Search Results

Search found 16688 results on 668 pages for 'expression language'.

Page 424/668 | < Previous Page | 420 421 422 423 424 425 426 427 428 429 430 431  | Next Page >

  • Mixed Table Type with other types as parameters to Stored Procedured c#

    - by amemak
    Hi, I am asking about how could i pass multi parameters to a stored procedure, one of these parameters is user defined table. When I tried to do it it shows this error: INSERT INTO BD (ID, VALUE, BID) values( (SELECT t1.ID, t1.Value FROM @Table AS t1),someintvalue) here @Table is the user defined table parameter. Msg 116, Level 16, State 1, Procedure UpdateBD, Line 12 Only one expression can be specified in the select list when the subquery is not introduced with EXISTS. Msg 109, Level 15, State 1, Procedure UpdateBD, Line 11 There are more columns in the INSERT statement than values specified in the VALUES clause. The number of values in the VALUES clause must match the number of columns specified in the INSERT statement. Thank you

    Read the article

  • SImplifying with LINQ - Basic selection

    - by baron
    Hello foreach (var person in peopleList.Where(person => person.FirstName == "Messi")) { selectPeople.Add(person); } I am just wondering if there is any way to simplify this using LINQ. Like rather than look at all the people I was trying to use LINQ to just fill a list with the "Messi"'s... was trying something like... var selectPeople = peopleList.Select(x=>x.FirstName=="Messi"); Then I could just add everyone in that list without a check. But it doesn't quite work as planned. Maybe there's no point simplifying that expression. But the question seemed worthwhile just to strengthen my LINQ knowledge.

    Read the article

  • How do I create regex groups for replacement?

    - by resting
    I have this sample string: Image: SGD$45.32 SKU: 3f3f3 dfdfd grg4t BP 6yhf Pack Size: 1000's Color: Green Price: SGD$45.32 SGD$45... I would like to remove all the prices namely: SGD$45.32 Price: SGD$45.32 SGD$45 I have this expression thats supposed to match the 3 groups: $pattern = '/(Price.+\sSGD\$\d+\.\d{2})(SGD\$\d+\.\d{2})(SGD\$\d+)/'; $new_snippet = preg_replace($pattern, '', $snippet);` But apparently its not working. It works if I replace a single group at a time. But, I'd like to know if it possible to replace all possible matching groups with a single statement. Tried preg_match_all($pattern, $snippet, $matches); to show matches based on the above pattern, but no matches are found if I put all 3 groups together.

    Read the article

  • Jasper Reports - Add one day to a Date Parameter

    - by Templar
    I'm creating a Jasper report that includes the following parameters: DATESTART (Date) DATEEND (Date) These parameters indicate a date range for a field called DATECREATED (Timestamp) which includes times. I would like the date range to be INCLUSIVE, that is, if I filter for "Jan 1, 2009" to "Jan 31, 2009", any DATECREATED value on Jan 31, 2009 (such as "Jan 31, 2009 15:00") will be included in the report. When I used Crystal Reports in the past, I used the DATEADD function to create a filter expression like the following: {DATECREATED} >= {DATESTART} and {DATECREATED} < DATEADD("d", 1, {DATEEND}) (I realize that this isn't syntactically correct, but you get the idea.) Is there any way to do something similar in Jasper Reports?

    Read the article

  • Error: A SQLParamenter wtih ParameterName @myparm is not contained by this SQLParameter Collection

    - by SidC
    Good Morning, I'm working on an ASP.NET 3.5 webforms application and have written the following code: Protected Sub btnSubmit_Click(ByVal sender As Object, ByVal e As System.EventArgs) Handles btnSubmit.Click Dim connectionString As String = WebConfigurationManager.ConnectionStrings("Diel_inventoryConnectionString").ConnectionString Dim con As New SqlConnection(connectionString) Dim adapter1 As New SqlDataAdapter adapter1.SelectCommand = New SqlCommand adapter1.SelectCommand.CommandType = CommandType.StoredProcedure adapter1.SelectCommand.CommandText = "PartSproc" Dim parmNSN As New SqlParameter("@NSN", SqlDbType.NVarChar) Dim parmName As New SqlParameter("@PartName", SqlDbType.NVarChar) txtNSN.Text = adapter1.SelectCommand.Parameters("@NSN").Value txtSearch.Text = adapter1.SelectCommand.Parameters("@PartName").Value Dim dt As New DataTable() adapter1.Fill(dt) MySearch.DataSource = dt MySearch.DataBind() End Sub When I run the page, I receive the error A SQLParameter with @NSN is not contained by this SQLParameter Collection. I tried using apostrophes around the @NSN and @PartName but that does not work either and presents expression expected error. How might I rectify the above code so that it references the @NSN and @PartName parameters correctly? Thanks, Sid

    Read the article

  • SQL CHECK constraint issues

    - by blahblah
    I'm using SQL Server 2008 and I have a table with three columns: Length, StartTime and EndTime. I want to make a CHECK constraint on this table which says that: if Length == NULL then StartTime <> NULL and EndTime <> NULL else StartTime == NULL and EndTime == NULL I've begun to try things like this: Length == NULL AND StartTime <> NULL AND EndTime <> NULL Obviously this is not enough, but even this simple expression will not validate. I get the error: "Error validating 'CK_Test_Length_Or_Time'. Do you want to edit the constraint?" Any ideas on how to go about doing this?

