Search Results

Search found 45715 results on 1829 pages for 'system verilog'.

Page 429/1829 | < Previous Page | 425 426 427 428 429 430 431 432 433 434 435 436  | Next Page >

  • ASP.NET: Turning on errors

    - by JamesBrownIsDead
    This is what I see when I visit my web site. How do I instead get the Yellow Screen of Death so I know what the error is? I have GoDaddy shared hosting and I think the problem is that I don't have the correct MVC binaries in the /bin folder. My web.config shows this: <add assembly="System.Web.Mvc, Version=2.0.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"/> <add assembly="System.Web.Abstractions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"/> <add assembly="System.Web.Routing, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"/> But I'm not positive I copied the right .DLL files into /bin. I've got like 8 of each file--which version is which?!

    Read the article

  • EBS with RAID0 (striping) and restoring snapshots

    - by grourk
    We have a MySQL database on EC2 and are looking at the disk IO performance there. Currently we have a single EBS volume with XFS and take snapshots for backup. It seems that a lot of people have seen significant performance gains by striping across multiple EBS volumes with software RAID. If this is done, how does one take snapshots and ensure the consistency of the file system? It seems to me that restoring the file system from multiple snapshots could be tricky.

    Read the article

  • SWT Filedialog Open into home folder

    - by Ivan
    I want to open a FileDialog window into the user home folder (i.e. /home/user or /Users/unsername) I read the user home folder, using System.getProperty: String homefolder = System.getProperty(user.home); And the variable containts the correct home folder. But when i set the filterpath in FileDialog, it opens (in linux) only the /home level not entering into the user home dir. This is the source code: FileDialog dialog = new FileDialog(shell); dialog.setText("Choose a certificate"); String platform = SWT.getPlatform(); String homefolder = System.getProperty("user.home"); dialog.setFilterPath(homefolder); Any idea? Here a screenshot:

    Read the article

  • Using Delphi's ShellExecute() with the process inheriting the original console?

    - by Phil
    In C I've used the system() function before in a console application and if I start another process using system() it inherits the console window of the process that called it. In Delphi system() doesn't exist so I'm using ShellExecute() to create a new process, but the new process comes up in a new console window. Is there some way that I can make it inherit the handle of the window that's calling it? I've used function GetConsoleWindow(): HWND; stdcall; external 'kernel32.dll'; to get the console window and passed it in the HWND part of ShellExecute(), but that didn't work.

    Read the article

  • http://localhost/ always gives 502 unknown host

    - by Nitesh Panchal
    My service for World Wide Web Publishing Service started successfully but whenever I browse to http://localhost/ I always get 502 Unknown host. Also, wampapache is installed side by side but when I stop IIS service and start wampapache from services.msc I get error and when I view it in System event log I get this error: - <Event xmlns="http://schemas.microsoft.com/win/2004/08/events/event"> - <System> <Provider Name="Service Control Manager" Guid="{555908d1-a6d7-4695-8e1e-26931d2012f4}" EventSourceName="Service Control Manager" /> <EventID Qualifiers="49152">7024</EventID> <Version>0</Version> <Level>2</Level> <Task>0</Task> <Opcode>0</Opcode> <Keywords>0x8080000000000000</Keywords> <TimeCreated SystemTime="2011-06-12T17:43:28.223498400Z" /> <EventRecordID>346799</EventRecordID> <Correlation /> <Execution ProcessID="456" ThreadID="3936" /> <Channel>System</Channel> <Computer>MACHINENAME</Computer> <Security /> </System> - <EventData> <Data Name="param1">wampapache</Data> <Data Name="param2">%%1</Data> </EventData> </Event> I am fed up of this error and it is driving me nuts. I feel like banging my head against the laptop. I am really serious. Without concentrating on my real application I am trying to solve this issue since 3 hours. I google various threads and few of them said that there could be issue of Reporting Services or Skype. But I have uninstalled Skype and Reporting Services are disabled. What more should I do? I have hosts file present in etc directory and it does have mapping for localhost to 127.0.0.1. What more could I do?

