlackBerry/pictures/org_Image.jpg",data); EncodedImage eImage = EncodedImage.createEncodedImage(data,0,data.length); int scaleFactorX = Fixed32.div(Fixed32.toFP(eImage.getWidth()), Fixed32.toFP(80)); int scaleFactorY = Fixed32.div(Fixed32.toFP(eImage.getHeight()), Fixed32.toFP(80)); eImage=eImage.scaleImage32(scaleFactorX, scaleFactorY); WriteFile("file:///SDCard/BlackBerry/pictures/resize.jpg",eImage.getData()); BitmapField bit=new BitmapField(eImage.getBitmap()); add(bit); } } catch(Exception e) { System.out.println("Exception is ==> "+e.getMessage()); } } } void WriteFile(String fileName,byte[] data) { FileConnection fconn = null; try { fconn = (FileConnection) Connector.open(fileName,Connector.READ_WRITE); } catch (IOException e) { System.out.print("Error opening file"); } if (fconn.exists()) try { fconn.delete(); } catch (IOException e) { System.out.print("Error deleting file"); } try { fconn.create(); } catch (IOException e) { System.out.print("Error creating file"); } OutputStream out = null; try { out = fconn.openOutputStream(); } catch (IOException e) { System.out.print("Error opening output stream"); } try { out.write(data); } catch (IOException e) { System.out.print("Error writing to output stream"); } try { fconn.close(); } catch (IOException e) { System.out.print("Error closing file"); } } }

    Read the article

  • Flash Buttons Don't Work: TypeError: Error #1009: Cannot access a property or method of a null objec

    - by goldenfeelings
    I've read through several threads about this error, but haven't been able to apply it to figure out my situation... My flash file is an approx 5 second animation. Then, the last keyframe of each layer (frame #133) has a button in it. My flash file should stop on this last key frame, and you should be able to click on any of the 6 buttons to navigate to another html page in my website. Here is the Action Script that I have applied to the frame in which the buttons exist (on a separate layer, see screenshot at: http://www.footprintsfamilyphoto.com/wp-content/themes/Footprints/images/flash_buttonissue.jpg stop (); function babieschildren(event:MouseEvent):void { trace("babies children method was called!!!"); var targetURL:URLRequest = new URLRequest("http://www.footprintsfamilyphoto.com/portfolio/babies-children"); navigateToURL(targetURL, "_self"); } bc_btn1.addEventListener(MouseEvent.CLICK, babieschildren); bc_btn2.addEventListener(MouseEvent.CLICK, babieschildren); function fams(event:MouseEvent):void { trace("families method was called!!!"); var targetURL:URLRequest = new URLRequest("http://www.footprintsfamilyphoto.com/portfolio/families"); navigateToURL(targetURL, "_self"); } f_btn1.addEventListener(MouseEvent.CLICK, fams); f_btn2.addEventListener(MouseEvent.CLICK, fams); function couplesweddings(event:MouseEvent):void { trace("couples weddings method was called!!!"); var targetURL:URLRequest = new URLRequest("http://www.footprintsfamilyphoto.com/portfolio/couples-weddings"); navigateToURL(targetURL, "_self"); } cw_btn1.addEventListener(MouseEvent.CLICK, couplesweddings); cw_btn2.addEventListener(MouseEvent.CLICK, couplesweddings); When I test the movie, I get this error in the output box: "TypeError: Error #1009: Cannot access a property or method of a null object reference." The test movie does stop on the appropriate frame, but the buttons don't do anything (no URL is opened, and the trace statements don't show up in the output box when the buttons are clicked on the test movie). You can view the .swf file here: www.footprintsfamilyphoto.com/portfolio I'm confident that all 6 buttons do exist in the appropriate frame (frame 133), so I don't think that's what's causing the 1009 error. I also tried deleting each of the three function/addEventListener sections one at a time and testing, and I still got the 1009 error every time. If I delete ALL of the action script except for the "stop ()" line, then I do NOT get the 1009 error. Any ideas?? I'm very new to Flash, so if I haven't clarified something that I need to, let me know!