    Read the article

  • regex to format a float in php

    - by Itamar Bar-Lev
    I have a PHP function for formatting a float to a given amount of decimal points that uses number_format(), and then removes the unneeded zeros (and also the '.' if possible): $float = number_format($float, $decimalPlaces, '.', ''); for ($i = 0; $i < $decimalPlaces; $i++) { if (substr($float, strlen($float) - 1, strlen($float)) == '0') { $float = substr($float, 0, strlen($float) - 1); } } if (substr($float, strlen($float) - 1, strlen($float)) == '.') { $float = substr($float, 0, strlen($float) - 1); } Is it possible to do so more effectively with a regular expression?

    Read the article

  • Numbering Regex Submatches

    - by gentlylisped
    Is there a canonical ordering of submatch expressions in a regular expression? For example: What is the order of the submatches in "(([0-9]{3}).([0-9]{3}).([0-9]{3}).([0-9]{3}))\s+([A-Z]+)" ? a. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([A-Z]+) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) b. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([A-Z]+) or c. somthin' else.

    Read the article

  • Javascript substrings multiline replace by RegExp

    - by Radek Šimko
    Hi, I'm having some troubles with matching a regular expression in multi-line string. <script> var str="Welcome to Google!\n"; str = str + "We are proud to announce that Microsoft has \n"; str = str + "one of the worst Web Developers sites in the world."; document.write(str.replace(/.*(microsoft).*/gmi, "$1")); </script> http://jsbin.com/osoli3/3/edit As you may see on the link above, the output of the code looks like this: Welcome to Google! Microsoft one of the worst Web Developers sites in the world. Which means, that the replace() method goes line by line and if there's no match in that line, it returns just the whole line... Even if it has the "m" (multiline) modifier...

    Read the article

  • In Haskell, how can you sort a list of infinite lists of strings?

    - by HaskellNoob
    So basically, if I have a (finite or infinite) list of (finite or infinite) lists of strings, is it possible to sort the list by length first and then by lexicographic order, excluding duplicates? A sample input/output would be: Input: [["a", "b",...], ["a", "aa", "aaa"], ["b", "bb", "bbb",...], ...] Output: ["a", "b", "aa", "bb", "aaa", "bbb", ...] I know that the input list is not a valid haskell expression but suppose that there is an input like that. I tried using merge algorithm but it tends to hang on the inputs that I give it. Can somebody explain and show a decent sorting function that can do this? If there isn't any function like that, can you explain why? In case somebody didn't understand what I meant by the sorting order, I meant that shortest length strings are sorted first AND if one or more strings are of same length then they are sorted using < operator. Thanks!

    Read the article

  • Using Regex groups in bash

    - by AlexeyMK
    Greetings, I've got a directory with a list of pdfs in it: file1.pdf, file2.pdf, morestuff.pdf ... etc. I want to convert these pdfs to pngs, ie file1.png, file2.png, morestuff.png ... etc. The basic command is, convert from to, But I'm having trouble getting convert to rename to the same file name. The obvious 'I wish it worked this way' is convert *.pdf *.png But clearly that doesn't work. My thought process is that I should utilize regular expression grouping here, to say somethink like convert (*).pdf %1.png but that clearly isn't the right syntax. I'm wondering what the correct syntax is, and whether there's a better approach (that doesn't require jumping into perl or python) that I'm ignoring. Thanks!

    Read the article

  • Do I need to include the 'this' when using a property name in a closure?

    - by Scott Whitlock
    I'm using a list of Actions to store an undo history for an object. Let's say I have a property of my object called myChildObject and it's being changed, so I want to store the undo action where I would set it back to it's current value: public class Class1 { public Class1() { } private readonly List<Action> m_undoActions = new List<Action>(); private SomeObject myChildObject { get; set; } public void ChangeState(SomeObject newChildObject) { // copies the reference SomeObject existingObject = myChildObject; m_undoActions.Add(() => myChildObject = existingObject); myChildObject = newChildObject; } } Looking at the lambda expression, existingObject is a local variable, so it's using a closure to pass a reference to that variable, but what about the property myChildObject? Do I need to use 'this' to preface it? Do I need to make a copy of the 'this' reference to a local variable first? Thanks for helping me understand this closure stuff.

