Search Results

Search found 88909 results on 3557 pages for 'inline code'.

Page 438/3557 | < Previous Page | 434 435 436 437 438 439 440 441 442 443 444 445  | Next Page >

  • JQGrid and JQuery Autocomplete

    - by Neff
    When implementing JQGrid 4.3.0, Jquery 1.6.2, and JQuery UI 1.8.16 Ive come across an issue with the Inline edit. When the inline edit is activated, some of the elements get assigned an auto complete. When the inline edit is canceld or saved, the auto complete does not always go away (selecting text by double clicking it then hitting delete, then hitting escape to exit row edit). Leaving the auto complete controls in edit mode when the row is no longer considered in edit mode. Perhaps you can tell me if there is a problem with the initialization or if I you are aware of an event post-"afterrestorefunc" that the fields can be returned to their "original" state. Original state being displayed as data in the JQGrid row. I've tried removing the DOM after row close, .remove() and .empty(): ... "afterrestorefunc": function(){ $('.ui-autocomplete-input').remove(); } ... but that causes other issues, such as the jqgrid is not able to find the cell when serializing the row for data or edit, and requires a refresh of the page, not just jqgrid, to be able to once again see the data from that row. Auto complete functionality for the element is created on the double click of the row: function CreateCustomSearchElement(value, options, selectiontype) { ... var el; el = document.createElement("input"); ... $(el).autocomplete({ source: function (request, response) { $.ajax({ url: '<%=ResolveUrl("~/Services/AutoCompleteService.asmx/GetAutoCompleteResponse") %>', data: "{ 'prefixText': '" + request.term + "', 'contextKey': '" + options.name + "'}", dataType: "json", type: "POST", contentType: "application/json; charset=utf-8", success: function (data) { response($.map(data.d, function (item) { return { label: Trim(item), value: Trim(item), searchVal: Trim(item) } })) } }); }, select: function (e, item) { //Select is on the event of selection where the value and label have already been determined. }, minLength: 1, change: function (event, ui) { //if the active element was not the search button //... } }).keyup(function (e) { if (e.keyCode == 8 || e.keyCode == 46) { //If the user hits backspace or delete, check the value of the textbox before setting the searchValue //... } }).keydown(function (e) { //if keycode is enter key and there is a value, you need to validate the data through select or change(onblur) if (e.keyCode == '13' && ($(el).val())) { return false; } if (e.keyCode == '220') { return false } }); } Other Sources: http://www.trirand.com/jqgridwiki/doku.php?id=wiki:inline_editing http://api.jqueryui.com/autocomplete/ Update: I tried only creating the autocomplete when the element was focused, and removing it when onblur. That did not resolve the issue either. It seems to just need the autocomplete dropdown to be triggered.

    Read the article

  • I'm getting an error in my Java code but I can't see whats wrong with it. Help?

    - by Fraz
    The error i'm getting is in the fillPayroll() method in the while loop where it says payroll.add(employee). The error says I can't invoke add() on an array type Person but the Employee class inherits from Person so I thought this would be possible. Can anyone clarify this for me? import java.io.*; import java.util.*; public class Payroll { private int monthlyPay, tax; private Person [] payroll = new Person [1]; //Method adds person to payroll array public void add(Person person) { if(payroll[0] == null) //If array is empty, fill first element with person { payroll[payroll.length-1] = person; } else //Creates copy of payroll with new person added { Person [] newPayroll = new Person [payroll.length+1]; for(int i = 0;i<payroll.length;i++) { newPayroll[i] = payroll[i]; } newPayroll[newPayroll.length] = person; payroll = newPayroll; } } public void fillPayroll() { try { FileReader fromEmployee = new FileReader ("EmployeeData.txt"); Scanner data = new Scanner(fromEmployee); Employee employee = new Employee(); while (data.hasNextLine()) { employee.readData(data.nextLine()); payroll.add(employee); } } catch (FileNotFoundException e) { System.out.println("Error: File Not Found"); } } }

    Read the article

  • Turn off enclosing <p> tags in CKEditor 3.0

    - by Kosi2801
    Is there a possibility to turn off the automatic enclosing of all written content within <p></p> in CKEditor 3.x? I tried CKEDITOR.config.enterMode = CKEDITOR.ENTER_BR; but this just changes the inline linebreaks to <br /> while leaving the enclosing paragraph. Currently writing "Test" produces this output <p> Test</p> but I want it to be simply Test Is there a configuration property for this or would another inline editor to be better suited for this?