    Read the article

  • Send file by webservice

    - by phenevo
    Hi, I have webservice, wwith method: [WebMethod] public byte[] GetFile(string FName) { System.IO.FileStream fs1 = null; fs1 = System.IO.File.Open(FName, FileMode.Open, FileAccess.Read); byte[] b1 = new byte[fs1.Length]; fs1.Read(b1, 0, (int)fs1.Length); fs1.Close(); return b1; } and it works with small file like 1mb, but when it comes to photoshop's file (about 1,5gb) I get: System.OutOfMemoryException The idea is I have winforms application which get this file and saving it on local disc.

    Read the article

  • Extracting init script from bult-in intrfs into Linux bzImage

    - by Maciej Piechotka
    I have following problem - I damaged my system (Gentoo - by rebuilding using gcc 4.5) beyond repair. I unmounted /home, copied /etc + other important files and I've started reinstalling system. However I forgot to copy init script. It is still present in kernel image that I have. How to extract it? Please note that initrd is not a separate file but is in the kernel image.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Bypassing "Found New Hardware Wizard" / Setting Windows to Install Drivers Automatically

    - by Synetech inc.
    Hi, My motherboard finally died after the better part of a decade, so I bought a used system. I put my old hard-drive and sound-card in the new system, and connected my old keyboard and mouse (the rest of the components—CPU, RAM, mobo, video card—are from the new system). I knew beforehand that it would be a challenge to get Windows to boot and install drivers for the new hardware (particularly since the foundational components are new), but I am completely unable to even attempt to get through the work of installing drivers for things like the video card because the keyboard and mouse won't work (they do work, in the BIOS screen, in DOS mode, in Windows 7, in XP's boot menu, etc., just not in Windows XP itself). Whenever I try to boot XP (in normal or safe mode), I get a bunch of balloons popping up for all the new hardware detected, and a New Hardware Found Wizard for Processor (obviously it has to install drivers for the lowest-level components on up). Unfortunately I cannot click Next since the keyboard and mouse won't work yet because the motherboard drivers (for the PS/2 or USB ports) are not yet installed. I even tried a serial mouse, but to no avail—again, it does work in DOS, 7, etc., but not XP because it doesn't have the serial port driver installed. I tried mounting the SOFTWARE and SYSTEM hives under Windows 7 in order to manually set the "unsigned drivers warning" to ignore (using both of the driver-signing policy settings that I found references to). That didn't work; I still get the wizard. They are not even fancy, proprietary, third-party, or unsigned drivers. They are drivers that come with Windows—as the drivers for CPU, RAM, IDE controller, etc. tend to be. And the keyboard and mouse drivers are the generic ones at that (but like I said, those are irrelevant since the drivers for the ports that they are connected to are not yet installed). Obviously at some point in time over the past several years, a setting got changed to make Windows always prompt me when it detects new hardware. (It was also configured to show the Shutdown Event Tracker on abnormal shutdowns, so I had to turn that off so that I could even see the desktop.) Oh, and I tried deleting all of the PNF files so that they get regenerated, but that too did not help. Does anyone know how I can reset Windows to at least try to automatically install drivers for new hardware before prompting me if it fails? Conversely, does anyone know how exactly one turns off automatic driver installation (and prompt with the wizard)? Thanks a lot.

    Read the article

  • Sending the files (At least 11 files) from folder through web service to android app.

