Search Results

Search found 11404 results on 457 pages for 'ui patterns'.

Page 431/457 | < Previous Page | 427 428 429 430 431 432 433 434 435 436 437 438  | Next Page >

  • Thread.CurrentThread.CurrentUICulture not working consistently

    - by xTRUMANx
    I've been working on a pet project on the weekends to learn more about C# and have encountered an odd problem when working with localization. To be more specific, the problem I have is with System.Threading.Thread.CurrentThread.CurrentUICulture. I've set up my app so that the user can quickly change the language of the app by clicking a menu item. The menu item in turn, saves the two-letter code for the language (e.g. "en", "fr", etc.) in a user setting called 'Language' and then restarts the application. Properties.Settings.Default.Language = "en"; Properties.Settings.Default.Save(); Application.Restart(); When the application is started up, the first line of code in the Form's constructor (even before InitializeComponent()) fetches the Language string from the settings and sets the CurrentUICulture like so: public Form1() { Thread.CurrentThread.CurrentUICulture = new CultureInfo(Properties.Settings.Default.Language); InitializeComponent(); } The thing is, this doesn't work consistently. Sometimes, all works well and the application loads the correct language based on the string saved in the settings file. Other times, it doesn't, and the language remains the same after the application is restarted. At first I thought that I didn't save the language before restarting the application but that is definitely not the case. When the correct language fails to load, if I were to close the application and run it again, the correct language would come up correctly. So this implies that the Language string has been saved but the CurrentUICulture assignment in my form constructor is having no effect sometimes. Any help? Is there something I'm missing of how threading works in C#? This could be machine-specific, so if it makes any difference I'm using Pentium Dual-Core CPU. UPDATE Vlad asked me to check what the CurrentThread's CurrentUICulture is. So I added a MessageBox on my constructor to tell me what the CurrentUICulture two-letter code is as well as the value of my Language user string. MessageBox.Show(string.Format("Current Language: {0}\nCurrent UI Culture: {1}", Properties.Settings.Default.Language, Thread.CurrentThread.CurrentUICulture.TwoLetterISOLanguageName)); When the wrong language is loaded, both the Language string and CurrentUICulture have the wrong language. So I guess the CurrentUICulture has been cleared and my problem is actually with the Language Setting. So I guess the problem is that my application sometimes loads the previously saved language string rather than the last saved language string. If the app is restarted, it will then load the actual saved language string.

    Read the article

  • Adding NavigationControl to a TabBar Application containing UITableViews

    - by kungfuslippers
    Hi, I'm new to iPhone dev and wanted to get advice on the general design pattern / guide for putting a certain kind of app together. I'm trying to build a TabBar type application. One of the tabs needs to display a TableView and selecting a cell from within the table view will do something else - maybe show another table view or a web page. I need a Navigation Bar to be able to take me back from the table view/web page. The approach I've taken so far is to: Create an app based around UITabBarController as the rootcontroller i.e. @interface MyAppDelegate : NSObject <UIApplicationDelegate> { IBOutlet UIWindow *window; IBOutlet UITabBarController *rootController; } Create a load of UIViewController derived classes and associated NIBs and wire everything up in IB so when I run the app I get the basic tabs working. I then take the UIViewController derived class and modify it to the following: @interface MyViewController : UIViewController<UITableViewDataSource, UITableViewDelegate> { } and I add the delegate methods to the implementation of MyViewController - (NSInteger)tableView:(UITableView *)tableView numberOfRowsInSection:(NSInteger)section { return 2; } - (UITableViewCell *)tableView:(UITableView *)tableView cellForRowAtIndexPath:(NSIndexPath *)indexPath { static NSString *CellIdentifier = @"Cell"; UITableViewCell *cell = [tableView dequeueReusableCellWithIdentifier:CellIdentifier]; if (cell == nil) { cell = [[[UITableViewCell alloc] initWithStyle:UITableViewCellStyleDefault reuseIdentifier:CellIdentifier] autorelease]; } if (indexPath.row == 0) { cell.textLabel.text = @"Mummy"; } else { cell.textLabel.text = @"Daddy"; } return cell; } Go back to IB , open MyViewController.xib and drop a UITableView onto it. Set the Files Owner to be MyViewController and then set the delegate and datasource of the UITableView to be MyViewController. If I run the app now, I get the table view appearing with mummy and daddy working nicely. So far so good. The question is how do I go about incorporating a Navigation Bar into my current code for when I implement: - (void)tableView:(UITableView *)tableView didSelectRowAtIndexPath:(NSIndexPath *)indexPath() { // get row selected NSUInteger row = [indexPath row]; if (row == 0) { // Show another table } else if (row == 1) { // Show a web view } } Do I drop a NavigationBar UI control onto MyControllerView.xib ? Should I create it programmatically? Should I be using a UINavigationController somewhere ? I've tried dropping a NavigationBar onto my MyControllerView.xib in IB but its not shown when I run the app, only the TableView is displayed.

    Read the article

  • Why doesn't my form post when I disable the submit button to prevent double clicking?

    - by John MacIntyre
    Like every other web developer on the planet, I have an issue with users double clicking the submit button on my forms. My understanding is that the conventional way to handle this issue, is to disable the button immediately after the first click, however when I do this, it doesn't post. I did do some research on this, god knows there's enough information, but other questions like Disable button on form submission, disabling the button appears to work. The original poster of Disable button after submit appears to have had the same problem as me, but there is no mention on how/if he resolved it. Here's some code on how to repeat it (tested in IE8 Beta2, but had same problem in IE7) My aspx code <%@ Page Language="C#" CodeFile="Default.aspx.cs" Inherits="_Default" %> <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <script language="javascript" type="text/javascript"> function btn_onClick() { var chk = document.getElementById("chk"); if(chk.checked) { var btn = document.getElementById("btn"); btn.disabled = true; } } </script> <body> <form id="form1" runat="server"> <asp:Literal ID="lit" Text="--:--:--" runat="server" /> <br /> <asp:Button ID="btn" Text="Submit" runat="server" /> <br /> <input type="checkbox" id="chk" />Disable button on first click </form> </body> </html> My cs code using System; public partial class _Default : System.Web.UI.Page { protected override void OnInit(EventArgs e) { base.OnInit(e); btn.Click += new EventHandler(btn_Click); btn.OnClientClick = "btn_onClick();"; } void btn_Click(object sender, EventArgs e) { lit.Text = DateTime.Now.ToString("HH:mm:ss"); } } Notice that when you click the button, a postback occurs, and the time is updated. But when you check the check box, the next time you click the button, the button is disabled (as expected), but never does the postback. WHAT THE HECK AM I MISSING HERE??? Thanks in advance.