    Read the article

  • usage of try catch

    - by Muhammed Rauf K
    Which is best: Code Snippet 1 or Code Snippet 2 ? And Why? /* Code Snippet 1 * * Write try-catch in function definition */ void Main(string[] args) { AddMe(); } void AddMe() { try { // Do operations... } catch(Exception e) { } } /* Code Snippet 2 * * Write try-catch where we call the function. */ void Main(string[] args) { try { AddMe(); } catch (Exception e) { } } void AddMe() { // Do operations... }

    Read the article

  • TFS CM resource recommendations / some questions

    - by John
    I am working with a small development shop that consists of a group of 5 developers and 1 QA person. We are using TFS and need to get more sophisticated on how we use this tool. Currently the development team checks in their code each evening. A nightly build runs and pushes the output out on a network share. Our QA person uses this build for testing the next day. Sometimes the build off the trunk codebase has issues/bugs that hinder the QA process, and it hasn’t been a giant issue in the past, but we now want to get to a state where we have our QA person testing on a stable QA build. So I believe we need to create a branch (call it QA), and the developers will continue to develop off the trunk, but the QA person will use builds created from code in the QA branch. Seems simple enough, but we have started doing code reviews as well. So we have another desire in that only code that has been code reviewed can be promoted to the QA branch. Each developer works off a TFS item, and when they check in a changeset, they do it against a TFS item which creates a link between a checked in code file and a TFS item. Eventually the TFS item becomes complete and ready for code review. All code attached to the TFS item is reviewed. How can the versions of these files get promoted to the QA branch? In the QA branch, if a bug is found, we want to fix it in the QA branch and have the changes migrated back to the trunk. I believe TFS has a way to automatically do this doesn’t it? Long story short, we want to get to a build and CM environment that I believe is pretty standard, but we are unaware of how to make this happen with TFS. Given our situation above, can someone point out a book or website(s) that would address our specific needs? We would like to make this happen without having to get too deep in CM theory or TFS. I very much appreciate any and all suggestions! Thanks, John

    Read the article

  • requestAccessToEntity for both iOS6 and 5.x - EKEventStore

    - by ShiShi
    following iOS6 eventKit and the new privacy settings I am using the following code - which works perfectly fine on iOS6 devices. Still, I would like the same code to work also for devices with iOS 5.x and I wish not to write a the "same code" twice - Seems wrong. Can anyone assist in an elegant solution ? EKEventStore *eventStore = [[EKEventStore alloc] init]; [eventStore requestAccessToEntityType:EKEntityTypeEvent completion:^(BOOL granted, NSError *error) { // some code }];

    Read the article

  • pure-specifier on function-definition

    - by bebul
    While compiling on GCC I get the error: pure-specifier on function-definition, but not when I compile the same code using VS2005. class Dummy { //error: pure-specifier on function-definition, VS2005 compiles virtual void Process() = 0 {}; }; But when the definition of this pure virtual function is not inline, it works: class Dummy { virtual void Process() = 0; }; void Dummy::Process() {} //compiles on both GCC and VS2005 What does the error means? Why cannot I do it inline? Is it legal to evade the compile issue as shown in the second code sample?

    Read the article

  • Face detection in 100% pure PHP

    - by Yogi Yang 007
    I am looking for PHP script that will detect face in a uploaded photo and automatically crop it accordingly. The code should be in pure PHP without depending on any third party API's or Libs. This code will be a part of our existing code for processing images. In fact this is the only part that is missing! I would prefer to have code in PHP version 5.x not PHP 6.x.

    Read the article

  • JQuery .html() method and external scripts

    - by Marco
    Hi, i'm loading, using the JQuery ajax() method, an external page with both html and javascript code: <script type="text/javascript" src="myfile.js"></script> <p>This is some HTML</p> <script type="text/javascript"> alert("This is inline JS"); </script> and setting the results into a div element, using the html() method. While the html() method properly evaluates the inline JS code, it doesn't download and evaluate the external JS file "myfile.js". Any tip for this issue?

    Read the article

  • How can i combine crystal reports and JAVA SWT?

    - by Armin
    I have to create reports from my application (java, swt). For reports i am using crystal reports, but i have problem, i can't find SWT code that enables me to open (create) and save report. I have found Swing code that enables me to do that, but i cant find SWT code. So can somebody explain me, or give me code, or tutorial that will help me to to that. Tnx.