    - by Shashank_Itmaster
    Hello All, I stuck in middle of this situation,Please help me out. My question is that I want to send files (Total 11 PDF Files) to android app using web service. I tried it with below code.Main Class from which web service is created public class MultipleFilesImpl implements MultipleFiles { public FileData[] sendPDFs() { FileData fileData = null; // List<FileData> filesDetails = new ArrayList<FileData>(); File fileFolder = new File( "C:/eclipse/workspace/AIPWebService/src/pdfs/"); // File fileTwo = new File( // "C:/eclipse/workspace/AIPWebService/src/simple.pdf"); File sendFiles[] = fileFolder.listFiles(); // sendFiles[0] = fileOne; // sendFiles[1] = fileTwo; DataHandler handler = null; char[] readLine = null; byte[] data = null; int offset = 0; int numRead = 0; InputStream stream = null; FileOutputStream outputStream = null; FileData[] filesData = null; try { System.out.println("Web Service Called Successfully"); for (int i = 0; i < sendFiles.length; i++) { handler = new DataHandler(new FileDataSource(sendFiles[i])); fileData = new FileData(); data = new byte[(int) sendFiles[i].length()]; stream = handler.getInputStream(); while (offset < data.length && (numRead = stream.read(data, offset, data.length - offset)) >= 0) { offset += numRead; } readLine = Base64Coder.encode(data); offset = 0; numRead = 0; System.out.println("'Reading File............................"); System.out.println("\n"); System.out.println(readLine); System.out.println("Data Reading Successful"); fileData.setFileName(sendFiles[i].getName()); fileData.setFileData(String.valueOf(readLine)); readLine = null; System.out.println("Data from bean " + fileData.getFileData()); outputStream = new FileOutputStream("D:/" + sendFiles[i].getName()); outputStream.write(Base64Coder.decode(fileData.getFileData())); outputStream.flush(); outputStream.close(); stream.close(); // FileData fileDetails = new FileData(); // fileDetails = fileData; // filesDetails.add(fileData); filesData = new FileData[(int) sendFiles[i].length()]; } // return fileData; } catch (FileNotFoundException e) { e.printStackTrace(); } catch (IOException e) { e.printStackTrace(); } catch (Exception e) { e.printStackTrace(); } return filesData; } } Also The Interface MultipleFiles:- public interface MultipleFiles extends Remote { public FileData[] sendPDFs() throws FileNotFoundException, IOException, Exception; } Here I am sending an array of bean "File Data",having properties viz. FileData & FileName. FileData- contains file data in encoded. FileName- encoded file name. The Bean:- (FileData) public class FileData { private String fileName; private String fileData; public String getFileName() { return fileName; } public void setFileName(String fileName) { this.fileName = fileName; } public String getFileData() { return fileData; } public void setFileData(String string) { this.fileData = string; } } The android DDMS gives out of memory exception when tried below code & when i tried to send two files then only first file is created. public class PDFActivity extends Activity { private final String METHOD_NAME = "sendPDFs"; private final String NAMESPACE = "http://webservice.uks.com/"; private final String SOAP_ACTION = NAMESPACE + METHOD_NAME; private final String URL = "http://192.168.1.123:8080/AIPWebService/services/MultipleFilesImpl"; /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); TextView textViewOne = (TextView) findViewById(R.id.textViewOne); try { SoapObject soapObject = new SoapObject(NAMESPACE, METHOD_NAME); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope( SoapEnvelope.VER11); envelope.setOutputSoapObject(soapObject); textViewOne.setText("Web Service Started"); AndroidHttpTransport httpTransport = new AndroidHttpTransport(URL); httpTransport.call(SOAP_ACTION, envelope); // SoapObject result = (SoapObject) envelope.getResponse(); Object result = envelope.getResponse(); Log.i("Result", result.toString()); // String fileName = result.getProperty("fileName").toString(); // String fileData = result.getProperty("fileData").toString(); // Log.i("File Name", fileName); // Log.i("File Data", fileData); // File pdfFile = new File(fileName); // FileOutputStream outputStream = // openFileOutput(pdfFile.toString(), // MODE_PRIVATE); // outputStream.write(Base64Coder.decode(fileData)); Log.i("File", "File Created"); // textViewTwo.setText(result); // Object result = envelope.getResponse(); // FileOutputStream outputStream = openFileOutput(name, mode) } catch (Exception e) { e.printStackTrace(); } } } Please help with some explanation or changes in my code. Thanks in Advance.