    Read the article

  • ASP.NET MVC CRUD PartialView Popup Issue

    - by Smiley Face
    I am creating an MVC website which makes use of Partial Views on Popups to handle all my CRUD transactions. Please note that my application can already handle these CRUD operations perfectly (LINQ-To-Entity). However, I have a problem with my popup forms. Below is the code from my _Add.cshtml: @model MyStore.Models.MyModels.ProductsModel @{ Layout = null; } @using (Ajax.BeginForm("_Add", "Products", new AjaxOptions { InsertionMode = InsertionMode.Replace, HttpMethod = "POST", OnSuccess = "addSuccess" }, new { @id = "addForm" })) { @Html.ValidationSummary(true) <div id="add-message" class="error invisible"></div> <fieldset> <legend>Products</legend> @Html.HiddenFor(m => Model.ProductCode) <div class="editor-label"> @Html.LabelFor(model => model.ProductName) </div> <div class="editor-field"> @Html.EditorFor(model => model.ProductName) @Html.ValidationMessageFor(model => model.ProductName) </div> <div class="editor-label"> @Html.LabelFor(model => model.Price) </div> <div class="editor-field"> @Html.TextBoxFor(model => model.Price) @Html.ValidationMessageFor(model => model.Price) </div> </fieldset> } Below is the code from my Controller: [HttpGet] public ActionResult _Add(string productCode) { ProductsModel model = newProductsModel(); model.ProductCode = ProductCode ; return PartialView(model); } [HttpPost] public JsonResult _Add(ProductsModel model) { if (ModelState.IsValid) { ProductsManager prod = new ProductsManager(); Products pa = new Products(); pa.ProductCode = model.ProductCode; pa.ProductName = model.ProductName; pa.Price = model.Price; prod.AddProduct(pa); return Json(HelperClass.SuccessResponse(pa), JsonRequestBehavior.AllowGet); } else { return Json(HelperClass.ErrorResponse("Please review your form"), JsonRequestBehavior.DenyGet); } } Please note that the _Add.cshtml is a partial view which is being rendered through a Popup.js which I found on the internet. It is rendered through this code: @Html.ActionLink("[Add Product]", "_Add", new { ProductCode = @ViewData["ProductCode"] }, new { @class = "editLink" }) This works okay. I mean it adds product to my database. But my problem is upon clicking the Proceed button, I get this pop-up download dialog from the page: Can somebody please help me with this? I have a hunch it's because of the HttpMethod i'm using (POST, PUT, GET, DELETE) but i'm not really sure which one is right to use or if it really is the problem in the first place. Any help would be greatly appreciated! PS. Sorry for the long post.

    Read the article

  • Rails 3 - development errors in production mode

    - by skrafi
    Im using Rails, Passenger (both are 3.0.5) and Nginx on my production server. As I heard, Rails should show public/404.html or public/500.html instead of development errors like ActiveRecord::RecordNotFound or Unknown action but that doesn't happen. I've tried to delete config.ru file and set rack_env or rails_env in nginx.conf but nothing helped. Here is my nginx.conf: worker_processes 1; events { worker_connections 1024; } http { passenger_root /home/makk/.rvm/gems/ruby-1.9.2-p0/gems/passenger-3.0.5; passenger_ruby /home/makk/.rvm/bin/passenger_ruby; #passenger_ruby /home/makk/.rvm/wrappers/ruby-1.9.2-p0/ruby; include mime.types; default_type application/octet-stream; sendfile on; keepalive_timeout 65; server { listen 80; server_name localhost; location / { root /home/makk/projects/1server/deploy/current/public; index index.html index.htm; passenger_enabled on; rack_env production; recursive_error_pages on; if (-f /home/makk/projects/1server/maintenance.html) { return 503; } error_page 404 /404.html; error_page 500 502 504 /500.html; error_page 503 @503; } location @503 { error_page 405 = /maintenance.html; # Serve static assets if found. if (-f $request_filename) { break; } rewrite ^(.*)$ /maintenance.html break; } location ~ ^(\/phpmyadmin\/)(.*)$ { fastcgi_pass 127.0.0.1:9000; fastcgi_index index.php; fastcgi_split_path_info ^(\/phpmyadmin\/)(.*)$; fastcgi_param SCRIPT_FILENAME /usr/share/phpmyadmin/$fastcgi_path_info; include fastcgi_params; } } } It seems that this question duplicates this one but there are no working suggestions. UPD: I have both development and production apps on same PC. In production Rails ignores config.consider_all_requests_local = false (in /config/environments/production.rb) due to local_request? method. So one of possible solutions is listed below (taken from here): # config/initializers/local_request_override.rb module CustomRescue def local_request? return false if Rails.env.production? || Rails.env.staging? super end end ActionController::Base.class_eval do include CustomRescue end Or for Rails 3: class ActionDispatch::Request def local? false end end