    Read the article

  • Does changing the order of class private data members breaks ABI

    - by Dmitry Yudakov
    I have a class with number of private data members (some of them static), accessed by virtual and non-virtual member functions. There's no inline functions and no friend classes. class A { int number; string str; static const int static_const_number; public: // got virtual and non-virtual functions, working with these memebers virtual void func1(); void func2(); // no inline functions or friends }; Does changing the order of private data members breaks ABI in this case? class A { string str; static const int static_const_number; int number; // <-- integer member moved here ... };

    Read the article

  • Invoke Python modules from Java

    - by user36813
    I have a Python interface of a graph library written in C - igraph (the name of library). My need is to invoke the python modules pertaining to this graph library from Java code. It goes like this, the core of library is in c. This core has been imported into Python and interfaces to the functions embedded in core are available in Python. My project's rest of the code is in Java and hence I would like to call the graph functions by Java as well. Jython - which lets you invoke python modules with in Java was an option.I went on trying Jython to discover that it will not work in my case as the core code is in C and Jython wont support anything that is imported as a c dll in python code.I also thought of opting for the approach of calling graph routines directly in c. That is without passing through Python code. I am assuming there must be something which lets you call c code from Java, how ever I am not good in C hence I did not go for it. My last resort seems to execute Python interpreter from command line using Java. But that is a dirty and shameless. Also to deal with the results produced by Python code I will have to write the results in a file and read it back in java. Again dirty way. Is there something that any one can suggest me? Thanks to every one giving time. Thanks Igal for answering. I had a look at it. At first glance it appears as if it is simply calling the python script. Jep jep = new Jep(false, SCRIPT_PATH, cl); jep.set("query", query); jep.runScript(SCRIPT_PATH + file); jep.close(); Isnt it very similar to what we would do if called the python interpreter from command line through a Java code. Runtime runtime = Runtime.getRuntime(); Process proc = runtime.exec("python test.py"); Concern is how do I use the results generated by Python script. The naive way is to write them to file and read it back in Java. I am searching for a smarter approach.Thanks for suggestion anyway.

    Read the article

  • CSS Calendar Display

    - by Steven
    I created my own custom date picker consisting of an ASP TextBox, Button, and Calendar complete with CSS styles, javascript code, and event handling vb code. I want to use this date picker multiple times on my form. I know the wrong way to do this would be to copy all the code and just adjust each name accordingly. How can I put those controls, styles, and code into a single entity?

    Read the article

  • No module named difflib

    - by bugbug
    I want to execute python code from C# with following code. static void Main(string[] args) { ScriptEngine engine = Python.CreateEngine(); ScriptSource source = engine.CreateScriptSourceFromFile(@"F:\Script\extracter.py"); source.Execute(); } I have the problem at line source.Execute(), I got error "No module named difflib". What is wrong in my code? This is my python code (extracter.py). import re import itertools import difflib print "Hello"

    Read the article

  • Wordpress css and ie6

    - by marc-andre menard
    my website : http://www.equipe94.com have a two column layout and in ie6 the right column is flushed at the button... it look like and inline problem, but even WITH the inline widget.. it's still at the bottom.. any idea to fix a wordpress template to play well with ie6 ? thanks in advance n.b. As mentioned in the comment... my page don't validate... after fixing the multiples problems now I validate in XHTML 1.0 Strict... but the problem is still there !

    Read the article

  • Migrating from Maven to SBT

    - by Vasil Remeniuk
    Hi people, As you know, SBT is compatible with Maven in some way -- SBT recognizes simple Maven POMs and can use dependencies and repositories specified in them. However, SBT wiki says that, if inline dependency is specified in SBT project definition, POM will be ignored (so using both in this case is impossible): Maven and Ivy configurations (pom.xml and ivy.xml) are ignored when inline dependency declarations are present. Does anyone know, if any kind of converter from Maven POM to SBT project definition exists (translating POM's XML into project definition Scala code)? I'm considering writing such script (that will help to migrate my old Scala/Maven projects to SBT), but want to know first, if this functionality already exists. Thanks in advance.