    Read the article

  • PostgreSQL String search for partial patterns removing exrtaneous characters

    - by tbrandao
    Looking for a simple SQL (PostgreSQL) regular expression or similar solution (maybe soundex) that will allow a flexible search. So that dashes, spaces and such are omitted during the search. As part of the search and only the raw characters are searched in the table.: Currently using: SELECT * FROM Productions WHERE part_no ~* '%search_term%' If user types UTR-1 it fails to bring up UTR1 or UTR 1 stored in the database. But the matches do not happen when a part_no has a dash and the user omits this character (or vice versa) EXAMPLE search for part UTR-1 should find all matches below. UTR1 UTR --1 UTR 1 any suggestions...

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • asp.net databinding string is passed to function but runtime occurs

    - by rod
    Hi All, I'm using a code-behind function (called TestFx) in my binding expression. I'm passing a string and the function accepts a string but I still get a runtime error saying invalid args. But if I change the method to accept an object and inspect the value, "it's a string!" Can someone please explain? -rod ProductDescription: <asp:Label ID="ProductDescriptionLabel" runat="server" Text='<%# TestFx(Eval("ProductDescription")) %>' /> <br />

    Read the article

  • Looping through list items with jquery

    - by Gallen
    I have this block of code listItems = $("#productList").find("li"); for (var li in listItems) { var product = $(li); var productid = product.children(".productId").val(); var productPrice = product.find(".productPrice").val(); var productMSRP = product.find(".productMSRP").val(); totalItemsHidden.val(parseInt(totalItemsHidden.val(), 10) + 1); subtotalHidden.val(parseFloat(subtotalHidden.val()) + parseFloat(productMSRP)); savingsHidden.val(parseFloat(savingsHidden.val()) + parseFloat(productMSRP - productPrice)); totalHidden.val(parseFloat(totalHidden.val()) + parseFloat(productPrice)); } and I'm not getting the desired results - totalItems is coming out as 180+ and the rest all NaN. I suspect its where i use var product = $(li); or perhaps with the expression on the loop itself. Either way - I need to loop through the <li> items in the <ul> labelled #productList

    Read the article

  • Can't enumerate LinQ results with left join

    - by nvtthang
    var itemSet = from item in da.GetList<Models.account>() join file in objFileStorageList on item.account_id equals file.parent_id into objFile from fileItem in objFile.DefaultIfEmpty() where item.company != null && item.company.company_id == 123 orderby item.updatedDate descending select new { Id = item.account_id, RefNo = item.refNo, StartDate = item.StartDate , EndDate = item.EndDate , Comment = item.comment, FileStorageID = fileItem != null ? fileItem.fileStorage_id : -1, Identification = fileItem != null ? fileItem.identifier : null, fileName = fileItem != null ? fileItem.file_nm : null }; It raises error message when I try to enumerate through collection result from Linq query above. LINQ to Entities does not recognize the method 'System.Collections.Generic.IEnumerable1[SCEFramework.Models.fileStorage] DefaultIfEmpty[fileStorage](System.Collections.Generic.IEnumerable1[SCEFramework.Models.fileStorage])' method, and this method cannot be translated into a store expression foreach (var item in itemSet) { string itemRef= item.RefNo; } Please suggest me any solutions. Thanks in advance.

    Read the article

  • a question on webpage data scraping using Java

    - by Gemma
    Hi there. I am now trying to implement a simple HTML webpage scraper using Java.Now I have a small problem. Suppose I have the following HTML fragment. <div id="sr-h-left" class="sr-comp"> <a class="link-gray-underline" id="compare_header" rel="nofollow" href="javascript:i18nCompareProd('/serv/main/buyer/ProductCompare.jsp?nxtg=41980a1c051f-0942A6ADCF43B802'); " Compare Showing 1 - 30 of 1,439 matches, The data I am interested is the integer 1.439 shown at the bottom.I am just wondering how can I get that integer out of the HTML. I am now considering using a regular expression,and then use the java.util.Pattern to help get the data out,but still not very clear about the process. I would be grateful if you guys could give me some hint or idea on this data scraping. Thanks a lot.

    Read the article

  • Redirect www.example.com/apple to food.example.com/fruits/apple

    - by Senthil
    I want to redirect users from www.example.com/apple to http://food.example.com/fruits/apple Note: This is a hardcoded redirection. Even a mapping if you will. "apple" will not be substituted with anything else. Nothing in the two URLs will change except for the domain of course. So there is no need for a regular expression to match the "apple" or anything else. There is already dozens of RewriteCond and RewriteRule things in the .htaccess file. I do not want them to be affected. This redirection is independent of those. I have access to the .htaccess file at the root of www.example.com and the httpd.conf What code should I put in .htaccess in order to achieve this? Or should I change the httpd.conf?