    Read the article

  • Sockets, Threads and Services in android, how to make them work together ?

    - by Spredzy
    Hi all, I am facing a probleme with threads and sockets I cant figure it out, if someone can help me please i would really appreciate. There are the facts : I have a service class NetworkService, inside this class I have a Socket attribute. I would like it be at the state of connected for the whole lifecycle of the service. To connect the socket I do it in a thread, so if the server has to timeout, it would not block my UI thread. Problem is, into the thread where I connect my socket everything is fine, it is connected and I can talk to my server, once this thread is over and I try to reuse the socket, in another thread, I have the error message Socket is not connected. Questions are : - Is the socket automatically disconnected at the end of the thread? - Is their anyway we can pass back a value from a called thread to the caller ? Thanks a lot, Here is my code public class NetworkService extends Service { private Socket mSocket = new Socket(); private void _connectSocket(String addr, int port) { Runnable connect = new connectSocket(this.mSocket, addr, port); new Thread(connect).start(); } private void _authentification() { Runnable auth = new authentification(); new Thread(auth).start(); } private INetwork.Stub mBinder = new INetwork.Stub() { @Override public int doConnect(String addr, int port) throws RemoteException { _connectSocket(addr, port); _authentification(); return 0; } }; class connectSocket implements Runnable { String addrSocket; int portSocket; int TIMEOUT=5000; public connectSocket(String addr, int port) { addrSocket = addr; portSocket = port; } @Override public void run() { SocketAddress socketAddress = new InetSocketAddress(addrSocket, portSocket); try { mSocket.connect(socketAddress, TIMEOUT); PrintWriter out = new PrintWriter(mSocket.getOutputStream(), true); out.println("test42"); Log.i("connectSocket()", "Connection Succesful"); } catch (IOException e) { Log.e("connectSocket()", e.getMessage()); e.printStackTrace(); } } } class authentification implements Runnable { private String constructFirstConnectQuery() { String query = "toto"; return query; } @Override public void run() { BufferedReader in; PrintWriter out; String line = ""; try { in = new BufferedReader(new InputStreamReader(mSocket.getInputStream())); out = new PrintWriter(mSocket.getOutputStream(), true); out.println(constructFirstConnectQuery()); while (mSocket.isConnected()) { line = in.readLine(); Log.e("LINE", "[Current]- " + line); } } catch (IOException e) {e.printStackTrace();} } }

    Read the article

  • Extending Enums, Overkill?

    - by CkH
    I have an object that needs to be serialized to an EDI format. For this example we'll say it's a car. A car might not be the best example b/c options change over time, but for the real object the Enums will never change. I have many Enums like the following with custom attributes applied. public enum RoofStyle { [DisplayText("Glass Top")] [StringValue("GTR")] Glass, [DisplayText("Convertible Soft Top")] [StringValue("CST")] ConvertibleSoft, [DisplayText("Hard Top")] [StringValue("HT ")] HardTop, [DisplayText("Targa Top")] [StringValue("TT ")] Targa, } The Attributes are accessed via Extension methods: public static string GetStringValue(this Enum value) { // Get the type Type type = value.GetType(); // Get fieldinfo for this type FieldInfo fieldInfo = type.GetField(value.ToString()); // Get the stringvalue attributes StringValueAttribute[] attribs = fieldInfo.GetCustomAttributes( typeof(StringValueAttribute), false) as StringValueAttribute[]; // Return the first if there was a match. return attribs.Length > 0 ? attribs[0].StringValue : null; } public static string GetDisplayText(this Enum value) { // Get the type Type type = value.GetType(); // Get fieldinfo for this type FieldInfo fieldInfo = type.GetField(value.ToString()); // Get the DisplayText attributes DisplayTextAttribute[] attribs = fieldInfo.GetCustomAttributes( typeof(DisplayTextAttribute), false) as DisplayTextAttribute[]; // Return the first if there was a match. return attribs.Length > 0 ? attribs[0].DisplayText : value.ToString(); } There is a custom EDI serializer that serializes based on the StringValue attributes like so: StringBuilder sb = new StringBuilder(); sb.Append(car.RoofStyle.GetStringValue()); sb.Append(car.TireSize.GetStringValue()); sb.Append(car.Model.GetStringValue()); ... There is another method that can get Enum Value from StringValue for Deserialization: car.RoofStyle = Enums.GetCode<RoofStyle>(EDIString.Substring(4, 3)) Defined as: public static class Enums { public static T GetCode<T>(string value) { foreach (object o in System.Enum.GetValues(typeof(T))) { if (((Enum)o).GetStringValue() == value.ToUpper()) return (T)o; } throw new ArgumentException("No code exists for type " + typeof(T).ToString() + " corresponding to value of " + value); } } And Finally, for the UI, the GetDisplayText() is used to show the user friendly text. What do you think? Overkill? Is there a better way? or Goldie Locks (just right)? Just want to get feedback before I intergrate it into my personal framework permanently. Thanks.

    Read the article

  • How to pass parameters to Apache Pivot's wtkx:include tag?

    - by Andrew Swan
    I need to create a reusable UI component that accepts a number of parameters (e.g. an image URL and some label text), similar to how JSP tags can accept parameters. The Pivot docs for the "wtkx:include" tag say: The tag allows a WTKX file to embed content defined in an external WTKX file as if it was defined in the source file itself. This is useful for ... defining reusable content templates I was hoping that I could define my component in a WTKX file using standard Pivot components (e.g. a TextInput) and pass it one or more parameters; for example my reusable template called "row.wtkx" might contain a row with an image and a text field, like this (where the ${xxx} bits are the parameters): <TablePane.Row xmlns="org.apache.pivot.wtk"> <ImageView image="@images/${image_url}" /> <TextInput text="${title}" /> </TablePane.Row> I could then reuse this component within a TablePane as follows: <rows> <TablePane.Row> <Label text="Painting"/> <Label text="Title"/> </TablePane.Row> <wtkx:include src="row.wtkx" image_url="mona_lisa.jpg" title="Mona Lisa"/> <wtkx:include src="row.wtkx" image_url="pearl_earring.jpg" title="Girl with a Pearl Earring"/> <wtkx:include src="row.wtkx" image_url="melting_clocks.jpg" title="Melting Clocks"/> </rows> I've made up the ${...} syntax myself just to show what I'm trying to do. Also, there could be other ways to pass the parameter values other than using attributes of the "wtkx:include" tag itself, e.g. pass a JSON-style map called say "args". The ability to pass parameters like this would make the include tag much more powerful, e.g. in my case allow me to eliminate a lot of duplication between the table row declarations. Or is "wtkx:include" not the right way to be doing this?