    Read the article

  • Changing a limited user account in XP fails

    - by javamonkey79
    I have the following: using System; using System.DirectoryServices.AccountManagement; public class ChangePassword { public static void Main() { PrincipalContext context = new PrincipalContext(ContextType.Machine); UserPrincipal user = UserPrincipal.FindByIdentity(context, "someLimitedAccount"); user.ChangePassword( "xxx", "zzz" ); } } This works just fine with administrator accounts, but seems to crash like so when I try to change limited accounts in XP: Unhandled Exception: System.NullReferenceException: Object reference not set to an instance of an object. at ChangePassword.Main() Is what I am trying to do possible? If so, how? EDIT #1: I added the following: Console.WriteLine( "user: " + user ); Below this line: UserPrincipal user = UserPrincipal.FindByIdentity(context, "someLimitedAccount"); And I get this: user: It doesn't look like user is null when I print it, but then again I'm not really a .Net guy - I seem to remember this being expected behavior.

    Read the article

  • ASP.net error message when using REST starter kit

    - by jonhobbs
    Hi all, I've written some code using the REST starter kit and it works fine on my development machine. However, when I upload it to our server the page gives me the following error message... CS1684: Warning as Error: Reference to type 'System.Runtime.Serialization.Json.DataContractJsonSerializer' claims it is defined in 'c:\WINNT\assembly\GAC_MSIL\System.ServiceModel.Web\3.5.0.0__31bf3856ad364e35\System.ServiceModel.Web.dll', but it could not be found I've removed code line by line and it appears that the following line of code is triggering the error... HttpContent newOrganizationContent = HttpContentExtensions.CreateXmlSerializable(newOrganizationXml); Really haven't got a clue how to fix it. I assumed it might be because it needs a newer version of the framework to run, but looking in IIS it says it's running version 2.0.50727 which I think is the lates version because it says that even when we're using framework 3.5 Very confused, any ideas? Jon

    Read the article

  • SecurityException from Activator.CreateInstance(), How to grant permissons to Assembly?

    - by user365164
    I have been loading an assembly via Assembly.LoadFrom(@"path"); and then doing Type t = asm.GetType("Test.Test"); test = Activator.CreateInstance(t, new Object[] { ... }); and it was working fine, but now I moved the dll I am getting the following System.Reflection.TargetInvocationException: Exception has been thrown by the target of an invocation. --- System.Security.SecurityException: Request for the permission of type 'System.Security.Permissons.SecurityPermission, etc .. For the sake of brevity it seems the demand was for an PermissionSet that allowed ControlAppDomain and it's not getting it. My question is how can I create this permissionset and pass it to the instance or assembly? I've been googling for hours to no avail.

    Read the article

  • How to define using statements in web.config?

    - by Hasan Gürsoy
    I'm using MySql in my asp.net project. But I don't want to type every "using MySql.Data.MySqlClient;" statement in every aspx.cs file. How can I define this lines in web.config file? I've defined some namespaces like below but this only works for aspx pages: <?xml version="1.0"?> <configuration> <system.web> <compilation debug="false" targetFramework="4.0"/> <pages> <namespaces> <add namespace="System.Web.Configuration"/> <add namespace="MySql.Data"/> <add namespace="MySql.Data.MySqlClient"/> </namespaces> </pages> </system.web> </configuration>

    Read the article

  • Using java.util.logging, is it possible to restart logs after a certain period of time?

    - by Fry
    I have some java code that will be running as an importer for data for a much larger project. The initial logging code was done with the java.util.logging classes, so I'd like to keep it if possible, but it seems to be a little inadequate now given he amount of data passing through the importer. Often times in the system, the importer will get data that the main system doesn't have information for or doesn't match the system's data so it is ignored but a message is written to the log about what information was dropped and why it wasn't imported. The problem is that this tends to grow in size very quickly, so we'd like to be able to start a fresh log daily or weekly. Does anybody have an idea if this can be done in the logging classes or would I have to switch to log4j or custom? Thanks for any help!

    Read the article

  • Lookahead regex produces unexpected group

    - by Ivan Yatskevich
    I'm trying to extract a page name and query string from a URL which should not contain .html Here is an example code in Java: public class TestRegex { public static void main(String[] args) { Pattern pattern = Pattern.compile("/test/(((?!\\.html).)+)\\?(.+)"); Matcher matcher = pattern.matcher("/test/page?param=value"); System.out.println(matcher.matches()); System.out.println(matcher.group(1)); System.out.println(matcher.group(2)); } } By running this code one can get the following output: true page e What's wrong with my regex so the second group contains the letter e instead of param=value?