    Read the article

  • Restructuting XML Data

    - by Frank
    Hi! The following is an excerpt of my XML data source: <file> <ALL_INSTANCES> <instance> <ID>1</ID> <start>5.8633333333</start> <end>29.8216666667</end> <code>Player 1</code> </instance> <instance> <ID>2</ID> <start>28.4566666667</start> <end>51.1450000000</end> <code>Player 2</code> </instance> <instance> <ID>3</ID> <start>49.8383333333</start> <end>71.1150000000</end> <code>Player 3</code> </instance> <instance> <ID>4</ID> <start>72.9850000000</start> <end>95.3766666667</end> <code>Speler 1</code> </instance> </ALL_INSTANCES> I'm looking to restructure this data into something like this: <Player 1> <ID>1</ID> <start>5.8633333333</start> <end>29.8216666667</end> </Player 1> <Player 1> <ID>4</ID> <start>72.9850000000</start> <end>95.3766666667</end> </Player 1> <Player 2> <ID>2</ID> <start>28.4566666667</start> <end>51.1450000000</end> </Player 2> <Player 3> <ID>3</ID> <start>49.8383333333</start> <end>71.1150000000</end> </Player 3> Could anyone please help me to achieve this? Much appreciated! Cheers, Frank

    Read the article

  • jQuery UI draggable() and resizable()

    - by foxlance
    I want to write the draggable() and resizable() code in such a way that all future elements with a particular class will inherit those plugins without calling them again. $('div.resizeMe').resizable({ containment: 'parent', minWidth: 400, minHeight: 200 }) When the above code is executed, all divs with resizeMe class inherits the resizable() function. But if I appended BODY with a new div with the same class, I needed to execute that code again. So my goal here is how to rewrite that code such that it will work for all and including future elements.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • .Net Dynamically Load DLL

    - by hermiod
    I am trying to write some code that will allow me to dynamically load DLLs into my application, depending on an application setting. The idea is that the database to be accessed is set in the application settings and then this loads the appropriate DLL and assigns it to an instance of an interface for my application to access. This is my code at the moment: Dim SQLDataSource As ICRDataLayer Dim ass As Assembly = Assembly. _ LoadFrom("M:\MyProgs\WebService\DynamicAssemblyLoading\SQLServer\bin\Debug\SQLServer.dll") Dim obj As Object = ass.CreateInstance(GetType(ICRDataLayer).ToString, True) SQLDataSource = DirectCast(obj, ICRDataLayer) MsgBox(SQLDataSource.ModuleName & vbNewLine & SQLDataSource.ModuleDescription) I have my interface (ICRDataLayer) and the SQLServer.dll contains an implementation of this interface. I just want to load the assembly and assign it to the SQLDataSource object. The above code just doesn't work. There are no exceptions thrown, even the Msgbox doesn't appear. I would've expected at least the messagebox appearing with nothing in it, but even this doesn't happen! Is there a way to determine if the loaded assembly implements a specific interface. I tried the below but this also doesn't seem to do anything! For Each loadedType As Type In ass.GetTypes If GetType(ICRDataLayer).IsAssignableFrom(loadedType) Then Dim obj1 As Object = ass.CreateInstance(GetType(ICRDataLayer).ToString, True) SQLDataSource = DirectCast(obj1, ICRDataLayer) End If Next EDIT: New code from Vlad's examples: Module CRDataLayerFactory Sub New() End Sub ' class name is a contract, ' should be the same for all plugins Private Function Create() As ICRDataLayer Return New SQLServer() End Function End Module Above is Module in each DLL, converted from Vlad's C# example. Below is my code to bring in the DLL: Dim SQLDataSource As ICRDataLayer Dim ass As Assembly = Assembly. _ LoadFrom("M:\MyProgs\WebService\DynamicAssemblyLoading\SQLServer\bin\Debug\SQLServer.dll") Dim factory As Object = ass.CreateInstance("CRDataLayerFactory", True) Dim t As Type = factory.GetType Dim method As MethodInfo = t.GetMethod("Create") Dim obj As Object = method.Invoke(factory, Nothing) SQLDataSource = DirectCast(obj, ICRDataLayer) EDIT: Implementation based on Paul Kohler's code Dim file As String For Each file In Directory.GetFiles(baseDir, searchPattern, SearchOption.TopDirectoryOnly) Dim assemblyType As System.Type For Each assemblyType In Assembly.LoadFrom(file).GetTypes Dim s As System.Type() = assemblyType.GetInterfaces For Each ty As System.Type In s If ty.Name.Contains("ICRDataLayer") Then MsgBox(ty.Name) plugin = DirectCast(Activator.CreateInstance(assemblyType), ICRDataLayer) MessageBox.Show(plugin.ModuleName) End If Next I get the following error with this code: Unable to cast object of type 'SQLServer.CRDataSource.SQLServer' to type 'DynamicAssemblyLoading.ICRDataLayer'. The actual DLL is in a different project called SQLServer in the same solution as my implementation code. CRDataSource is a namespace and SQLServer is the actual class name of the DLL. The SQLServer class implements ICRDataLayer, so I don't understand why it wouldn't be able to cast it. Is the naming significant here, I wouldn't have thought it would be.