    Read the article

  • jQuery: Can't get tooltip plugin to work

    - by Rosarch
    I'm trying to use this tooltip plugin: http://bassistance.de/jquery-plugins/jquery-plugin-tooltip/. I can't seem to get it to work. <head> <script type="text/javascript" src="/static/JQuery.js"></script> <script type="text/javascript" src="/static/jquery-ui-1.8.1.custom.min.js"></script> <script type="text/javascript" src="/static/jquery.json-2.2.min.js"></script> <script type="text/javascript" src="/static/jquery.form.js"></script> <script type="text/javascript" src="/static/js-lib/jquery.bgiframe.js"></script> <script type="text/javascript" src="/static/js-lib/jquery.delegate.js"></script> <script type="text/javascript" src="/static/js-lib/jquery.dimensions.js"></script> <script type="text/javascript" src="/static/jquery.tooltip.js"></script> <script type="text/javascript" src="/static/sprintf.js"></script> <script type="text/javascript" src="/static/clientside.js"></script> </head> I try it out in a simple example: clientside.js: $(document).ready(function () { $("#set1 *").tooltip(); }); The target html: <div id="set1"> <p id="welcome">Welcome. What is your email?</p> <form id="form-username-form" action="api/user_of_email" method="get"> <p> <label for="form-username">Email:</label> <input type="text" name="email" id="form-username" /> <input type="submit" value="Submit" id="form-submit" /> </p> </form> <p id="msg-user-accepted"></p> </div> Unfortunately, nothing happens. What am I doing wrong?

    Read the article

  • Is there a path of least resistance that a newcomer to graphics-technology-adoption can take at this point in the .NET graphics world?

    - by Rao
    For the past 5 months or so, I've spent time learning C# using Andrew Troelsen's book and getting familiar with stuff in the .NET 4 stack... bits of ADO.NET, EF4 and a pinch of WCF to taste. I'm really interested in graphics development (not for games though), which is why I chose to go the .NET route when I decided choose from either Java or .NET to learn... since I heard about WPF and saw some sexy screenshots and all. I'm even almost done with the 4 WPF chapters in Troelsen's book. Now, all of a sudden I saw some post on a forum about how "WPF was dead" in the face of something called Silverlight. I searched more and saw all the confusion going on at present... even stuff like "Silverlight is dead too!" wrt HTML5. From what I gather, we are in a delicate period of time that will eventually decide which technology will stabilize, right? Even so, as someone new moving into UI & graphics development via .NET, I wish I could get some guidance from people more experienced people. Maybe I'm reading too much? Maybe I have missed some pieces of information? Maybe a path exists that minimizes tears of blood? In any case, here is a sample vomiting of my thoughts on which I'd appreciate some clarification or assurance or spanking: My present interest lies in desktop development. But on graduating from college, I wish to market myself as a .NET developer. The industry seems to be drooling for web stuff. Can Silverlight do both equally well? (I see on searches that SL works "out of browser"). I have two fair-sized hobby projects planned that will have hawt UIs with lots of drag n drop, sliding animations etc. These are intended to be desktop apps that will use reflection, database stuff using EF4, networking over LAN, reading-writing of files... does this affect which graphics technology can be used? At some laaaater point, if I become interested in doing a bit of 3D stuff in .NET, will that affect which technologies can be used? Or what if I look up to the heavens, stick out my middle finger, and do something crazy like go learn HTML5 even though my knowledge of it can be encapsulated in 2 sentences? Sorry I seem confused so much, I just want to know if there's a path of least resistance that a newcomer to graphics-technology-adoption can take at this point in the graphics world.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • how Can we get the output format to CSV instead of HTML in Alfresco using webscripts?

    - by pavan123
    how Can we change the output format to CSV instead of HTML in Alfresco using webscripts? below are the my corresponding FTL and Webscript files recursive.get.html.ftl <#macro recurse_macro node depth> <#if node.isContainer> <tr> <td> ${node.properties.name} </td> <td></td> </tr> <#list node.children as child> <#if child.isContainer> <@recurse_macro node=child depth=depth+1/> <#list child.children as child2> <#if child2.isDocument> <tr><td></td><td>${child2.properties.name}</td></tr> </#if> </#list> </#if> </#list> </#if> </#macro> Recursive Listing of Spaces & Documents: Space Document recursive.get.desc.xml <webscript> <shortname>recurcive</shortname> <description>Recursive</description> <url>/sample/recursive/{recursive}</url> <format default="html">extension</format> <authentication>guest</authentication> </webscript> and html output is Recursive Listing of Spaces & Documents: Space Document Company Home Data Dictionary Space Templates Software Engineering Project Documentation Drafts Pending Approval Published Samples system-overview.html Discussions UI Design Presentations Quality Assurance Presentation Templates doc_info.ftl localizable.ftl my_docs.ftl my_spaces.ftl my_summary.ftl translatable.ftl recent_docs.ftl general_example.ftl my_docs_inline.ftl show_audit.ftl readme.ftl Email Templates notify_user_email.ftl invite_user_email.ftl RSS Templates RSS_2.0_recent_docs.ftl Saved Searches admin Scripts backup.js example test script.js backup and log.js append copyright.js alfresco docs.js test return value.js Web Scripts org alfresco sample blogsearch.get.js blogsearch.get.atom.ftl blogsearch.get.desc.xml blogsearch.get.html.ftl blogsearch.get.html.400.ftl blogsearch.get.atom.400.ftl categorysearch.get.js categorysearch.get.atom.ftl categorysearch.get.desc.xml categorysearch.get.html.ftl categorysearch.get.html.404.ftl categorysearch.get.atom.404.ftl folder.get.js folder.get.atom.ftl folder.get.desc.xml folder.get.html.ftl avmstores.get.desc.xml avmstores.get.html.ftl avmbrowse.get.js avmbrowse.get.desc.xml avmbrowse.get.html.ftl recursive.get.desc.xml recursive.get.html.ftl sgs.get.desc.xml sgs.get.csv.ftl sample1.get.desc.xml sample1.get.csv.ftl first.get.desc.xml first.get.text.ftl rag.get.html.ftl rag.get.desc.xml new1.get.desc.xml new1.get.html.ftl excel.get.html.ftl excel.get.desc.xml sgs1.get.desc.xml one.get.html.ftl one.get.desc.xml one.get.js readme.html Web Scripts Extensions readme.html Guest Home Alfresco-Tutorial.pdf User Homes isabel Users Home