    Read the article

  • How to Programmatically Identify a PI Font (a Dingbat) under OS X

    - by Glenn Howes
    There is a class of fonts called Pi fonts whose glyphs, under OS X, get mapped to the private Unicode space 0xF021-0xF0FF such that if you subtract 0xF000 from each unicode character to retrieve the 8-bit version of the character and be able to draw that character as if it were a standard Roman character. My question is how do I recognize these fonts? It's obvious the system can do so because there is a category on the Special Characters palette called "Pi Fonts" which apparently has the various such fonts installed on my system. In my case they are BookshelSymbolSeven, MSReferenceSpeciality, MT-Extras, Marlett, MonotypeSorts, Webdings, and various Wingdings. If I use the old fashioned QuickDraw routines to ask for the TextEncoding of these fonts, I get a value of 0x20000 which I do not see in the system header file TextCommon.h. Am I supposed to treat any font with a TextEncoding of 0x20000 as a Pi Font? And I'd rather not use any QuickDraw font handling routines for obvious reasons.

    Read the article

  • Server-Ip address is not getting displayed in snmp-trap messages

    - by Gaurav
    my problem is about Ip Address which I am receiving on the windows system snmp-trap messages,is some thing like that UDP: [192.168.1.150]:1029->[0.0.0.0]:0 while same trap message on linux system has been displayed as UDP: [192.168.1.150]:1030->[192.168.1.23] Now,if you observed carefully these two ,its clearly shown that server ip is not coming in windows traps-Ip([0.0.0.0]:0).what would be the possible reason?please anyone can help me about understanding this & can provide the solution for this problem.