    Read the article

  • What is a good platform for building a game framework targetting both web and native languages?

    - by fuzzyTew
    I would like to develop (or find, if one is already in development) a framework with support for accelerated graphics and sound built on a system flexible enough to compile to the following: native ppc/x86/x86_64/arm binaries or a language which compiles to them javascript actionscript bytecode or a language which compiles to it (actionscript 3, haxe) optionally java I imagine, for example, creating an API where I can open windows and make OpenGL-like calls and the framework maps this in a relatively efficient manner to either WebGL with a canvas object, 3d graphics in Flash, OpenGL ES 2 with EGL, or desktop OpenGL in an X11, Windows, or Cocoa window. I have so far looked into these avenues: Building the game library in haXe Pros: Targets exist for php, javascript, actionscript bytecode, c++ High level, object oriented language Cons: No support for finally{} blocks or destructors, making resource cleanup difficult C++ target does not allow room for producing highly optimized libraries -- the foreign function interface requires all primitive types be boxed in a wrapper object, as if writing bindings for a scripting language; these feel unideal for real-time graphics and audio, especially exporting low-level functions. Doesn't seem quite yet mature Using the C preprocessor to create a translator, writing programs entirely with macros Pros: CPP is widespread and simple to use Cons: This is an arduous task and probably the wrong tool for the job CPP implementations differ widely in support for features (e.g. xcode cpp has no variadic macros despite claiming C99 compliance) There is little-to-no room for optimization in this route Using llvm's support for multiple backends to target c/c++ to web languages Pros: Can code in c/c++ LLVM is a very mature highly optimizing compiler performing e.g. global inlining Targets exist for actionscript (alchemy) and javascript (emscripten) Cons: Actionscript target is closed source, unmaintained, and buggy. Javascript targets do not use features of HTML5 for appropriate optimization (e.g. linear memory with typed arrays) and are immature An LLVM target must convert from low-level bytecode, so high-level constructs are lost and bloated unreadable code is created from translating individual instructions, which may be more difficult for an unprepared JIT to optimize. "jump" instructions cause problems for languages with no "goto" statements. Using libclang to write a translator from C/C++ to web languages Pros: A beautiful parsing library providing easy access to the code structure Can code in C/C++ Has sponsored developer effort from Apple Cons: Incomplete; current feature set targets IDEs. Basic operators are unexposed and must be manually parsed from the returned AST element to be identified. Translating code prior to compilation may forgo optimizations assumed in c/c++ such as inlining. Creating new code generators for clang to translate into web languages Pros: Can code in C/C++ as libclang Cons: There is no API; code structure is unstable A much larger job than using libclang; the innards of clang are complex Building the game library in Common Lisp Pros: Flexible, ancient, well-developed language Extensive introspection should ease writing translators Translators exist for at least javascript Cons: Unfamiliar language No standardized library functions, widely varying implementations Which of these avenues should I pursue? Do you know of any others, or any systems that might be useful? Does a general project like this exist somewhere already? Thank you for any input.

    Read the article

  • hide javascript in php

    - by raja
    hi all i am working on a project, it need email validation when user enter his email address check for availiblity. i wrote the php code in javascript it works fine but my problem is when some see my page source it display all user email address in javascript code. i want hide this one. i wrote javascript code in seperate file but validation is not working. if any one hide how hide javascript code in php, guide me plzz. thanks

    Read the article

  • How to get `gcc` to generate `bts` instruction for x86-64 from standard C?

    - by Norman Ramsey
    Inspired by a recent question, I'd like to know if anyone knows how to get gcc to generate the x86-64 bts instruction (bit test and set) on the Linux x86-64 platforms, without resorting to inline assembly or to nonstandard compiler intrinsics. Related questions: Why doesn't gcc do this for a simple |= operation were the right-hand side has exactly 1 bit set? How to get bts using compiler intrinsics or the asm directive Portability is more important to me than bts, so I won't use and asm directive, and if there's another solution, I prefer not to use compiler instrinsics. EDIT: The C source language does not support atomic operations, so I'm not particularly interested in getting atomic test-and-set (even though that's the original reason for test-and-set to exist in the first place). If I want something atomic I know I have no chance of doing it with standard C source: it has to be an intrinsic, a library function, or inline assembly. (I have implemented atomic operations in compilers that support multiple threads.)

    Read the article

< Previous Page | 434 435 436 437 438 439 440 441 442 443 444 445  | Next Page >