    Read the article

  • Strange behavior of move with strings

    - by Umair Ahmed
    I am testing some enhanced string related functions with which I am trying to use move as a way to copy strings around for faster, more efficient use without delving into pointers. While testing a function for making a delimited string from a TStringList, I encountered a strange issue. The compiler referenced the bytes contained through the index when it was empty and when a string was added to it through move, index referenced the characters contained. Here is a small downsized barebone code sample:- unit UI; interface uses System.SysUtils, System.Types, System.UITypes, System.Rtti, System.Classes, System.Variants, FMX.Types, FMX.Controls, FMX.Forms, FMX.Dialogs, FMX.Layouts, FMX.Memo; type TForm1 = class(TForm) Results: TMemo; procedure FormCreate(Sender: TObject); end; var Form1: TForm1; implementation {$R *.fmx} function StringListToDelimitedString ( const AStringList: TStringList; const ADelimiter: String ): String; var Str : String; Temp1 : NativeInt; Temp2 : NativeInt; DelimiterSize : Byte; begin Result := ' '; Temp1 := 0; DelimiterSize := Length ( ADelimiter ) * 2; for Str in AStringList do Temp1 := Temp1 + Length ( Str ); SetLength ( Result, Temp1 ); Temp1 := 1; for Str in AStringList do begin Temp2 := Length ( Str ) * 2; // Here Index references bytes in Result Move ( Str [1], Result [Temp1], Temp2 ); // From here the index seems to address characters instead of bytes in Result Temp1 := Temp1 + Temp2; Move ( ADelimiter [1], Result [Temp1], DelimiterSize ); Temp1 := Temp1 + DelimiterSize; end; end; procedure TForm1.FormCreate(Sender: TObject); var StrList : TStringList; Str : String; begin // Test 1 : StringListToDelimitedString StrList := TStringList.Create; Str := ''; StrList.Add ( 'Hello1' ); StrList.Add ( 'Hello2' ); StrList.Add ( 'Hello3' ); StrList.Add ( 'Hello4' ); Str := StringListToDelimitedString ( StrList, ';' ); Results.Lines.Add ( Str ); StrList.Free; end; end. Please devise a solution and if possible, some explanation. Alternatives are welcome too.

    Read the article

  • Crashes in Core Data's Inferred Mapping Model Creation (Lightweight Migration). Threading Issue?

    - by enchilada
    I'm getting random crashes when creating an inferred mapping model (with Core Data's lightweight migration) within my application. By the way, I have to do it programmatically in my application while it is running. This is how I create this model (after I have made proper currentModel and newModel objects, of course): NSMappingModel *mappingModel = [NSMappingModel inferredMappingModelForSourceModel:currentModel destinationModel:newModel error:&error]; The problem is this: This method is crashing randomly. When it works, it works just fine without issues. But when it crashes, it crashes my application (instead of returning nil to signify that the method failed, as it should). By randomly, I mean that sometimes it happens and sometimes not. It is unpredictable. Now, here is the deal: I'm running this method in another thread. More precisely, it is located inside a block that is passed via GCD to run on the global main queue. I need to do this for my UI to appear crisp to the user, i.e. so that I can display a progress indicator while the work is underway. The strange thing seems to be that if I remove the GCD stuff and just let it run on the main thread, it seems to be working fine and never crashing. Thus, could it be because I'm running this on a different thread that this is crashing? I somehow find that weird because I don't believe I'm breaking any Core Data rules regarding multi-threading. In particular, I'm not passing any managed objects around, and whenever I need access to the MOC, I create a new MOC, i.e. I'm not relying on any MOC (or for that matter: anything) that has been created earlier on the main thread. Besides the little MOC stuff that occurs, occurs after the mapping model creation method, i.e. after the point at which the app crashes, so it can't possibly be a cause of the crashes under consideration here. All I'm doing is taking two MOMs and asking for a mapping model between them. That can't be wrong even under threading, now can it? Any ideas on what could be going on?

    Read the article

  • Exception: attempt to acquire a reference on a close SQLiteClosable

    - by CommonsWare
    I posted this back in May on the [android-developers] Google Group. I never heard back and was not able to reproduce the problem until one of my students did last week. I figured I'd post it here and see if it rang any bells for anyone. In one of my code samples, I have the following method: static Cursor getAll(SQLiteDatabase db, String orderBy) { return(db.rawQuery("SELECT * FROM restaurants "+orderBy, null)); } When I run it, sporadically, I get this: 05-01 14:45:05.849: ERROR/AndroidRuntime(1145): java.lang.IllegalStateException: attempt to acquire a reference on a close SQLiteClosable 05-01 14:45:05.849: ERROR/AndroidRuntime(1145): at android.database.sqlite.SQLiteClosable.acquireReference(SQLiteClosable.java:31) 05-01 14:45:05.849: ERROR/AndroidRuntime(1145): at android.database.sqlite.SQLiteProgram.<init>(SQLiteProgram.java:56) 05-01 14:45:05.849: ERROR/AndroidRuntime(1145): at android.database.sqlite.SQLiteQuery.<init>(SQLiteQuery.java:49) 05-01 14:45:05.849: ERROR/AndroidRuntime(1145): at android.database.sqlite.SQLiteDirectCursorDriver.query(SQLiteDirectCursorDriver.java:49) 05-01 14:45:05.849: ERROR/AndroidRuntime(1145): at android.database.sqlite.SQLiteDatabase.rawQueryWithFactory(SQLiteDatabase.java:1118) 05-01 14:45:05.849: ERROR/AndroidRuntime(1145): at android.database.sqlite.SQLiteDatabase.rawQuery(SQLiteDatabase.java:1092) 05-01 14:45:05.849: ERROR/AndroidRuntime(1145): at apt.tutorial.Restaurant.getAll(Restaurant.java:14) This makes no sense to me. The database is definitely open. The SQLiteClosable is the SQLiteQuery created by SQLiteQueryDriver, and I see no evidence that there is an object pool or something going on here that might explain how a "new" SQLiteClosable is already closed. The fact that it is sporadic (meaning the same UI operations sometimes trigger the exception, but not always) suggests some sort of pool, race condition, or something...but I'm not sure where. Thoughts? Thanks! UPDATE: The code in question is from the LunchList tutorials out of my Android Programming Tutorials book. It's a bit spread out and not terribly suitable for posting directly in SO. You can download the code for that book from the above link if you want to take a look at it. I do not recall exactly which edition of the tutorial the student was working on at the time, though it was in the Tutorial 12-Tutorial 16 range. I was mostly hoping to run across somebody who had tripped over this problem before and had a likely culprit. I'm fairly certain my database is open. Thanks again!