    Read the article

  • How to implement an EventHandler to update controls

    - by Bill
    May I ask for help with the following? I am attempting to connect and control three pieces of household electronic equipment by computer through a GlobalCache GC-100 and iTach. As you will see in the following code, I created a class-instance of GlobalCacheAdapter that communicates with each piece of equipment. Although the code seems to work well in controlling the equipment, I am having trouble updating controls with the feedback from the equipment. The procedure "ReaderThreadProc" captures the feedback; however I don't know how to update the associated TextBox with the feedback. I believe that I need to create an EventHandler to notify the TextBox of the available update; however I am uncertain as to how an EventHandler like this would be implemented. Any help wold be greatly appreciated. using System; using System.IO; using System.Net; using System.Net.Sockets; using System.Threading; using System.Windows.Forms; namespace WindowsFormsApplication1 { public partial class Form1 : Form { // Create three new instances of GlobalCacheAdaptor and connect. // GC-100 (Elan) 192.168.1.70 4998 // GC-100 (TuneSuite) 192.168.1.70 5000 // GC iTach (Lighting) 192.168.1.71 4999 private GlobalCacheAdaptor elanGlobalCacheAdaptor; private GlobalCacheAdaptor tuneSuiteGlobalCacheAdaptor; private GlobalCacheAdaptor lutronGlobalCacheAdaptor; public Form1() { InitializeComponent(); elanGlobalCacheAdaptor = new GlobalCacheAdaptor(); elanGlobalCacheAdaptor.ConnectToDevice(IPAddress.Parse("192.168.1.70"), 4998); tuneSuiteGlobalCacheAdaptor = new GlobalCacheAdaptor(); tuneSuiteGlobalCacheAdaptor.ConnectToDevice(IPAddress.Parse("192.168.1.70"), 5000); lutronGlobalCacheAdaptor = new GlobalCacheAdaptor(); lutronGlobalCacheAdaptor.ConnectToDevice(IPAddress.Parse("192.168.1.71"), 4999); elanTextBox.Text = elanGlobalCacheAdaptor._line; tuneSuiteTextBox.Text = tuneSuiteGlobalCacheAdaptor._line; lutronTextBox.Text = lutronGlobalCacheAdaptor._line; } private void btnZoneOnOff_Click(object sender, EventArgs e) { elanGlobalCacheAdaptor.SendMessage("sendir,4:3,1,40000,4,1,21,181,21,181,21,181,21,181,21,181,21,181,21,181,21,181,21,181,21,181,21,181,21,800" + Environment.NewLine); } private void btnSourceInput1_Click(object sender, EventArgs e) { elanGlobalCacheAdaptor.SendMessage("sendir,4:3,1,40000,1,1,20,179,20,179,20,179,20,179,20,179,20,179,20,179,20,278,20,179,20,179,20,179,20,780" + Environment.NewLine); } private void btnSystemOff_Click(object sender, EventArgs e) { elanGlobalCacheAdaptor.SendMessage("sendir,4:3,1,40000,1,1,20,184,20,184,20,184,20,184,20,184,20,286,20,286,20,286,20,184,20,184,20,184,20,820" + Environment.NewLine); } private void btnLightOff_Click(object sender, EventArgs e) { lutronGlobalCacheAdaptor.SendMessage("sdl,14,0,0,S2\x0d"); } private void btnLightOn_Click(object sender, EventArgs e) { lutronGlobalCacheAdaptor.SendMessage("sdl,14,100,0,S2\x0d"); } private void btnChannel31_Click(object sender, EventArgs e) { tuneSuiteGlobalCacheAdaptor.SendMessage("\xB8\x4D\xB5\x33\x31\x00\x30\x21\xB8\x0D"); } private void btnChannel30_Click(object sender, EventArgs e) { tuneSuiteGlobalCacheAdaptor.SendMessage("\xB8\x4D\xB5\x33\x30\x00\x30\x21\xB8\x0D"); } } } public class GlobalCacheAdaptor { public Socket _multicastListener; public string _preferredDeviceID; public IPAddress _deviceAddress; public Socket _deviceSocket; public StreamWriter _deviceWriter; public bool _isConnected; public int _port; public IPAddress _address; public string _line; public GlobalCacheAdaptor() { } public static readonly GlobalCacheAdaptor Instance = new GlobalCacheAdaptor(); public bool IsListening { get { return _multicastListener != null; } } public GlobalCacheAdaptor ConnectToDevice(IPAddress address, int port) { if (_deviceSocket != null) _deviceSocket.Close(); try { _port = port; _address = address; _deviceSocket = new Socket(AddressFamily.InterNetwork, SocketType.Stream, ProtocolType.Tcp); _deviceSocket.Connect(new IPEndPoint(address, port)); ; _deviceAddress = address; var stream = new NetworkStream(_deviceSocket); var reader = new StreamReader(stream); var writer = new StreamWriter(stream) { NewLine = "\r", AutoFlush = true }; _deviceWriter = writer; writer.WriteLine("getdevices"); var readerThread = new Thread(ReaderThreadProc) { IsBackground = true }; readerThread.Start(reader); _isConnected = true; return Instance; } catch { DisconnectFromDevice(); MessageBox.Show("ConnectToDevice Error."); throw; } } public void SendMessage(string message) { try { var stream = new NetworkStream(_deviceSocket); var reader = new StreamReader(stream); var writer = new StreamWriter(stream) { NewLine = "\r", AutoFlush = true }; _deviceWriter = writer; writer.WriteLine(message); var readerThread = new Thread(ReaderThreadProc) { IsBackground = true }; readerThread.Start(reader); } catch { MessageBox.Show("SendMessage() Error."); } } public void DisconnectFromDevice() { if (_deviceSocket != null) { try { _deviceSocket.Close(); _isConnected = false; } catch { MessageBox.Show("DisconnectFromDevice Error."); } _deviceSocket = null; } _deviceWriter = null; _deviceAddress = null; } private void ReaderThreadProc(object state) { var reader = (StreamReader)state; try { while (true) { var line = reader.ReadLine(); if (line == null) break; _line = _line + line + Environment.NewLine; } // Need to create EventHandler to notify the TextBoxes to update with _line } catch { MessageBox.Show("ReaderThreadProc Error."); } } }

    Read the article

  • How to grant su access to wheel without asking for password on FreeBSD?