    Read the article

  • Delphi component or library to display mathematical expressions

    - by Svein Bringsli
    I'm looking for a simple component that displays mathematical expressions in Delphi. When I started out I thought it would be easy to find something on the net, but it turns out it was harder than anticipated. There are lots and lots of components that will parse mathematical expressions, but few (none?) that will display them. Ideally I would like a component as simple as a TLabel, where I could set the caption to some expression and it would be displayed correctly, but some sort of library that let's me draw expressions to a canvas would also be sufficient for my needs. Update: I'm not talking about plotting graphs of functions or something like that. I want to display (for instance) (X^2+3)/X like this:

    Read the article

  • Tentative date casting in tsql

    - by Tewr
    I am looking for something like TRYCAST in TSQL or an equivalent method / hack. In my case I am extracting some date data from an xml column. The following query throws "Arithmetic overflow error converting expression to data type datetime." if the piece of data found in the xml cannot be converted to datetime (in this specific case, the date is "0001-01-01" in some cases). Is there a way to detect this exception before it occurs? select [CustomerInfo].value('(//*:InceptionDate/text())[1]', 'datetime') FROM Customers An example of what I am trying to achieve in pseudocode with an imagined tsql function TRYCAST(expr, totype, defaultvalue): select TRYCAST( [CustomerInfo].value('(//*:InceptionDate/text())[1]', 'nvarchar(100)'), datetime, null) FROM Customers

    Read the article

  • Assigning an @Annotation enum a value

    - by h2g2java
    I created enum Restrictions{ none, enumeration, fractionDigits, length, maxExclusive, maxInclusive, maxLength, minExclusive, minInclusive, minLength, pattern, totalDigits, whiteSpace; public Restrictions setValue(int value){ this.value = value; return this; } public int value; } So that I could happily do something like this, which is perfectly legal syntax. Restrictions r1 = Restrictions.maxLength.setValue(64); The reason being is, I am using enum to restrict the type of restriction that could be used, and be able to assign a value to that restriction. However, my actual motivation is to use that restriction in an @annotation. @Retention(RetentionPolicy.RUNTIME) @Target({ElementType.TYPE, ElementType.FIELD, ElementType.METHOD}) public @interface Presentable { Restrictions[] restrictions() default Restrictions.none; } So that, I intended to do this: @Presentable(restrictions=Restrictions.maxLength.setValue(64)) public String userName; to which, the compiler croaks The value for annotation enum attribute must be an enum constant expression. Is there a way to accomplish what I wish to accomplish

    Read the article

  • Is it possible to use DLR in a .NET 3.5 website project?

    - by Aplato
    I'm trying to evaluate an expression stored in a database i.e. "if (Q1 ==2) {result = 3.1;} elseif (Q1 ==3){result=4.1;} else result = 5.9;" Rather than parsing it myself I'm trying to use the DLR. I'm using version .92 from the Codeplex repository and my solution is a .NET 3.5 website; and I'm having conflicts between the System.Core and Microsoft.Scripting.ExtenstionAttribute .dll's. Error = { Description: "'ExtensionAttribute' is ambiguous in the namespace 'System.Runtime.CompilerServices'.", File: "InternalXmlHelper.vb" } At this time I cannot upgrade to .NET 4.0 and make significant use of the .net 3.5 features (so downgrading is not an option). Any help greatly appreciated.

    Read the article

  • ngModel and component with isolated scope

    - by Artem Andreev
    I am creating simple ui-datetime directive. It splits javascript Date object into _date, _hours and _minutes parts. _date uses jquery ui datepicker, _hours and _minutes - number inputs. See example: http://jsfiddle.net/andreev_artem/nWsZp/3/ On github: https://github.com/andreev-artem/angular_experiments/tree/master/ui-datetime As far as I understand - best practice when you create a new component is to use isolated scope. When I tried to use isolated scope - nothing works. ngModel.$viewValue === undefined. When I tried to use new scope (my example, not so good variant imho) - ngModel uses value on newly created scope. Of course I can create directive with isolated scope and work with ngModel value through "=expression" (example). But I think that working with ngModelController is a better practice. My questions: Can I use ngModelController with isolated scope? If it is not possible which solution is better for creating such component?

    Read the article

  • Eclipse keyword highlighting in in my own text editor

    - by Torok Balint
    I made a simple text editor in eclipse to which I added some simple WordRule based syntax highlighting to highlight the language keywords. The problem is that when a keyword is part of an identifier (eg. "import" is part of "extra_import"), then "import" is highlighted in "extra_import". How can I stop eclipse to highlight a a keyword if it is only a sub string of another string? Anlther question; is there a regular expression based IRule? What is the purpose of WhitespaceRule? White spaces are usually not highlighted. Thaks

    Read the article

< Previous Page | 420 421 422 423 424 425 426 427 428 429 430 431  | Next Page >