    Read the article

  • NSOperation inside NSOperationQueue not being executed

    - by Martin Garcia
    I really need help here. I'm desperate at this point. I have NSOperation that when added to the NSOperationQueue is not being triggered. I added some logging to see the NSOperation status and this is the result: Queue operations count = 1 Queue isSuspended = 0 Operation isCancelled? = 0 Operation isConcurrent? = 0 Operation isFinished? = 0 Operation isExecuted? = 0 Operation isReady? = 1 Operation dependencies? = 0 The code is very simple. Nothing special. LoadingConflictEvents_iPad *loadingEvents = [[LoadingConflictEvents_iPad alloc] initWithNibName:@"LoadingConflictEvents_iPad" bundle:[NSBundle mainBundle]]; loadingEvents.modalPresentationStyle = UIModalPresentationFormSheet; loadingEvents.conflictOpDelegate = self; [self presentModalViewController:loadingEvents animated:NO]; [loadingEvents release]; ConflictEventOperation *operation = [[ConflictEventOperation alloc] initWithParameters:wiLr.formNumber pWI_ID:wiLr.wi_id]; [queue addOperation:operation]; NSLog(@"Queue operations count = %d",[queue operationCount]); NSLog(@"Queue isSuspended = %d",[queue isSuspended]); NSLog(@"Operation isCancelled? = %d",[operation isCancelled]); NSLog(@"Operation isConcurrent? = %d",[operation isConcurrent]); NSLog(@"Operation isFinished? = %d",[operation isFinished]); NSLog(@"Operation isExecuted? = %d",[operation isExecuting]); NSLog(@"Operation isReady? = %d",[operation isReady]); NSLog(@"Operation dependencies? = %d",[[operation dependencies] count]); [operation release]; Now my operation do many things on the main method, but the problem is never being called. The main is never executed. The most weird thing (believe me, I'm not crazy .. yet). If I put a break point in any NSLog line or in the creation of the operation the main method will be called and everything will work perfectly. This have been working fine for a long time. I have been making some changes recently and apparently something screw things up. One of those changes was to upgrade the device to iOS 5.1 SDK (iPad). To add something, I have the iPhone (iOS 5.1) version of this application that use the same NSOperation object. The difference is in the UI only, and everything works fine. Any help will be really appreciated. Regards,

    Read the article

  • JQuery in ASP.NET - Form Validation Issue

    - by user1026288
    It's not working at all and I'm not sure why. Ideally I'd like to have all the errors pop up in a modal dialog box. But right now I can't even get it to work normally. Any help would be appreciated. Thanks. HTML <html xmlns="http://www.w3.org/1999/xhtml"> <head runat="server"> <title></title> <script src="https://ajax.googleapis.com/ajax/libs/jquery/1.7.0/jquery.min.js" type="text/javascript"></script> <script src="https://ajax.googleapis.com/ajax/libs/jqueryui/1.8.16/jquery-ui.min.js" type="text/javascript"></script> <script src="http://ajax.microsoft.com/ajax/jquery.validate/1.7/jquery.validate.min.js" type="text/javascript"></script> <script src="../Scripts/Frame.js" type="text/javascript"></script> </head> <body runat="server" id="bodyLogin"> <div runat="server" id="frameLogin"> <form runat="server" id="formLogin"> <asp:CheckBox runat="server" ID="checkboxRemember" /> <div><span id="un">Username</span><div id="forgotUsername">?</div><br /> <asp:TextBox runat="server" ID="textUsername" Name="username" /></div> <div><span id="pw">Password</span><div id="forgotPassword">?</div><br /> <asp:TextBox runat="server" ID="textPassword" Name="password" TextMode="Password" /></div> <asp:Button runat="server" ID="buttonLogin" Text="L" /> <asp:Button runat="server" ID="buttonRegister" Text="R" /> </form> </div> <div id="dialog" title="Errors" style="display:none;"><ul></ul></div> </body> </html> JQuery <script type="text/javascript"> $(function () { $("#formLogin").validate({ rules: { username: { required:true, minlength:3, maxlength:15 }, password: { required:true, minlength:6, maxlength:15 }, }, messages: { username: { required: "Username is required.", minlength: "Username minimum length is 3 characters.", maxlength: "Username maxumum length is 15 characters." }, password: { required: "Password is required.", minlength: "Password minumum length is 6 characters.", maxlength: "Password maximum length is 15 characters." } } }); }); </script>

    Read the article

  • Using a Button to navigate to another Page in a NavigationWindow

    - by Will
    I'm trying to use the navigation command framework in WPF to navigate between Pages within a WPF application (desktop; not XBAP or Silverlight). I believe I have everything configured correctly, yet its not working. I build and run without errors, I'm not getting any binding errors in the Output window, but my navigation button is disabled. Here's the app.xaml for a sample app: <Application x:Class="Navigation.App" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" StartupUri="First.xaml"> </Application> Note the StartupUri points to First.xaml. First.xaml is a Page. WPF automatically hosts my page in a NavigationWindow. Here's First.xaml: <Page x:Class="Navigation.First" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" Title="First"> <Grid> <Button CommandParameter="/Second.xaml" CommandTarget="{Binding RelativeSource= {RelativeSource FindAncestor, AncestorType={x:Type NavigationWindow}}}" Command="NavigationCommands.GoToPage" Content="Go!"/> </Grid> </Page> The button's CommandTarget is set to the NavigationWindow. The command is GoToPage, and the page is /Second.xaml. I've tried setting the CommandTarget to the containing Page, the CommandParameter to "Second.xaml" (First.xaml and Second.xaml are both in the root of the solution), and I've tried leaving the CommandTarget empty. I've also tried setting the Path to the Binding to various navigational-related public properties on the NavigationWindow. Nothing has worked so far. What am I missing here? I really don't want to do my navigation in code. Clarification. If, instead of using a button, I use a Hyperlink: <Grid> <TextBlock> <Hyperlink NavigateUri="Second.xaml">Go! </Hyperlink> </TextBlock> </Grid> everything works as expected. However, my UI requirements means that using a Hyperlink is right out. I need a big fatty button for people to press. That's why I want to use the button to navigate. I just want to know how I can get the Button to provide the same ability that the Hyperlink does in this case.