    - by cstamas
    I would like to grant users of the wheel group (other sysadmins) su access without being asked for password. I know how to do it with pam in linux, but the question now is for FreeBSD. I am not familiar with the syntax for FreeBSD's PAM subsystem. What shall I enter in /etc/pam.d/su instead of the default: auth sufficient pam_rootok.so no_warn auth sufficient pam_self.so no_warn auth requisite pam_group.so no_warn group=wheel root_only fail_safe ruser auth include system # account account include system # session session required pam_permit.so

    Read the article

  • File Upload in GWT in a Special Case

    - by Maksud
    I am doing a software for a document system. In this system when a user completes a document and want to save it, the document will be uploaded directly to server without the user action. This system uses COM/ActiveX to facilitate user using native editors. Ok, my problem is: suppose I have a file say d:/notepad.txt. Using classical method a user can browse the file and upload it. I can do that with apache commonio and GWT FormPanel and FileUpload. But if I know the filename (d:/notepad.txt), is there any way to upload the file directly to server without the user having to browse the file. I am currently doing this by the ActiveX componenet calling some HttpUpload methods with POST. But that does not maintain session. Thanks

    Read the article

  • Open source configuration framework for ASP.NET - does one exist?

    - by Jon
    We currently have an old product written in classic asp and are about to re-write parts in ASP.NET. One big problem is that much of the cutomer-specifics within the system are hard coded. We want to split this out for specific customers by storing data in the database. Is there a quick an easy open source framework which allows me to set up some quick tables and simple UIs to allow me to change configuration items? We have 6-7 modules, and it would be nice to have the ability to have system admins gain access to a configuration area where they can set-up settings in a tabbed UI format, settings could also be set-up to allow dropdown, fields, numbers etc. The items could then be accessed via classes in C#/vb for use within the operational parts of the system. If not, I'm suprised and it might even be a good basis for a new open source project.

    Read the article

  • Trouble using SFML with GCC and OS X

    - by user1322654
    I've been trying to get SFML working for a while now and I've been trying to get it working using GCC. I'm on OS X by the way. I followed the standard Linux instructions and using the Linux 64-bit download however when it comes to compiling... g++ -o testing main.cpp -lsfml-system This happens: main.cpp: In function ‘int main()’: main.cpp:7: error: ‘class sf::Clock’ has no member named ‘GetElapsedTime’ main.cpp:9: error: ‘class sf::Clock’ has no member named ‘GetElapsedTime’ main.cpp:10: error: ‘Sleep’ is not a member of ‘sf’ So I thought it could be due to not using includes, so I changed my gcc compile command to: g++ -o testing main.cpp -I ~/SFML-1.6/include/ -lsfml-system and now I'm getting this error: ld: warning: ignoring file /usr/local/lib/libsfml-system.so, file was built for unsupported file format which is not the architecture being linked (x86_64) Undefined symbols for architecture x86_64: "sf::Clock::Clock()", referenced from: _main in ccZEiB7b.o "sf::Clock::GetElapsedTime() const", referenced from: _main in ccZEiB7b.o "sf::Sleep(float)", referenced from: _main in ccZEiB7b.o ld: symbol(s) not found for architecture x86_64 collect2: ld returned 1 exit status** And I have no idea what to do to fix it.

    Read the article

  • Agile Approach for WCM

    - by cameron.f.logan
    Can anyone provide me with advice, opinions, or experience with using an agile methodology to delivery an enterprise-scale Web Content Management system (e.g., Interwoven TeamSite, Tridion)? My current opinion is that to implement a CM system there is a certain--relatively high--amount of upfront work that needs to happen to make sure the system is going to be scalable and efficient for future projects for the multi-year lifespan an WCM is expected to have. This suggests a hybrid approach at best, if not a more waterfall-like approach. I'm really interested to learn what approaches others have taken. Thanks.

    Read the article

< Previous Page | 425 426 427 428 429 430 431 432 433 434 435 436  | Next Page >