    Read the article

  • Sending HTML email from PHP

    - by KevinM
    I am trying to send a simple HTML e-mail from PHP. The code below simply results in a blank e-mail in GMail. It also has an empty attachment called 'noname', which is not at all what I want; though that might just be a symptom of it not working. The code I am using is: <?php //define the receiver of the email $to = '[email protected]'; //define the subject of the email $subject = 'Test HTML email'; //create a boundary string. It must be unique //so we use the MD5 algorithm to generate a random hash $random_hash = md5(date('r', time())); //define the headers we want passed. Note that they are separated with \r\n $headers = "From: [email protected]\r\nReply-To: [email protected]"; //add boundary string and mime type specification $headers .= "\r\nContent-Type: multipart/alternative; boundary=\"PHP-alt-".$random_hash."\""; //define the body of the message. ob_start(); //Turn on output buffering ?> --PHP-alt-<?php echo $random_hash; ?> MIME-Version: 1.0 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: 7bit Hello World!!! This is simple text email message. --PHP-alt-<?php echo $random_hash; ?> MIME-Version: 1.0 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: 7bit <h2>Hello World!</h2> <p>This is something with <b>HTML</b>formatting.</p> --PHP-alt-<?php echo $random_hash; ?>-- <? //copy current buffer contents into $message variable and delete current output buffer $message = ob_get_clean(); //send the email $mail_sent = @mail( $to, $subject, $message, $headers ); //if the message is sent successfully print "Mail sent". Otherwise print "Mail failed" echo $mail_sent ? "Mail sent" : "Mail failed";

    Read the article

  • J2ME/Java: Referencing StringBuffer through Threads

    - by Jemuel Dalino
    This question might be long, but I want to provide much information. Overview: I'm creating a Stock Quotes Ticker app for Blackberry. But I'm having problems with my StringBuffer that contains an individual Stock information. Process: My app connects to our server via SocketConnection. The server sends out a formatted set of strings that contains the latest Stock trade. So whenever a new trade happens, the server will send out an individual Stock Quote of that trade. Through an InputStream I am able to read that information and place each character in a StringBuffer that is referenced by Threads. By parsing based on char3 I am able to determine a set of stock quote/information. char1 - to separate data char3 - means end of a stock quote/information sample stock quote format sent out by our server: stock_quote_name(char 1)some_data(char1)some_data(char1)(char3) My app then parses that stock quote to compare certain data and formats it how it will look like when displayed in the screen. When trades happen gradually(slow) the app works perfectly. However.. Problem: When trades happen too quickly and almost at the same time, My app is not able to handle the information sent efficiently. The StringBuffer has its contents combined with the next trade. Meaning Two stock information in one StringBuffer. field should be: Stock_quote_name some_data some_data sample of what's happening: Stock_quote_name some_data some_dataStock_quote_name some_data some_data here's my code for this part: while (-1 != (data = is.read())) { sb.append((char)data); while(3 != (data = is.read())) { sb.append((char)data); } UiApplication.getUiApplication().invokeLater(new Runnable() { public void run() { try { synchronized(UiApplication.getEventLock()) { SetStringBuffer(sb); DisplayStringBuffer(); RefreshStringBuffer(); } } catch (Exception e) { System.out.println("Error in setting stringbuffer: " + e.toString()); } } }); } public synchronized void DisplayStringBuffer() { try { //parse sb - string buffer ...... } catch(Exception ex) { System.out.println("error in DisplayStringBuffer(): " + ex.toString()); } } public synchronized void SetStringBuffer(StringBuffer dataBuffer) { this.sb =dataBuffer; System.out.println(sb); } public synchronized void RefreshStringBuffer() { this.sb.delete(0, this.sb.length()); } From what I can see, when trades happen very fast, The StringBuffer is not refreshed immediately and still has the contents of the previous trade, when i try to put new data. My Question is: Do you guys have any suggestion on how i can put data into the StringBuffer, without the next information being appended to the first content

    Read the article

< Previous Page | 420 421 422 423 424 425 426 427 428 429 430 431  | Next Page >