    Read the article

  • HTML5 <audio> Safari live broadcast vs not

    - by Peter Parente
    I'm attempting to embed an HTML5 audio element pointing to MP3 or OGG data served by a PHP file . When I view the page in Safari, the controls appear, but the UI says "Live Broadcast." When I click play, the audio starts as expected. Once it ends, however, I can't start it playing again by clicking play. Even using the JS API on the audio element and setting currentTime to 0 fails with an index error exception. I suspected the headers from the PHP script were the problem, particularly missing a content length. But that's not the case. The response headers include a proper Content- Length to indicate the audio has finite size. Furthermore, everything works as expected in Firefox 3.5+. I can click play on the audio element multiple times to hear the sound replay. If I remove the PHP script from the equation and serve up a static copy of the MP3 file, everything works fine in Safari. Does this mean Safari is treating audio src URLs with query parameters differently than URLs that don't have them? Anyone have any luck getting this to work? My simple example page is: <!DOCTYPE html> <html> <head></head> <body> <audio controls autobuffer> <source src="say.php?text=this%20is%20a%20test&format=.ogg" /> <source src="say.php?text=this%20is%20a%20test&format=.mp3" /> </audio> </body> </html> HTTP Headers from PHP script: HTTP/1.x 200 OK Date: Sun, 03 Jan 2010 15:39:34 GMT Server: Apache X-Powered-By: PHP/5.2.10 Content-Length: 8993 Keep-Alive: timeout=2, max=98 Connection: Keep-Alive Content-Type: audio/mpeg HTTP Headers from direct file access: HTTP/1.x 200 OK Date: Sun, 03 Jan 2010 20:06:59 GMT Server: Apache Last-Modified: Sun, 03 Jan 2010 03:20:02 GMT Etag: "a404b-c3f-47c3a14937c80" Accept-Ranges: bytes Content-Length: 8993 Keep-Alive: timeout=2, max=100 Connection: Keep-Alive Content-Type: audio/mpeg I tried hard-coding the Accept-Ranges header into the script too, but no luck.

    Read the article

  • How to return the date value from DatePickerDialog in Android?

    - by user1855222
    I am new to android . I ve created a Date picker in android using following guide .http://developer.android.com/guide/topics/ui/controls/pickers.html public class DatePickerFragment extends DialogFragment implements DatePickerDialog.OnDateSetListener { StringBuilder sb = new StringBuilder(); public static String date; @Override public Dialog onCreateDialog(Bundle savedInstanceState) { // Use the current date as the default date in the picker final Calendar c = Calendar.getInstance(); int year = c.get(Calendar.YEAR); int month = c.get(Calendar.MONTH); int day = c.get(Calendar.DAY_OF_MONTH); // Create a new instance of DatePickerDialog and return it return new DatePickerDialog(getActivity(), this, year, month, day); } public void onDateSet(DatePicker view, int year, int month, int day) { // Do something with the date chosen by the user sb.append(year); sb.append('-'); sb.append(month+1); sb.append('-'); sb.append(day); date = sb.toString(); System.out.println("The date is "+date); } I need to return this date value (date = sb.toString()) to my MainActivity . Since the onDateSet method is void what should I do ? Additional Information - DatePickerDialog Triggers at the MainActivity class ,But not with single button click . There are several processes happens in side a single button , Date picker will triggers only when certain condition is met . I do not want to display the date value either . Just want it returned for further processing. Appreciate any kind of guidance Changed onDataset method and justshow() public void onDateSet(DatePicker view, int year, int month, int day) { // Do something with the date chosen by the user sb.append(year); sb.append('-'); sb.append(month+1); sb.append('-'); sb.append(day); date = sb.toString(); MainActivity.newdate=sb.toString(); System.out.println("The date is "+MainActivity.newdate); } public void justShow(){ System.out.println("The date is "+MainActivity.newdate); } This is the relevant Part From Main(After making changes suggested in first reply ) DateToken mydate=new DateToken(); String test=dayvals.get(0); DialogFragment df=new DatePickerFragment(); if(test.equalsIgnoreCase("day")){ df.show(getSupportFragmentManager(), "DatePik"); } System.out.println("Date is on Main"+newdate); DatePickerFragment dpf=new DatePickerFragment(); dpf.justShow(); newdate is the static String , but still outputs null. In both MainActivity and justShow methods . But in onDataSet method date outputs correctly

    Read the article

  • Web image loaded by thread in android

    - by Bostjan
    I have an extended BaseAdapter in a ListActivity: private static class RequestAdapter extends BaseAdapter { and some handlers and runnables defined in it // Need handler for callbacks to the UI thread final Handler mHandler = new Handler(); // Create runnable for posting final Runnable mUpdateResults = new Runnable() { public void run() { loadAvatar(); } }; protected static void loadAvatar() { // TODO Auto-generated method stub //ava.setImageBitmap(getImageBitmap("URL"+pic)); buddyIcon.setImageBitmap(avatar); } In the getView function of the Adapter, I'm getting the view like this: if (convertView == null) { convertView = mInflater.inflate(R.layout.messageitem, null); // Creates a ViewHolder and store references to the two children views // we want to bind data to. holder = new ViewHolder(); holder.username = (TextView) convertView.findViewById(R.id.username); holder.date = (TextView) convertView.findViewById(R.id.dateValue); holder.time = (TextView) convertView.findViewById(R.id.timeValue); holder.notType = (TextView) convertView.findViewById(R.id.notType); holder.newMsg = (ImageView) convertView.findViewById(R.id.newMsg); holder.realUsername = (TextView) convertView.findViewById(R.id.realUsername); holder.replied = (ImageView) convertView.findViewById(R.id.replied); holder.msgID = (TextView) convertView.findViewById(R.id.msgID_fr); holder.avatar = (ImageView) convertView.findViewById(R.id.buddyIcon); holder.msgPreview = (TextView) convertView.findViewById(R.id.msgPreview); convertView.setTag(holder); } else { // Get the ViewHolder back to get fast access to the TextView // and the ImageView. holder = (ViewHolder) convertView.getTag(); } and the image is getting loaded this way: Thread sepThread = new Thread() { public void run() { String ava; ava = request[8].replace(".", "_micro."); Log.e("ava thread",ava+", username: "+request[0]); avatar = getImageBitmap(URL+ava); buddyIcon = holder.avatar; mHandler.post(mUpdateResults); //holder.avatar.setImageBitmap(getImageBitmap(URL+ava)); } }; sepThread.start(); Now, the problem I'm having is that if there are more items that need to display the same picture, not all of those pictures get displayed. When you scroll up and down the list maybe you end up filling all of them. When I tried the commented out line (holder.avatar.setImageBitmap...) the app sometimes force closes with "only the thread that created the view can request...". But only sometimes. Any idea how I can fix this? Either option.

    Read the article

  • WCF Service with callbacks coming from background thread?

    - by Mark Struzinski
    Here is my situation. I have written a WCF service which calls into one of our vendor's code bases to perform operations, such as Login, Logout, etc. A requirement of this operation is that we have a background thread to receive events as a result of that action. For example, the Login action is sent on the main thread. Then, several events are received back from the vendor service as a result of the login. There can be 1, 2, or several events received. The background thread, which runs on a timer, receives these events and fires an event in the wcf service to notify that a new event has arrived. I have implemented the WCF service in Duplex mode, and planned to use callbacks to notify the UI that events have arrived. Here is my question: How do I send new events from the background thread to the thread which is executing the service? Right now, when I call OperationContext.Current.GetCallbackChannel<IMyCallback>(), the OperationContext is null. Is there a standard pattern to get around this? I am using PerSession as my SessionMode on the ServiceContract. UPDATE: I thought I'd make my exact scenario clearer by demonstrating how I'm receiving events from the vendor code. My library receives each event, determines what the event is, and fires off an event for that particular occurrence. I have another project which is a class library specifically for connecting to the vendor service. I'll post the entire implementation of the service to give a clearer picture: [ServiceBehavior( InstanceContextMode = InstanceContextMode.PerSession )] public class VendorServer:IVendorServer { private IVendorService _vendorService; // This is the reference to my class library public VendorServer() { _vendorServer = new VendorServer(); _vendorServer.AgentManager.AgentLoggedIn += AgentManager_AgentLoggedIn; // This is the eventhandler for the event which arrives from a background thread } public void Login(string userName, string password, string stationId) { _vendorService.Login(userName, password, stationId); // This is a direct call from the main thread to the vendor service to log in } private void AgentManager_AgentLoggedIn(object sender, EventArgs e) { var agentEvent = new AgentEvent { AgentEventType = AgentEventType.Login, EventArgs = e }; } } The AgentEvent object contains the callback as one of its properties, and I was thinking I'd perform the callback like this: agentEvent.Callback = OperationContext.Current.GetCallbackChannel<ICallback>(); How would I pass the OperationContext.Current instance from the main thread into the background thread?

    Read the article

  • how to drag a 'div' element to the google maps ,that be changed to a 'marker'..use jquery

    - by zjm1126
    this is my code : <!DOCTYPE html PUBLIC "-//WAPFORUM//DTD XHTML Mobile 1.0//EN" "http://www.wapforum.org/DTD/xhtml-mobile10.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" > <head> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8"> <meta name="viewport" content="width=device-width,minimum-scale=1.0,maximum-scale=1.0,user-scalable=no"> </head> <body onload="initialize()" onunload="GUnload()"> <style type="text/css"> </style> <div id="map_canvas" style="width: 500px; height: 300px;float:left;"></div> <div id=b style="width: 50px; height: 50px;background:red;float:left;margin-left:300px;"></div> <script src="jquery-1.4.2.js" type="text/javascript"></script> <script src="jquery-ui-1.8rc3.custom.min.js" type="text/javascript"></script> <script src="http://ditu.google.cn/maps?file=api&amp;v=2&amp;key=ABQIAAAA-7cuV3vqp7w6zUNiN_F4uBRi_j0U6kJrkFvY4-OX2XYmEAa76BSNz0ifabgugotzJgrxyodPDmheRA&sensor=false"type="text/javascript"></script> <script type="text/javascript"> //********** function initialize() { if (GBrowserIsCompatible()) { // function createMarker(point, number) { var marker = new GMarker(point); var message = ["?","?","?","??","??"]; marker.value = number; GEvent.addListener(marker, "click", function() { var myHtml = "<b>#" + number + "</b><br/>" + message[number -1]; map.openInfoWindowHtml(point, myHtml); }); return marker; } // var map = new GMap2(document.getElementById("map_canvas")); map.setCenter(new GLatLng(39.9493, 116.3975), 13); // Add 5 markers to the map at random locations var bounds = map.getBounds(); var southWest = bounds.getSouthWest(); var northEast = bounds.getNorthEast(); var lngSpan = northEast.lng() - southWest.lng(); var latSpan = northEast.lat() - southWest.lat(); for (var i = 0; i < 5; i++) { var point = new GLatLng(southWest.lat() + latSpan * Math.random(), southWest.lng() + lngSpan * Math.random()); map.addOverlay(createMarker(point, i + 1)); } } } //************* $("#b").draggable(); </script> </body> </html>

    Read the article

  • What's wrong with this code? Values not saved to db

    - by Scott B
    Been trying to get this code to work for several days now to no avail. I'm at wits end. I've managed, with the code below, to create a customized category picker widget that appears on the PAGE editor. However, for the life of me, I cannot get the checked categories to save. function my_post_options_box() { if ( function_exists('add_meta_box') ) { //add_meta_box( $id, $title, $callback, $page, $context, $priority ); add_meta_box('categorydiv', __('Page Options'), 'post_categories_meta_box_modified', 'page', 'side', 'core'); } } //adds the custom categories box function post_categories_meta_box_modified($post) { $noindexCat = get_cat_ID('noindex'); $nofollowCat = get_cat_ID('nofollow'); if(in_category("noindex")){ $noindexChecked = " checked='checked'";} else {$noindexChecked = "";} if(in_category("nofollow")){ $nofollowChecked = " checked='checked'";} else {$noindexChecked = "";} ?> <div id="categories-all" class="ui-tabs-panel"> <ul id="categorychecklist" class="list:category categorychecklist form-no-clear"> <li id='category-<?php echo $noindexCat ?>' class="popular-category"><label class="selectit"><input value="<?php echo $noindexCat ?>" type="checkbox" name="post_category[]" id="in-category-<?php echo $noindexCat ?>"<?php echo $noindexChecked ?> /> noindex</label></li> <li id='category-<?php echo $nofollowCat ?>' class="popular-category"><label class="selectit"><input value="<?php echo $noindexCat ?>" type="checkbox" name="post_category[]" id="in-category-<?php echo $nofollowCat ?>"<?php echo $nofollowChecked ?> /> nofollow</label></li> <li id='category-1' class="popular-category"><label class="selectit"><input value="1" type="checkbox" name="post_category[]" id="in-category-1" checked="checked"/> Uncategorized</label></li> </ul> </div> <?php }

    Read the article

  • Is there a recommended approach to handle saving data in response to within-site navigation without

    - by Carvell Fenton
    Hello all, Preamble to scope my question: I have a web app (or site, this is an internal LAN site) that uses jQuery and AJAX extensively to dynamically load the content section of the UI in the browser. A user navigates the app using a navigation menu. Clicking an item in the navigation menu makes an AJAX call to php, and php then returns the content that is used to populate the central content section. One of the pages served back by php has a table form, set up like a spreadsheet, that the user enters values into. This table is always kept in sync with data in the database. So, when the table is created, is it populated with the relevant database data. Then when the user makes a change in a "cell", that change immediately is written back to the database so the table and database are always in sync. This approach was take to reassure users that the data they entered has been saved (long story...), and to alleviate them from having to click a save button of some kind. So, this always in sync idea is great, except that a user can enter a value in a cell, not take focus out of the cell, and then take any number of actions that would cause that last value to be lost: e.g. navigate to another section of the site via the navigation menu, log out of the app, close the browser, etc. End of preamble, on to the issue: I initially thought that wasn't a problem, because I would just track what data was "dirty" or not saved, and then in the onunload event I would do a final write to the database. Herein lies the rub: because of my clever (or not so clever, not sure) use of AJAX and dynamically loading the content section, the user never actually leaves the original url, or page, when the above actions are taken, with the exception of closing the browser. Therefore, the onunload event does not fire, and I am back to losing the last data again. My question, is there a recommended way to handle figuring out if a person is navigating away from a "section" of your app when content is dynamically loaded this way? I can come up with a solution I think, that involves globals and tracking the currently viewed page, but I thought I would check if there might be a more elegant solution out there, or a change I could make in my design, that would make this work. Thanks in advance as always!

    Read the article

  • How can I ignore an http request without clearing the browser?

    - by Timid Developer
    To prevent duplicate requests (i.e. pressing F5 right after clicking a command button), I've setup my page base class to ignore the request if it's detected as a duplicate. When I say 'ignore' I mean Response.End() Now I thought I've seen this work before, where there's an issue, I just Response.End() and the users page just does nothing. I don't know the exact circumstance in which this worked, but I'm unable to repeat it now. Now when I call Response.End(), I just get an empty browser. More specifically, I get this html. <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0 Transitional//EN"> <HTML><HEAD> <META http-equiv=Content-Type content="text/html; charset=utf-8"></HEAD> <BODY></BODY></HTML> I setup the following test app to confirm the problem is not elsewhere in my app. Here it is: Add the following to an aspx form <asp:Label ID="lbl" Text="0" runat="server" /><br /> <asp:Button ID="btnAdd1" Text="Add 1" runat="server" /><br /> <asp:Button ID="btnAdd2" Text="Add 2" runat="server" /><br /> <asp:Button ID="btnAdd3" Text="Add 3" runat="server" /><br /> And here's the code behind file using System; namespace TestDupRequestCancellation { public partial class _Default : System.Web.UI.Page { protected void Page_Init(object sender, EventArgs e) { btnAdd1.Click += btnAdd1_Click; btnAdd2.Click += btnAdd2_Click; btnAdd3.Click += btnAdd3_Click; } protected void Page_Load(object sender, EventArgs e) { if (!IsPostBack) CurrentValue = 0; else if (Int32.Parse(lbl.Text) != CurrentValue) Response.End(); } protected void Page_PreRender(object sender, EventArgs e) { lbl.Text = CurrentValue.ToString(); } protected int CurrentValue { get { return Int32.Parse(Session["CurrentValue"].ToString()); } set { Session["CurrentValue"] = value.ToString(); } } void btnAdd3_Click(object sender, EventArgs e) { CurrentValue += 3; } void btnAdd2_Click(object sender, EventArgs e) { CurrentValue += 2; } void btnAdd1_Click(object sender, EventArgs e) { CurrentValue += 1; } } } When you load the page, clicking any button does what is expected, but if you press F5 at any time after pressing one of the buttons, it will detect it as a duplicate request and call Response.End() which promptly ends the task. Which leaves the user with an empty browser. Is there anyway to leave the user with the page as it was, so they can just click a button? Also; please note that this code is the simplest code I could come up with to demonstrate my problem. It's not meant to demonstrate how to check for dup requests.

    Read the article

  • If we don't like it for the presentation layer, then why do we tolerate it for the behavior layer?

    - by greim
    Suppose CSS as we know it had never been invented, and the closest we could get was to do this: <script> // this is the page's stylesheet $(document).ready(function(){ $('.error').css({'color':'red'}); $('a[href]').css({'textDecoration':'none'}); ... }); </script> If this was how we were forced to write code, would we put up with it? Or would every developer on Earth scream at browser vendors until they standardized upon CSS, or at least some kind of declarative style language? Maybe CSS isn't perfect, but hopefully it's obvious how it's better than the find things, do stuff method shown above. So my question is this. We've seen and tasted of the glory of declarative binding with CSS, so why, when it comes to the behavioral/interactive layer, does the entire JavaScript community seem complacent about continuing to use the kludgy procedural method described above? Why for example is this considered by many to be the best possible way to do things: <script> $(document).ready(function(){ $('.widget').append("<a class='button' href='#'>...</div>"); $('a[href]').click(function(){...}); ... }); </script> Why isn't there a massive push to get XBL2.0 or .htc files or some kind of declarative behavior syntax implemented in a standard way across browsers? Is this recognized as a need by other web development professionals? Is there anything on the horizon for HTML5? (Caveats, disclaimers, etc: I realize that it's not a perfect world and that we're playing the hand we've been dealt. My point isn't to criticize the current way of doing things so much as to criticize the complacency that exists about the current way of doing things. Secondly, event delegation, especially at the root level, is a step closer to having a declarative behavior layer. It solves a subset of the problem, but it can't create UI elements, so the overall problem remains.)

    Read the article

< Previous Page | 427 428 429 430 431 432 433 434 435 436 437 438  | Next Page >